Your browser is old and dusty. Try Google Chrome!

Details for sll0552

ORF sll0552
Accession NP_442411.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -208 -222 14.4542 0.0392
NP_441061.1_2 Reverse -25 -39 6.6861 0.115
NP_441061.1_2 Forward -221 -207 3.44117 0.164
NP_441061.1_2 Forward -32 -18 0.0979218 0.218
NP_440795.1_7 Forward -32 -25 14.6904 0.0123
NP_440795.1_7 Reverse -25 -32 14.6904 0.0123
NP_441418.1_6 Reverse -24 -43 -1.67217 0.0147
NP_441418.1_6 Forward -33 -14 -13.2752 0.0751
NP_441418.1_6 Forward -336 -317 -22.2233 0.172
NP_441418.1_6 Reverse -318 -337 -29.7948 0.238
NP_441418.1_6 Reverse -213 -232 -30.6798 0.291
NP_442291.1_5 Reverse -23 -39 -0.728113 0.189
NP_440897.1_6 Reverse -24 -43 7.07848 0.0883
NP_441453.1_4 Reverse -24 -32 16.539 0.00633
NP_441453.1_4 Forward -33 -25 16.539 0.00633
NP_441453.1_4 Reverse -115 -123 3.36267 0.293
NP_441453.1_7 Reverse -274 -281 11.9372 0.298
NP_442151.1_6 Reverse -207 -221 7.37441 0.2
NP_442151.1_6 Forward -33 -19 6.29277 0.24
NP_441818.1_1 Forward -32 -21 14.0211 0.0577
NP_441818.1_1 Reverse -25 -36 9.30127 0.246
NP_440226.1_1 Reverse -24 -43 5.60432 0.151
NP_441465.1_8 Forward -44 -26 12.5072 0.174
NP_440817.1_7 Forward -161 -142 18.3873 0.221
NP_440150.1_2 Forward -227 -208 5.50519 0.269
NP_440150.1_6 Reverse -21 -40 13.9625 0.0993
NP_440150.1_6 Forward -36 -17 0.491109 0.3
NP_442744.1_8 Reverse -240 -259 -2.36049 0.297
NP_442173.1_1 Forward -32 -24 15.4574 0.00633
NP_442173.1_1 Reverse -25 -33 15.4574 0.00633
NP_442752.1_4 Forward -33 -26 13.8055 0.0199
NP_442752.1_4 Reverse -24 -31 13.8055 0.0199
NP_442752.1_4 Reverse -39 -46 5.44732 0.202
NP_443027.1_4 Forward -35 -25 14.828 0.0437
NP_443027.1_4 Reverse -22 -32 6.46988 0.275
NP_442975.1_10 Forward -37 -23 4.62054 0.241
NP_440784.1_7 Forward -32 -25 15.9687 0.0123
NP_440784.1_7 Reverse -25 -32 15.9687 0.0123
NP_442909.1_7 Forward -32 -18 8.45543 0.176
NP_440061.1_9 Forward -35 -21 21.4351 0.00189
NP_440061.1_9 Forward -218 -204 11.9953 0.103
NP_440110.1_8 Reverse -22 -41 19.2723 0.015
NP_441054.1_4 Reverse -14 -32 2.77242 0.169
NP_442062.1_8 Reverse -24 -34 19.4496 0.000558
NP_442062.1_8 Forward -33 -23 17.6796 0.00193
NP_442062.1_8 Reverse -213 -223 11.0914 0.0493
NP_441859.1_3 Forward -34 -15 22.6147 0.0135
NP_440304.1_4 Reverse -22 -32 17.9746 0.00654
NP_440304.1_4 Forward -35 -25 10.8948 0.051
NP_440304.1_4 Forward -179 -169 3.02829 0.299
NP_442242.1_4 Forward -32 -25 14.3954 0.0124
NP_442242.1_4 Reverse -25 -32 14.3954 0.0124
NP_439918.1_3 Reverse -225 -244 5.11266 0.264
NP_441935.1_1 Forward -123 -104 13.0775 0.168
NP_441208.1_9 Reverse -21 -35 14.4542 0.0974
NP_441594.1_6 Reverse -204 -223 9.93088 0.134
NP_441594.1_6 Forward -225 -206 4.12936 0.222
NP_442375.1_8 Forward -372 -354 15.7521 0.272
NP_441491.1_1 Forward -59 -40 3.93269 0.296
NP_441925.1_4 Forward -326 -307 -17.0125 0.287
NP_440856.1_7 Reverse -213 -232 -5.99873 0.235
NP_440856.1_7 Reverse -21 -40 -9.14533 0.283
NP_441083.1_5 Forward -33 -23 19.3512 0.000718
NP_441083.1_5 Reverse -24 -34 11.3864 0.0159
NP_441083.1_5 Forward -48 -38 4.69992 0.134
NP_441083.1_5 Forward -216 -206 -0.511621 0.269
NP_442827.1_8 Forward -41 -22 6.98015 0.0988
NP_442827.1_8 Reverse -37 -56 -1.27961 0.245
NP_441738.1_2 Forward -31 -24 15.28 0.0102
NP_441738.1_2 Reverse -26 -33 15.28 0.0102
NP_441738.1_2 Forward -46 -39 9.77352 0.143
NP_441738.1_2 Reverse -171 -178 6.72528 0.236
NP_441942.1_7 Reverse -102 -121 10.6192 0.294
NP_440209.1_1 Reverse -24 -32 18.1123 0.00295
NP_440209.1_1 Forward -33 -25 18.1123 0.00295
NP_440447.1_6 Reverse -184 -202 1.69077 0.261
NP_441713.1_1 Reverse -18 -37 8.75091 0.0568
NP_440178.1_7 Reverse -23 -42 -12.1936 0.115
NP_442570.1_3 Reverse -205 -224 1.67108 0.193
NP_441716.1_1 Reverse -24 -38 13.3726 0.0689
NP_441716.1_1 Forward -33 -19 9.14437 0.124
NP_441327.1_5 Forward -77 -68 12.7828 0.29
NP_442111.1_4 Reverse -23 -37 13.1759 0.0394
NP_441163.1_1 Reverse -77 -94 17.3443 0.158
NP_441163.1_1 Reverse -206 -223 5.24966 0.277
NP_440906.1_5 Forward -32 -25 15.8704 0.0124
NP_440906.1_5 Reverse -25 -32 15.8704 0.0124
NP_440747.1_10 Reverse -21 -33 -1.92764 0.0192
NP_440747.1_10 Forward -36 -24 -2.02597 0.0196
NP_440747.1_10 Reverse -210 -222 -12.1541 0.227
NP_440747.1_10 Reverse -204 -216 -12.5474 0.297
NP_440747.1_10 Reverse -36 -48 -12.5474 0.297
NP_441130.1_10 Forward -35 -21 20.9441 0.00768
NP_441130.1_10 Reverse -22 -36 9.04604 0.131
NP_441486.1_1 Forward -36 -22 13.3726 0.00871
NP_441486.1_1 Reverse -21 -35 2.35953 0.0844
NP_439964.1_9 Forward -347 -328 20.4405 0.193
NP_442634.1_4 Reverse -22 -36 4.22782 0.0819
NP_440403.1_4 Forward -42 -23 -5.80207 0.221
NP_440403.1_10 Reverse -24 -43 3.04771 0.278
NP_440403.1_10 Reverse -22 -41 2.0644 0.282
NP_440842.1_10 Forward -110 -96 4.62115 0.254
NP_441014.1_5 Reverse -319 -337 10.9339 0.263
NP_441014.1_10 Reverse -212 -231 2.85027 0.216
NP_442848.1_1 Forward -39 -25 5.89945 0.0803
NP_442848.1_1 Reverse -18 -32 -2.36035 0.263
NP_442848.1_5 Reverse -206 -224 -3.02911 0.29
NP_442848.1_9 Forward -99 -80 -0.295539 0.278
NP_442848.1_9 Forward -326 -307 -0.787193 0.28
NP_443018.1_3 Forward -32 -25 14.8871 0.0123
NP_443018.1_3 Reverse -25 -32 14.8871 0.0123
NP_443018.1_3 Forward -326 -319 10.2655 0.107
NP_443018.1_3 Forward -215 -208 9.38056 0.128
NP_441316.1_7 Forward -35 -20 6.07642 0.107
NP_441634.1_8 Reverse -211 -225 9.2427 0.108
NP_441634.1_8 Forward -35 -21 3.04785 0.157
NP_441634.1_8 Reverse -187 -201 2.45787 0.167
NP_441634.1_8 Reverse -22 -36 -3.54032 0.295
NP_440376.1_1 Forward -33 -24 19.4693 0.000692
NP_440376.1_1 Reverse -24 -33 19.4693 0.000692
NP_440376.1_1 Reverse -213 -222 3.63797 0.2
NP_440376.1_1 Reverse -207 -216 2.65466 0.216
NP_441857.1_5 Reverse -17 -35 7.78729 0.185
NP_442687.1_7 Reverse -23 -33 18.5646 0.0028
NP_442687.1_7 Forward -34 -24 15.8113 0.0125
NP_442485.1_3 Reverse -307 -326 3.04771 0.206
NP_442485.1_3 Forward -338 -319 -1.08219 0.255
NP_442485.1_3 Reverse -22 -41 -1.67217 0.26
NP_440042.1_2 Reverse -14 -33 -0.295539 0.227
NP_441422.1_7 Forward -122 -105 -6.35267 0.25
NP_440533.1_6 Reverse -224 -243 7.47261 0.297
NP_441950.1_7 Reverse -306 -325 -3.93378 0.211
NP_440360.1_10 Forward -31 -17 7.9644 0.227
NP_442658.1_1 Reverse -22 -32 17.6791 0.00565
NP_442658.1_1 Forward -35 -25 15.9091 0.00966
NP_442658.1_1 Forward -224 -214 12.0743 0.0643
NP_440141.1_8 Forward -231 -212 4.81767 0.28
NP_441971.1_5 Reverse -24 -43 12.1925 0.234
NP_442782.1_2 Reverse -208 -222 0.687908 0.286
NP_442496.1_5 Forward -185 -167 10.0489 0.217
NP_442205.1_9 Forward -60 -44 4.77842 0.147
NP_442205.1_9 Reverse -39 -55 -3.8747 0.297
NP_440656.1_8 Forward -44 -25 2.26107 0.113
NP_441414.1_9 Reverse -24 -43 4.32602 0.0546
NP_441414.1_9 Forward -33 -14 3.14605 0.0601
NP_441487.1_6 Forward -41 -22 -0.590531 0.276
NP_442937.1_5 Reverse -202 -221 13.4708 0.0906
NP_441958.1_5 Reverse -23 -33 20.5312 0.000966
NP_441958.1_5 Forward -34 -24 12.2714 0.00183
NP_441958.1_5 Reverse -110 -120 -1.69159 0.249
NP_442836.1_5 Reverse -18 -37 5.70265 0.185
NP_440203.1_5 Reverse -171 -181 10.4026 0.225
NP_440203.1_5 Forward -30 -20 10.4026 0.225
NP_440203.1_5 Forward -330 -320 8.63269 0.29
NP_439905.1_1 Forward -32 -19 10.934 0.204
NP_440984.1_7 Reverse -19 -33 12.291 0.122
NP_439990.1_5 Reverse -235 -248 6.21414 0.249
NP_442911.1_2 Reverse -14 -33 11.6025 0.0131
NP_442911.1_2 Forward -299 -280 1.0811 0.0618
NP_442911.1_2 Forward -43 -24 -0.983855 0.0804
NP_440153.1_5 Reverse -25 -39 8.25939 0.149
NP_440153.1_5 Reverse -46 -60 1.96621 0.241
NP_442064.1_1 Reverse -163 -182 -10.3253 0.259
NP_442064.1_4 Forward -43 -24 7.17681 0.245
NP_442064.1_4 Reverse -203 -222 5.30853 0.271
NP_443055.1_6 Forward -230 -212 11.2281 0.114
NP_443055.1_6 Reverse -199 -217 -1.16155 0.273
NP_442236.1_3 Reverse -18 -37 23.5006 0.0329
NP_440993.1_2 Forward -38 -22 8.12167 0.155
NP_440993.1_4 Forward -222 -205 5.05372 0.263
NP_440138.1_6 Forward -221 -202 12.585 0.118
NP_441348.1_3 Forward -48 -29 7.07928 0.265
NP_441099.1_5 Reverse -14 -33 -9.14533 0.214
NP_442002.1_9 Reverse -23 -30 14.1004 0.074
NP_442002.1_9 Forward -34 -27 10.7572 0.185
NP_440809.1_9 Reverse -15 -33 -7.749 0.225
NP_441294.1_7 Forward -37 -23 14.818 0.0351
NP_442438.1_10 Forward -38 -24 13.1759 0.0364
NP_441000.1_6 Reverse -23 -37 13.8643 0.0396
NP_441000.1_6 Forward -34 -20 -5.70361 0.29
NP_442771.1_1 Reverse -22 -40 4.34571 0.0672
NP_440147.1_4 Forward -35 -22 13.0973 0.0326
NP_440147.1_4 Reverse -22 -35 2.67422 0.203
NP_440147.1_4 Reverse -109 -122 2.2809 0.209
NP_441295.1_6 Reverse -179 -198 11.6025 0.244
NP_441550.1_8 Reverse -22 -32 19.8424 0.00352
NP_441550.1_8 Forward -35 -25 6.0761 0.214
NP_441916.1_7 Reverse -24 -34 18.4663 0.00144
NP_441916.1_7 Forward -33 -23 16.893 0.00407
NP_440465.1_10 Forward -36 -17 8.84924 0.173
NP_440465.1_10 Reverse -21 -40 3.14605 0.251
NP_441041.1_4 Reverse -24 -43 -7.67036 0.191
NP_441041.1_4 Forward -120 -101 -11.1119 0.241
NP_441041.1_7 Reverse -21 -33 12.568 0.0611
NP_441041.1_7 Forward -225 -213 5.18252 0.272
NP_442396.1_5 Forward -37 -24 5.91914 0.26
NP_442004.1_6 Forward -33 -19 7.9644 0.15
NP_442004.1_6 Forward -222 -208 5.30946 0.191
NP_442004.1_6 Reverse -24 -38 2.75286 0.257
NP_440703.1_3 Forward -41 -22 16.1755 0.297
NP_441725.1_5 Forward -32 -22 18.7612 0.0119
NP_441725.1_5 Reverse -25 -35 11.2881 0.0247
NP_439966.1_7 Forward -35 -25 18.4657 0.00473
NP_439966.1_7 Reverse -22 -32 8.14104 0.14
NP_439966.1_7 Forward -200 -190 5.28945 0.232
NP_439966.1_9 Forward -35 -26 0.983037 0.253
NP_439966.1_9 Reverse -22 -31 0.983037 0.253
NP_440202.1_8 Forward -41 -22 18.6573 0.177
NP_442941.1_3 Reverse -25 -35 11.4848 0.0116
NP_442941.1_3 Forward -32 -22 2.43831 0.14
NP_440289.1_2 Forward -36 -23 14.7689 0.0107
NP_440289.1_2 Reverse -21 -34 4.8375 0.0644
NP_441554.1_4 Reverse -252 -266 15.7511 0.22
NP_440260.1_8 Forward -225 -207 -6.96235 0.295
NP_441514.1_6 Forward -179 -172 12.8221 0.252
NP_441678.1_9 Forward -171 -152 3.53937 0.218
NP_442281.1_1 Reverse -19 -33 9.83206 0.0661
NP_442281.1_1 Forward -227 -213 9.53707 0.0685
NP_442281.1_1 Forward -221 -207 8.3571 0.0823
NP_442281.1_1 Forward -38 -24 3.8339 0.217
NP_442281.1_1 Forward -332 -318 2.75226 0.257
NP_441334.1_7 Reverse -22 -41 -11.5053 0.122
NP_442901.1_4 Reverse -73 -92 2.45773 0.278
NP_442847.1_3 Reverse -209 -228 4.03023 0.281
NP_442256.1_2 Reverse -22 -40 -5.68405 0.214
NP_440437.1_1 Forward -39 -20 10.7175 0.0427
NP_442012.1_1 Reverse -18 -37 7.27595 0.112
NP_442012.1_1 Forward -39 -20 4.71934 0.163
NP_441556.1_4 Forward -45 -26 17.2356 0.113
NP_441556.1_7 Forward -44 -25 0.0970122 0.3
NP_440498.1_1 Forward -42 -24 6.60732 0.0856
NP_440498.1_1 Reverse -15 -33 1.49411 0.204
NP_442982.1_5 Forward -104 -85 13.2741 0.0832
NP_441644.1_6 Forward -33 -23 15.7125 0.0048
NP_441644.1_6 Forward -216 -206 13.6475 0.0181
NP_441644.1_6 Forward -120 -110 12.0743 0.0392
NP_441644.1_6 Reverse -24 -34 10.1076 0.0628
NP_441644.1_6 Reverse -207 -217 4.30615 0.242
NP_442215.1_2 Reverse -166 -182 -1.61309 0.186
NP_440253.1_2 Forward -216 -198 -2.73412 0.274
NP_440929.1_8 Forward -33 -24 19.2726 0.000701
NP_440929.1_8 Reverse -24 -33 19.2726 0.000701
NP_442933.1_10 Forward -33 -24 17.601 0.00325
NP_442933.1_10 Reverse -24 -33 17.601 0.00325
NP_440891.1_8 Reverse -278 -297 13.3082 0.294
NP_441751.2_8 Forward -32 -18 3.44117 0.0661
NP_441751.2_8 Reverse -25 -39 -0.295402 0.125
NP_442926.1_3 Forward -119 -100 6.68596 0.199
NP_442554.1_8 Forward -32 -22 16.9913 0.0065
NP_442554.1_8 Reverse -25 -35 13.8447 0.0145
NP_442554.1_8 Reverse -208 -218 11.3864 0.0365
NP_442554.1_8 Forward -215 -205 4.20827 0.193
NP_442554.1_8 Forward -326 -316 2.24165 0.276
NP_442075.1_1 Reverse -74 -93 12.6841 0.173
NP_441762.1_7 Forward -34 -22 11.7404 0.0142
NP_441762.1_7 Reverse -23 -35 11.4454 0.0142
NP_442313.1_5 Reverse -208 -227 20.944 0.0328
NP_442313.1_6 Reverse -347 -366 6.39097 0.252
NP_442142.1_4 Forward -330 -317 16.8333 0.0264
NP_442142.1_4 Reverse -21 -34 6.60689 0.16
NP_442142.1_4 Reverse -210 -223 4.54195 0.217
NP_442142.1_4 Forward -219 -206 4.14862 0.231
NP_442292.1_1 Reverse -25 -34 9.63616 0.0183
NP_442292.1_1 Forward -32 -23 9.53783 0.0183
NP_442292.1_5 Reverse -20 -39 -0.983855 0.257
NP_442476.1_6 Forward -32 -18 21.1407 0.0195
NP_442476.1_6 Reverse -25 -39 2.2612 0.188
NP_441711.1_4 Forward -231 -212 7.86593 0.144
NP_441711.1_4 Forward -187 -168 7.47261 0.144
NP_443009.1_5 Reverse -23 -34 20.6093 0.001
NP_443009.1_5 Reverse -212 -223 10.4812 0.0792
NP_443009.1_5 Forward -34 -23 9.10461 0.0965
NP_442408.2_1 Reverse -24 -43 -7.17871 0.292
NP_441371.1_3 Reverse -288 -306 4.83737 0.295
NP_441715.1_4 Reverse -25 -35 16.303 0.0117
NP_440357.1_3 Forward -35 -16 5.89931 0.242
NP_440183.1_9 Reverse -320 -339 -14.7502 0.27
NP_441198.1_8 Reverse -22 -32 15.2245 0.0427
NP_440379.1_5 Reverse -309 -328 -4.72043 0.215
NP_440379.1_5 Reverse -24 -43 -10.3253 0.28
NP_441468.1_1 Forward -32 -25 15.8704 0.0124
NP_441468.1_1 Reverse -25 -32 15.8704 0.0124
NP_441468.1_1 Reverse -190 -197 6.72562 0.126
NP_441020.2_6 Reverse -22 -39 14.8868 0.0469
NP_441015.1_10 Forward -119 -100 -2.0655 0.178
NP_441015.1_10 Reverse -100 -119 -5.60541 0.228
NP_441015.1_10 Reverse -19 -38 -6.68705 0.253
NP_441673.1_1 Forward -33 -24 20.8459 0.000698
NP_441673.1_1 Reverse -24 -33 20.8459 0.000698
NP_441016.2_6 Forward -48 -29 12.3883 0.202
NP_441426.1_3 Reverse -99 -118 8.75009 0.259
NP_441826.1_2 Forward -39 -25 7.37441 0.0899
NP_441826.1_2 Reverse -207 -221 3.04785 0.115
NP_441826.1_2 Reverse -18 -32 0.786239 0.172
NP_441826.1_2 Forward -222 -208 -3.83532 0.288
NP_441330.1_1 Forward -141 -122 -13.6686 0.198
NP_441330.1_1 Forward -348 -329 -15.6352 0.289
NP_442868.1_6 Reverse -22 -32 16.7946 0.0131
NP_442868.1_6 Forward -35 -25 0.963343 0.205
NP_441612.1_2 Reverse -249 -259 7.00028 0.268
NP_442427.1_1 Forward -58 -39 21.6323 0.085
NP_442808.1_1 Forward -34 -24 18.4657 0.00201
NP_442808.1_1 Reverse -23 -33 8.73102 0.0481
NP_441101.1_3 Forward -119 -100 19.764 0.0964
NP_441101.1_10 Reverse -20 -39 -0.39387 0.189
NP_442542.1_2 Reverse -22 -35 13.9823 0.114
NP_442542.1_2 Forward -224 -211 7.6891 0.173
NP_442050.1_5 Reverse -22 -32 14.9258 0.0175
NP_442050.1_5 Forward -35 -25 9.12434 0.193
NP_442342.1_9 Reverse -83 -99 2.32015 0.29
NP_441114.1_3 Forward -221 -212 17.1093 0.113
NP_440558.1_2 Reverse -102 -121 2.3594 0.169
NP_440558.1_2 Reverse -204 -223 0.786102 0.185
NP_440558.1_2 Forward -118 -99 -4.42544 0.245
NP_440111.2_2 Forward -44 -25 -0.590531 0.215
NP_442789.1_4 Reverse -22 -41 -2.55715 0.238
NP_441518.1_3 Forward -43 -24 -6.68705 0.142
NP_442792.1_5 Forward -170 -153 13.2152 0.266
NP_441878.1_6 Reverse -23 -33 20.2362 0.0046
NP_441878.1_6 Forward -34 -24 10.4031 0.0176
NP_441878.1_6 Reverse -206 -216 0.668351 0.139
NP_441878.1_6 Forward -217 -207 0.57002 0.14
NP_441878.1_6 Forward -223 -213 -7.59145 0.245
NP_441878.1_6 Reverse -84 -94 -7.78811 0.266
NP_441036.1_8 Forward -34 -24 17.7779 0.000554
NP_441036.1_8 Reverse -23 -33 8.4365 0.174
NP_441036.1_8 Reverse -19 -29 5.78156 0.258
NP_441557.1_5 Forward -33 -24 19.9609 0.000699
NP_441557.1_5 Reverse -24 -33 19.9609 0.000699
NP_441445.1_1 Forward -42 -23 4.62101 0.191
NP_441445.1_1 Reverse -15 -34 1.0811 0.262
NP_441445.1_8 Forward -215 -196 -10.4236 0.277
NP_441433.1_7 Forward -258 -239 16.2734 0.231
NP_442419.1_2 Reverse -313 -332 -1.86883 0.246
NP_441308.1_8 Forward -35 -25 10.1081 0.22
NP_442183.1_1 Forward -33 -19 18.9775 0.0065
NP_442183.1_1 Reverse -24 -38 11.6026 0.0702
NP_442183.1_1 Reverse -213 -227 4.03116 0.282
NP_442397.1_9 Forward -223 -204 2.0644 0.283
NP_440979.1_3 Reverse -25 -43 10.9339 0.235
NP_441574.1_1 Reverse -306 -325 -4.03212 0.249
NP_442494.1_7 Reverse -320 -339 4.62101 0.246
NP_441549.1_9 Reverse -20 -38 10.8356 0.0392
NP_441549.1_9 Forward -37 -19 -9.32229 0.245
NP_442347.1_2 Reverse -25 -34 11.1111 0.056
NP_442347.1_2 Forward -32 -23 3.34298 0.284
NP_442645.1_2 Forward -96 -77 -19.7651 0.288
NP_442645.1_2 Reverse -205 -224 -21.4367 0.29
NP_441037.1_4 Reverse -22 -32 18.9151 0.00351
NP_441037.1_4 Reverse -83 -93 10.144 0.21
NP_441037.1_4 Forward -35 -25 7.02532 0.237
NP_442594.1_10 Reverse -216 -235 9.34008 0.28
NP_441633.1_3 Forward -35 -22 15.4572 0.0103
NP_441633.1_3 Forward -338 -325 -0.964025 0.151
NP_441633.1_3 Reverse -22 -35 -5.88057 0.236
NP_440136.1_2 Forward -32 -25 15.9687 0.0123
NP_440136.1_2 Reverse -25 -32 15.9687 0.0123
NP_442590.1_9 Reverse -23 -42 8.75091 0.23
NP_442998.1_10 Forward -31 -24 15.5754 0.0102
NP_442998.1_10 Reverse -26 -33 15.5754 0.0102
NP_440899.1_8 Forward -298 -279 -5.9004 0.231
NP_440299.1_1 Forward -37 -24 14.08 0.0259
NP_440299.1_1 Reverse -20 -33 6.50855 0.139
NP_441799.1_1 Reverse -20 -34 19.8618 0.00596
NP_441799.1_1 Forward -37 -23 7.17714 0.149
NP_441799.1_9 Reverse -23 -42 0.786102 0.213
NP_440640.1_6 Reverse -312 -331 1.17943 0.266
NP_441007.1_10 Reverse -19 -32 18.7022 0.0299
NP_440256.1_1 Reverse -21 -40 0.58944 0.0818
NP_440256.1_1 Reverse -210 -229 -0.197208 0.0907
NP_440256.1_1 Reverse -108 -127 -7.27704 0.232
NP_442961.1_4 Forward -261 -242 6.29264 0.218
NP_441559.1_8 Forward -38 -24 0.294584 0.169
NP_440915.1_6 Forward -37 -23 2.94952 0.11
NP_440915.1_6 Reverse -20 -34 -2.16369 0.26
NP_440717.1_1 Forward -222 -203 7.47261 0.265
NP_442785.1_7 Reverse -109 -123 8.94771 0.279
NP_442866.1_1 Forward -126 -107 -9.53865 0.294
NP_441464.1_8 Forward -33 -19 17.9942 0.072
NP_441464.1_8 Forward -321 -307 8.65272 0.194
NP_440026.1_4 Reverse -21 -40 12.2908 0.239
NP_440695.1_6 Forward -302 -288 13.417 0.236
NP_441494.1_6 Reverse -19 -32 10.639 0.225
NP_442993.1_1 Reverse -207 -223 -12.0362 0.265
NP_442993.1_1 Forward -100 -84 -14.0028 0.295
NP_440677.1_1 Forward -231 -212 11.7008 0.154
NP_440677.1_1 Reverse -15 -34 7.17762 0.243
NP_442386.1_9 Forward -34 -25 15.7322 0.0144
NP_442386.1_9 Forward -223 -214 7.17747 0.219
NP_442386.1_9 Forward -217 -208 6.48915 0.219
NP_442386.1_9 Reverse -23 -32 6.39082 0.219
NP_440570.1_5 Forward -169 -150 4.81767 0.207
NP_440570.1_5 Reverse -74 -93 -0.590531 0.262
NP_441340.1_5 Forward -32 -25 15.6737 0.0124
NP_441340.1_5 Reverse -25 -32 15.6737 0.0124
NP_442791.1_5 Forward -41 -22 -8.26035 0.279
NP_440168.1_4 Forward -331 -312 4.916 0.185
NP_440161.1_3 Reverse -22 -41 8.35759 0.273
NP_440586.1_1 Reverse -308 -327 -5.40875 0.285
NP_440586.1_1 Reverse -20 -39 -6.39206 0.299
NP_440586.1_8 Forward -32 -25 13.2151 0.026
NP_440586.1_8 Reverse -25 -32 13.2151 0.026
NP_440586.1_8 Forward -326 -319 9.08521 0.178
NP_442251.1_6 Forward -32 -25 15.2804 0.0124
NP_442251.1_6 Reverse -25 -32 15.2804 0.0124
NP_441262.1_3 Reverse -24 -31 14.7888 0.0223
NP_441262.1_3 Forward -33 -26 14.7888 0.0223
NP_440027.1_3 Forward -43 -25 2.37835 0.29
NP_443051.1_1 Reverse -23 -32 18.0926 0.00402
NP_443051.1_1 Forward -34 -25 10.4228 0.00754
NP_441232.1_10 Reverse -13 -32 3.24438 0.233
NP_441232.1_10 Forward -44 -25 2.85105 0.239
NP_439937.1_8 Forward -35 -16 0.982764 0.231
NP_439937.1_8 Forward -236 -217 0.491109 0.235
NP_439937.1_8 Reverse -22 -41 -4.03212 0.276
NP_439937.1_9 Forward -34 -17 12.5261 0.0317
NP_439937.1_9 Reverse -279 -296 -0.551837 0.122
NP_439937.1_9 Reverse -23 -40 -6.84499 0.157
NP_440926.1_6 Reverse -35 -54 17.699 0.143
NP_440439.1_1 Forward -36 -23 19.7838 0.0105
NP_440439.1_1 Reverse -21 -34 10.934 0.0339
NP_440372.1_2 Forward -32 -25 16.3621 0.0124
NP_440372.1_2 Reverse -25 -32 16.3621 0.0124
NP_441138.1_5 Forward -264 -251 2.83104 0.297
NP_441181.1_4 Reverse -213 -232 14.8466 0.271
NP_440819.1_5 Forward -366 -358 15.8507 0.185
NP_440819.1_5 Forward -103 -95 7.8859 0.266
NP_441803.1_2 Forward -99 -80 5.89931 0.16
NP_441803.1_2 Forward -215 -196 5.211 0.17
NP_441803.1_2 Reverse -208 -227 0.0977854 0.26
NP_442368.1_3 Reverse -179 -197 2.87075 0.3
NP_440139.1_1 Forward -39 -20 9.04509 0.105
NP_441572.1_7 Reverse -18 -37 6.78429 0.0785
NP_442384.1_10 Reverse -24 -37 16.3422 0.00854
NP_442384.1_10 Forward -33 -20 11.6223 0.0341
NP_442384.1_10 Forward -222 -209 4.93583 0.142
NP_442035.1_7 Reverse -167 -186 16.1765 0.276
NP_440364.1_6 Forward -223 -210 18.0132 0.136
NP_440364.1_10 Reverse -34 -53 15.1424 0.256
NP_442572.1_6 Forward -48 -29 6.98095 0.295
NP_441018.1_7 Reverse -203 -222 11.0125 0.194
NP_442262.1_10 Forward -32 -25 14.1988 0.0123
NP_442262.1_10 Reverse -25 -32 14.1988 0.0123
NP_442262.1_10 Forward -215 -208 9.47889 0.187
NP_442262.1_10 Forward -326 -319 9.18389 0.211
NP_441689.1_5 Forward -35 -25 8.53436 0.132
NP_442244.1_6 Reverse -21 -40 -0.295539 0.291
NP_440163.1_10 Reverse -210 -220 9.41981 0.234
NP_440163.1_10 Forward -330 -320 8.73149 0.262
NP_440344.1_10 Reverse -17 -34 5.74204 0.0197
NP_440344.1_10 Forward -40 -23 -1.73112 0.0566
NP_440344.1_10 Forward -229 -212 -5.95935 0.111
NP_440282.1_10 Reverse -14 -33 -8.35868 0.262
NP_440531.1_6 Forward -41 -22 1.86774 0.166
NP_442123.1_3 Forward -33 -14 11.7008 0.228
NP_442123.1_3 Reverse -24 -43 10.8159 0.269
NP_441060.1_1 Forward -277 -258 16.5641 0.18
NP_440487.1_1 Reverse -21 -40 -3.54046 0.214
NP_441965.1_3 Reverse -14 -33 2.55606 0.203
NP_441965.1_10 Reverse -21 -37 4.77842 0.231
NP_440297.1_9 Forward -32 -22 9.51814 0.0917
NP_440297.1_9 Reverse -25 -35 9.32148 0.0917
NP_440297.1_9 Forward -158 -148 6.37155 0.193
NP_440297.1_9 Forward -326 -316 -0.41329 0.283
NP_440297.1_9 Reverse -208 -218 -0.41329 0.283
NP_440350.1_1 Reverse -294 -313 10.2259 0.12
NP_440350.1_5 Forward -267 -248 5.01433 0.158
NP_442187.1_3 Reverse -38 -48 14.533 0.186
NP_442280.1_10 Reverse -197 -215 5.06482 0.291
NP_441592.1_4 Forward -327 -308 -2.65548 0.268
NP_441592.1_4 Forward -37 -18 -3.14714 0.275
NP_440999.1_9 Forward -37 -23 0.392915 0.187
NP_440999.1_9 Reverse -20 -34 -0.0987402 0.199
NP_440888.1_2 Reverse -24 -38 16.1252 0.00789
NP_440888.1_2 Reverse -213 -227 10.2254 0.1
NP_440888.1_2 Forward -33 -19 6.48882 0.232
NP_440888.1_2 Forward -94 -80 5.50552 0.276
NP_440491.1_1 Forward -51 -32 7.4043 0.268
NP_441345.1_8 Forward -130 -111 13.2741 0.26
NP_442948.1_2 Forward -34 -15 6.09597 0.245
NP_441543.1_2 Reverse -25 -34 18.486 0.00236
NP_441543.1_2 Forward -32 -23 9.34117 0.0818
NP_441543.1_2 Forward -326 -317 4.81794 0.219
NP_442845.1_2 Reverse -207 -221 7.66941 0.195
NP_442845.1_2 Forward -222 -208 6.29277 0.212
NP_442845.1_2 Reverse -183 -197 4.81781 0.251
NP_442845.1_2 Reverse -18 -32 4.52282 0.258
NP_441551.1_5 Forward -37 -21 16.8724 0.0579
NP_441551.1_5 Reverse -20 -36 10.7759 0.193
NP_441319.1_8 Forward -39 -21 13.3922 0.12
NP_442710.1_5 Forward -149 -130 16.4207 0.261
NP_441469.1_8 Forward -34 -25 16.126 0.00797
NP_441469.1_8 Reverse -23 -32 13.3727 0.073
NP_441469.1_8 Forward -223 -214 12.1928 0.123
NP_441469.1_8 Forward -199 -190 5.60459 0.258
NP_443064.1_6 Forward -33 -23 13.8273 0.0796
NP_442578.1_7 Forward -32 -25 14.5921 0.026
NP_442578.1_7 Reverse -25 -32 14.5921 0.026
NP_440710.1_1 Forward -41 -23 9.36059 0.0983
NP_440220.1_4 Reverse -287 -306 -3.34455 0.286
NP_440148.1_6 Reverse -38 -52 15.4762 0.3
NP_441462.1_2 Forward -33 -23 20.1379 0.000967
NP_441462.1_2 Reverse -24 -34 11.5831 0.00406
NP_441621.1_7 Reverse -22 -36 4.42448 0.0934
NP_441621.1_7 Forward -35 -21 -3.34366 0.188
NP_441621.1_7 Forward -233 -219 -6.29359 0.283
NP_443062.1_1 Forward -120 -102 5.32818 0.231
NP_443062.1_1 Reverse -318 -336 4.74314 0.25
NP_443062.1_6 Reverse -16 -35 12.2908 0.0996
NP_443062.1_6 Forward -41 -22 11.4058 0.105
NP_442204.1_1 Forward -85 -74 1.4353 0.271
NP_442204.1_5 Reverse -14 -33 3.14605 0.196
NP_441560.1_3 Forward -230 -212 7.00065 0.28
NP_440516.1_8 Forward -33 -24 16.9127 0.00442
NP_440516.1_8 Reverse -24 -33 16.9127 0.00442
NP_442428.1_4 Reverse -311 -330 2.55606 0.252
NP_442428.1_5 Forward -32 -25 15.8704 0.0124
NP_442428.1_5 Reverse -25 -32 15.8704 0.0124
NP_442120.1_10 Forward -228 -209 -6.88371 0.217
NP_442120.1_10 Reverse -306 -325 -7.57203 0.222
NP_440673.1_3 Forward -31 -24 12.4288 0.0426
NP_440673.1_3 Reverse -26 -33 12.4288 0.0426
NP_441052.1_2 Reverse -24 -34 10.5014 0.0285
NP_441052.1_2 Forward -33 -23 10.4031 0.0285
NP_441052.1_2 Forward -222 -212 5.48657 0.116
NP_441052.1_2 Reverse -207 -217 4.20827 0.163
NP_441052.1_2 Forward -216 -206 3.91327 0.17
NP_441052.1_2 Forward -327 -317 1.55333 0.238
NP_441052.1_2 Forward -54 -44 1.55333 0.238
NP_441052.1_2 Forward -48 -38 -0.511621 0.282
NP_442219.1_8 Reverse -38 -57 6.52434 0.294
NP_442219.1_9 Reverse -25 -34 8.35786 0.0681
NP_442219.1_9 Forward -32 -23 8.25953 0.0681
NP_440436.1_4 Reverse -25 -34 18.1905 0.00233
NP_440436.1_4 Forward -32 -23 15.9289 0.00508
NP_441884.1_8 Reverse -23 -42 1.96607 0.135
NP_441884.1_9 Reverse -21 -40 -5.01543 0.0594
NP_441884.1_9 Forward -36 -17 -15.5368 0.138
NP_441884.1_9 Forward -339 -320 -23.895 0.284
NP_441719.1_4 Forward -32 -25 16.3621 0.0124
NP_441719.1_4 Reverse -25 -32 16.3621 0.0124
NP_441733.1_10 Reverse -21 -34 10.344 0.106
NP_441004.1_1 Reverse -306 -325 -9.047 0.206
NP_441004.1_4 Reverse -219 -229 8.73149 0.267
NP_442813.1_4 Reverse -173 -192 0.687771 0.197
NP_442813.1_4 Reverse -5 -24 -0.688862 0.23
NP_442813.1_4 Reverse -6 -25 -0.885524 0.236
NP_442873.1_3 Forward -43 -24 4.12856 0.274
NP_440296.1_10 Reverse -21 -40 -13.0786 0.269
NP_440296.1_10 Forward -118 -99 -14.5535 0.27
NP_441115.1_4 Forward -34 -16 8.96649 0.229
NP_442206.1_1 Forward -33 -14 6.78429 0.0457
NP_442206.1_1 Reverse -213 -232 -14.3569 0.269
NP_440288.1_1 Reverse -152 -170 11.0322 0.297
NP_443054.1_2 Forward -35 -21 10.226 0.0761
NP_443054.1_2 Reverse -211 -225 9.93102 0.0832
NP_441851.1_10 Reverse -23 -33 17.4829 0.0027
NP_441851.1_10 Forward -34 -24 16.008 0.00552
NP_442622.1_1 Reverse -23 -42 -11.7019 0.257
NP_442622.1_8 Reverse -24 -42 -9.0273 0.138
NP_442622.1_8 Forward -33 -15 -18.7621 0.268
NP_442515.1_1 Forward -34 -20 14.4542 0.0276
NP_442515.1_1 Reverse -23 -37 1.96621 0.145
NP_441396.1_5 Reverse -304 -313 8.55452 0.21
NP_441396.1_5 Reverse -16 -25 7.47288 0.252
NP_440593.1_3 Forward -119 -100 -3.44213 0.235
NP_440593.1_3 Reverse -94 -113 -6.78538 0.28
NP_440593.1_9 Reverse -210 -224 9.73436 0.245
NP_440463.1_7 Reverse -104 -118 14.5526 0.296
NP_440463.1_8 Reverse -317 -336 6.33814 0.27
NP_440940.1_7 Forward -43 -25 15.063 0.0666
NP_441349.1_10 Forward -43 -24 -4.6221 0.177
NP_441349.1_10 Forward -367 -348 -8.85033 0.279
NP_441107.1_1 Reverse -308 -327 18.0924 0.174
NP_440432.1_9 Forward -32 -17 -1.10174 0.167
NP_440432.1_9 Reverse -214 -229 -2.67504 0.175
NP_442843.1_1 Reverse -319 -338 -4.32711 0.237
NP_442843.1_1 Forward -215 -196 -4.42544 0.239
NP_439960.1_10 Forward -88 -70 -4.50408 0.293
NP_440474.1_8 Reverse -25 -39 12.8803 0.0782
NP_441124.1_5 Forward -172 -162 10.6209 0.286
NP_440877.1_4 Reverse -148 -163 21.9077 0.0522
NP_442450.1_5 Reverse -22 -32 10.1081 0.115
NP_442450.1_5 Forward -35 -25 9.32148 0.115
NP_440588.1_2 Reverse -15 -34 5.89931 0.0609
NP_440588.1_2 Forward -42 -23 0.58944 0.146
NP_442006.1_2 Forward -231 -214 -9.49926 0.197
NP_442006.1_2 Forward -66 -49 -16.0874 0.238
NP_442006.1_2 Forward -109 -92 -17.6607 0.279
NP_442006.1_2 Forward -42 -25 -17.7591 0.282
NP_441003.1_9 Reverse -96 -115 10.0292 0.213
NP_440483.1_1 Forward -191 -172 -6.78538 0.252
NP_442243.1_1 Forward -87 -69 -2.04653 0.286
NP_441570.1_1 Reverse -24 -42 22.1436 0.00108
NP_441570.1_1 Forward -54 -36 -8.04399 0.101
NP_441078.1_4 Forward -33 -24 19.6659 0.0007
NP_441078.1_4 Reverse -24 -33 19.6659 0.0007
NP_441078.1_4 Forward -222 -213 5.60459 0.111
NP_441078.1_4 Reverse -207 -216 -1.6719 0.266
NP_441078.1_4 Forward -216 -207 -1.77023 0.266
NP_442729.1_7 Reverse -38 -56 5.23069 0.292
NP_442729.1_8 Reverse -20 -33 10.344 0.125
NP_441091.1_5 Forward -226 -207 16.5191 0.0818
NP_441094.1_6 Forward -100 -83 8.78956 0.261
NP_440526.1_3 Forward -32 -21 11.3662 0.0646
NP_441432.1_8 Reverse -23 -32 8.35786 0.0755
NP_441432.1_8 Forward -34 -25 8.25953 0.0755
NP_441432.1_8 Reverse -206 -215 3.44131 0.245
NP_442320.1_8 Reverse -18 -32 -2.45868 0.0894
NP_442320.1_8 Forward -39 -25 -4.03198 0.142
NP_442320.1_8 Forward -16 -2 -4.52363 0.171
NP_441732.1_2 Forward -37 -21 2.22182 0.0253
NP_441732.1_2 Reverse -20 -36 -15.9694 0.164
NP_441732.1_2 Forward -325 -309 -17.7394 0.292
NP_440629.1_6 Forward -39 -20 17.1898 0.0792
NP_440760.1_1 Forward -33 -14 -20.3551 0.222
NP_440760.1_7 Reverse -159 -178 6.68515 0.192
NP_442797.1_1 Reverse -107 -126 7.86593 0.137
NP_442797.1_6 Forward -118 -99 11.6185 0.238
NP_442797.1_7 Forward -328 -310 13.0972 0.128
NP_442797.1_7 Forward -40 -22 7.39397 0.198
NP_440199.1_10 Forward -36 -26 13.2547 0.108
NP_440461.1_4 Reverse -353 -372 16.7157 0.264
NP_442353.1_6 Reverse -319 -338 9.63589 0.298
NP_442353.1_7 Forward -127 -108 10.3242 0.176
NP_440713.1_4 Forward -43 -24 7.7676 0.174
NP_442489.1_7 Forward -33 -24 20.1576 0.000695
NP_442489.1_7 Reverse -24 -33 20.1576 0.000695
NP_442489.1_7 Forward -216 -207 -1.57357 0.213
NP_442489.1_7 Forward -222 -213 -1.6719 0.235
NP_442489.1_7 Reverse -207 -216 -1.6719 0.235
NP_442489.1_7 Reverse -213 -222 -1.96689 0.28
NP_440757.1_6 Reverse -20 -39 10.4225 0.28
NP_442079.1_7 Forward -32 -13 1.57275 0.249
NP_442079.1_7 Reverse -25 -44 0.196116 0.286
NP_440559.1_1 Forward -32 -23 17.306 0.00658
NP_440559.1_1 Reverse -25 -34 8.75118 0.0586
NP_441659.2_8 Forward -33 -23 19.3512 0.000966
NP_441659.2_8 Reverse -24 -34 11.9764 0.0147
NP_441659.2_8 Forward -216 -206 3.22496 0.169
NP_441022.1_1 Forward -169 -160 14.7117 0.183
NP_442913.1_10 Forward -342 -323 1.27776 0.144
NP_442008.1_2 Reverse -21 -40 3.24438 0.26
NP_442346.1_5 Reverse -23 -33 17.9746 0.00128
NP_442346.1_5 Forward -34 -24 9.02648 0.118
NP_442346.1_5 Reverse -206 -216 5.5849 0.238
NP_442346.1_5 Forward -217 -207 4.89658 0.269
NP_442346.1_10 Reverse -211 -230 2.45773 0.195
NP_442346.1_10 Reverse -22 -41 -3.14714 0.294
NP_440545.1_3 Reverse -20 -37 14.7885 0.0141
NP_440545.1_3 Forward -37 -20 10.4619 0.0323
NP_440545.1_3 Reverse -276 -293 -4.68105 0.23
NP_440831.1_3 Forward -42 -23 5.99883 0.28
NP_440459.1_2 Forward -225 -208 8.00365 0.272
NP_441653.1_2 Forward -233 -214 3.04645 0.277
NP_442551.1_4 Forward -117 -102 -3.26502 0.287
NP_440847.1_3 Reverse -92 -106 13.372 0.217
NP_442603.1_7 Forward -33 -19 14.2569 0.0707
NP_441585.1_5 Forward -310 -291 3.34192 0.255
NP_441888.1_7 Forward -38 -24 3.93283 0.225
NP_440946.1_6 Reverse -22 -41 3.24438 0.294
NP_441948.1_4 Forward -40 -22 9.95058 0.0561
NP_441047.1_2 Forward -221 -202 -3.44213 0.297
NP_441833.1_4 Forward -32 -25 15.9687 0.0124
NP_441833.1_4 Reverse -25 -32 15.9687 0.0124
NP_442162.1_9 Forward -32 -25 16.2637 0.0124
NP_442162.1_9 Reverse -25 -32 16.2637 0.0124
NP_440671.1_4 Forward -222 -208 6.6861 0.239
NP_442404.1_9 Forward -30 -16 11.602 0.263
NP_440772.1_8 Reverse -241 -260 7.86593 0.269
NP_442045.1_5 Reverse -165 -184 -2.36049 0.294
NP_442140.1_3 Forward -32 -22 14.828 0.0433
NP_442140.1_3 Reverse -25 -35 8.33817 0.119
NP_442140.1_3 Forward -215 -205 3.42162 0.297
NP_442723.1_8 Reverse -311 -325 16.7159 0.269
NP_441671.1_10 Reverse -79 -98 1.47442 0.269
NP_441671.1_10 Reverse -100 -119 0.982764 0.277
NP_440875.1_9 Forward -118 -108 7.00932 0.287
NP_441813.1_5 Forward -35 -25 17.188 0.00979
NP_441813.1_5 Reverse -22 -32 8.92815 0.0347
NP_440594.1_8 Forward -32 -19 9.36014 0.186
NP_440590.1_4 Reverse -25 -38 -3.52063 0.255
NP_440590.1_4 Forward -32 -19 -3.81562 0.255
NP_440567.1_1 Forward -32 -18 17.4042 0.0153
NP_440567.1_1 Reverse -25 -39 16.9125 0.0164
NP_442497.1_10 Forward -32 -23 19.8626 0.00532
NP_442497.1_10 Reverse -25 -34 10.4228 0.0087
NP_440821.1_4 Reverse -22 -32 19.5479 0.00399
NP_440821.1_4 Forward -35 -25 19.0562 0.00399
NP_441239.1_9 Reverse -22 -34 17.0502 0.0153
NP_441239.1_9 Forward -35 -23 16.8536 0.0155
NP_441239.1_9 Forward -329 -317 5.93884 0.202
NP_441239.1_9 Forward -224 -212 3.87389 0.272
NP_441239.1_9 Forward -117 -105 3.48056 0.285
NP_441239.1_9 Forward -218 -206 3.18557 0.292
NP_440156.1_4 Reverse -294 -304 12.9592 0.176
NP_442691.1_5 Reverse -320 -338 19.3524 0.139
NP_441727.1_3 Reverse -17 -36 13.9625 0.116
NP_441892.1_1 Forward -42 -25 0.825489 0.161
NP_441892.1_1 Forward -336 -319 0.137172 0.173
NP_441892.1_1 Forward -225 -208 -4.28772 0.258
NP_440665.1_1 Forward -333 -314 -12.8819 0.254
NP_440665.1_1 Forward -45 -26 -16.1268 0.28
NP_440604.1_6 Reverse -24 -43 -0.000545616 0.17
NP_440604.1_6 Forward -33 -14 -3.14714 0.225
NP_442044.1_1 Forward -38 -19 -8.752 0.262
NP_442193.1_1 Reverse -213 -231 10.5406 0.228
NP_442193.1_1 Reverse -312 -330 9.65558 0.233
NP_441017.1_6 Forward -220 -206 15.4369 0.103
NP_441017.1_8 Forward -305 -290 8.53469 0.244
NP_440989.1_3 Reverse -19 -38 15.3391 0.138
NP_440876.1_5 Forward -31 -12 5.89931 0.283
NP_440949.1_7 Forward -230 -211 14.8466 0.176
NP_440949.1_7 Forward -41 -22 14.7483 0.177
NP_441617.1_6 Forward -166 -147 -5.21209 0.274
NP_442138.1_1 Forward -329 -310 7.66846 0.24
NP_440546.1_4 Forward -33 -23 12.8578 0.0572
NP_440546.1_4 Reverse -24 -34 11.8882 0.0679
NP_440546.1_4 Reverse -207 -217 8.78555 0.171
NP_440546.1_7 Reverse -318 -328 14.238 0.279
NP_442041.1_5 Forward -126 -107 -0.983855 0.278
NP_440462.1_6 Forward -35 -25 15.418 0.0142
NP_440462.1_6 Reverse -22 -32 10.4031 0.0396
NP_440868.1_4 Forward -37 -25 18.3285 0.0124
NP_440868.1_4 Reverse -20 -32 12.3303 0.0242
NP_440868.1_8 Reverse -20 -39 -3.3438 0.263
NP_442499.1_1 Forward -230 -211 7.66927 0.203
NP_442499.1_1 Forward -32 -13 4.62101 0.23
NP_441868.1_4 Reverse -304 -318 12.586 0.284
NP_440653.1_10 Reverse -202 -221 4.62101 0.249
NP_440696.1_3 Reverse -24 -42 4.14905 0.2
NP_442039.1_4 Forward -32 -25 15.1821 0.0124
NP_442039.1_4 Reverse -25 -32 15.1821 0.0124
NP_441811.1_8 Forward -54 -40 6.98109 0.259
NP_442679.1_1 Reverse -253 -272 -4.13045 0.273
NP_440008.1_9 Reverse -207 -226 21.9273 0.0341
NP_442409.1_10 Reverse -165 -179 14.8469 0.293
NP_442837.1_3 Forward -32 -25 15.7721 0.0124
NP_442837.1_3 Reverse -25 -32 15.7721 0.0124
NP_442053.1_1 Forward -33 -24 18.3876 0.0007
NP_442053.1_1 Reverse -24 -33 18.3876 0.0007
NP_440505.1_3 Forward -35 -25 13.8447 0.0247
NP_440505.1_3 Forward -12 -2 9.91146 0.122
NP_440505.1_3 Reverse -22 -32 7.84651 0.147
NP_440505.1_3 Reverse -37 -47 6.56821 0.176
NP_442532.1_7 Forward -33 -19 4.91614 0.171
NP_440914.1_1 Forward -222 -212 13.885 0.022
NP_440914.1_1 Reverse -24 -34 8.6151 0.186
NP_440914.1_1 Forward -33 -23 8.51751 0.186
NP_441011.1_8 Reverse -25 -34 16.9127 0.00602
NP_441011.1_8 Forward -32 -23 14.356 0.0249
NP_442533.1_6 Forward -33 -24 17.2076 0.00137
NP_442533.1_6 Reverse -24 -33 17.2076 0.00137
NP_442533.1_6 Forward -216 -207 13.5694 0.021
NP_442533.1_6 Forward -222 -213 6.98123 0.0992
NP_442533.1_6 Reverse -207 -216 6.78456 0.103
NP_442541.1_10 Reverse -105 -119 2.06395 0.269
NP_442541.1_10 Forward -216 -202 1.08065 0.292
NP_442232.1_2 Reverse -185 -204 9.73422 0.289
NP_442232.1_3 Reverse -205 -224 -11.0136 0.277
NP_442232.1_3 Reverse -16 -35 -11.8986 0.282
NP_442322.1_4 Forward -339 -322 -10.0899 0.298
NP_443016.1_1 Forward -39 -20 0.294447 0.199
NP_441482.1_7 Reverse -18 -32 -10.6202 0.211
NP_441482.1_7 Forward -39 -25 -10.9151 0.222
NP_439944.1_9 Forward -32 -22 17.4829 0.00423
NP_439944.1_9 Reverse -25 -35 10.3048 0.0887
NP_440816.1_7 Reverse -20 -39 20.1573 0.181
NP_441028.1_6 Forward -90 -80 5.97777 0.234
NP_440115.1_6 Reverse -21 -31 18.2696 0.0139
NP_440007.1_9 Forward -220 -206 0.491246 0.297
NP_439965.1_7 Reverse -26 -45 11.9744 0.294
NP_441961.1_4 Forward -224 -205 9.73422 0.259
NP_441602.1_4 Forward -44 -25 8.25926 0.293
NP_440317.1_9 Reverse -221 -240 13.6675 0.181
NP_441972.1_5 Forward -248 -229 -7.86702 0.254
NP_441972.1_5 Reverse -106 -125 -9.44032 0.285
NP_441106.1_1 Forward -34 -25 18.191 0.0028
NP_441106.1_1 Reverse -23 -32 9.73449 0.0311
NP_442306.1_10 Forward -38 -19 -21.3384 0.263
NP_441286.1_1 Forward -34 -22 14.6903 0.00418
NP_441286.1_1 Reverse -23 -35 5.05386 0.0259
NP_441286.1_1 Reverse -38 -50 -1.73098 0.145
NP_440670.1_8 Forward -33 -24 18.3876 0.000699
NP_440670.1_8 Reverse -24 -33 18.3876 0.000699
NP_441930.1_2 Reverse -213 -223 14.0414 0.236
NP_441930.1_2 Forward -223 -213 13.0581 0.248
NP_440886.1_7 Forward -34 -24 17.7774 0.0011
NP_440886.1_7 Reverse -23 -33 8.04271 0.0805
NP_440886.1_7 Forward -313 -303 3.71617 0.267
NP_440828.1_1 Reverse -107 -126 1.47364 0.253
NP_442614.1_2 Forward -33 -19 8.35772 0.255
NP_439995.1_5 Forward -43 -24 6.88262 0.276
NP_442072.1_1 Forward -308 -290 9.0656 0.231
NP_442072.1_9 Reverse -23 -41 -21.9087 0.215
NP_441753.1_10 Reverse -15 -34 7.17762 0.186
NP_441753.1_10 Forward -42 -23 5.50599 0.186
NP_441753.1_10 Forward -231 -212 0.491109 0.291
NP_442022.1_4 Reverse -195 -214 6.58763 0.27
NP_440907.2_8 Forward -32 -22 19.449 0.00351
NP_440907.2_8 Reverse -25 -35 7.84605 0.117
NP_442264.1_1 Reverse -304 -323 14.3558 0.296
NP_442264.1_2 Reverse -20 -37 8.98696 0.205
NP_442264.1_2 Reverse -203 -220 5.44704 0.276
NP_441021.1_8 Forward -38 -20 7.98396 0.181
NP_441463.1_3 Forward -43 -24 16.0274 0.018
NP_441463.1_3 Reverse -14 -33 10.1275 0.0481
NP_441463.1_3 Forward -337 -318 -2.85214 0.162
NP_441463.1_3 Reverse -35 -54 -5.21209 0.222
NP_441463.1_6 Reverse -211 -225 11.2476 0.224
NP_441463.1_6 Forward -35 -21 7.57554 0.256
NP_442893.1_6 Reverse -208 -227 6.39097 0.205
NP_441626.1_2 Forward -32 -25 15.7721 0.0124
NP_441626.1_2 Reverse -25 -32 15.7721 0.0124
NP_442365.1_5 Forward -32 -13 19.0757 0.0501
NP_442365.1_7 Reverse -20 -39 9.63589 0.0723
NP_440107.1_5 Forward -40 -21 -0.787193 0.178
NP_440107.1_5 Forward -49 -30 -6.98204 0.272
NP_442615.1_1 Reverse -15 -33 -3.02911 0.154
NP_441962.1_4 Reverse -208 -227 -1.08219 0.118
NP_440387.1_1 Reverse -24 -40 15.5948 0.00527
NP_440387.1_1 Forward -33 -17 -1.41643 0.142
NP_440387.1_1 Forward -327 -311 -5.25134 0.222
NP_441431.1_2 Reverse -21 -35 9.34041 0.19
NP_441431.1_2 Forward -36 -22 8.55376 0.211
NP_441488.1_7 Reverse -18 -37 9.14423 0.121
NP_441488.1_8 Reverse -275 -289 7.17714 0.268
NP_441836.1_2 Reverse -201 -220 -4.6221 0.261
NP_440634.1_7 Forward -219 -200 15.9291 0.158
NP_441993.1_1 Forward -222 -203 9.54836 0.135
NP_441993.1_1 Reverse -207 -226 6.62464 0.178
NP_441993.1_1 Forward -120 -101 1.4594 0.276
NP_440143.1_1 Forward -225 -206 17.404 0.205
NP_441174.1_2 Reverse -210 -224 15.8309 0.0907
NP_440114.1_10 Forward -33 -19 14.5526 0.0382
NP_440114.1_10 Reverse -24 -38 12.586 0.0783
NP_440114.1_10 Reverse -213 -227 5.89945 0.292
NP_442323.1_7 Forward -338 -319 1.47364 0.279
NP_440725.1_4 Reverse -209 -228 2.3594 0.195
NP_441720.1_2 Reverse -20 -39 7.27514 0.213
NP_440293.1_3 Reverse -205 -224 2.94938 0.192
NP_440293.1_3 Reverse -182 -201 -4.22878 0.26
NP_440766.1_4 Reverse -20 -34 7.86607 0.0871
NP_440766.1_4 Forward -37 -23 5.50613 0.11
NP_439988.1_3 Reverse -203 -217 4.03116 0.296
NP_439988.1_7 Reverse -26 -40 12.8803 0.292
NP_441237.1_9 Forward -32 -22 17.2863 0.00348
NP_441237.1_9 Forward -222 -212 10.1081 0.248
NP_442743.1_4 Reverse -73 -92 -6.98204 0.279
NP_442743.1_5 Reverse -25 -44 5.50599 0.202
NP_440643.1_6 Forward -242 -223 0.58944 0.294
NP_442867.1_8 Reverse -50 -69 8.45592 0.233
NP_440457.1_1 Forward -37 -25 11.4454 0.092
NP_440457.1_1 Reverse -20 -32 9.97041 0.092
NP_442940.1_2 Forward -33 -14 8.06259 0.167
NP_442940.1_2 Forward -321 -302 0.58944 0.296
NP_440798.1_6 Reverse -25 -38 5.03416 0.14
NP_440798.1_6 Forward -32 -19 2.96921 0.158
NP_441801.1_4 Forward -46 -36 2.7333 0.262
NP_442680.1_5 Reverse -252 -271 1.92835 0.237
NP_441984.1_3 Reverse -203 -221 11.2289 0.177
NP_440473.1_9 Reverse -13 -32 -7.4737 0.236
NP_442509.1_9 Forward -33 -23 17.3841 0.00128
NP_442509.1_9 Reverse -24 -34 16.2041 0.00739
NP_442509.1_9 Forward -320 -310 6.66608 0.259
NP_440554.1_4 Reverse -25 -35 14.6313 0.02
NP_440554.1_4 Forward -32 -22 6.27322 0.123
NP_441885.1_5 Reverse -24 -34 11.4848 0.00668
NP_441885.1_5 Forward -33 -23 11.3864 0.00668
NP_441885.1_5 Forward -222 -212 -0.216628 0.189
NP_441885.1_5 Reverse -207 -217 -0.314959 0.195
NP_441885.1_5 Reverse -111 -121 -1.3966 0.26
NP_440649.2_8 Reverse -79 -93 11.2093 0.265
NP_440898.1_5 Reverse -213 -232 14.9458 0.161
NP_442341.1_3 Forward -170 -151 2.85105 0.236
NP_442341.1_7 Forward -34 -20 14.9459 0.0256
NP_442341.1_7 Reverse -23 -37 7.37441 0.107
NP_442341.1_7 Reverse -206 -220 4.71948 0.181
NP_442341.1_9 Forward -35 -21 5.30886 0.274
NP_442395.2_4 Forward -223 -204 2.16195 0.224
NP_442395.2_4 Forward -34 -15 -0.00131823 0.28
NP_443000.1_7 Forward -35 -25 8.73149 0.0437
NP_443000.1_7 Reverse -22 -32 2.14332 0.226
NP_440507.2_3 Reverse -204 -223 15.9282 0.0822
NP_440507.2_3 Reverse -364 -383 12.88 0.145
NP_441842.1_1 Forward -31 -18 11.8184 0.241
NP_441842.1_10 Reverse -17 -31 16.9125 0.0273
NP_441842.1_10 Forward -40 -26 14.9459 0.0499
NP_440275.1_3 Reverse -22 -32 19.5479 0.00756
NP_440275.1_3 Forward -35 -25 8.4365 0.0602
NP_440275.1_3 Reverse -109 -119 2.7333 0.254
NP_440091.1_1 Forward -37 -25 17.7386 0.013
NP_440091.1_1 Reverse -20 -32 0.825626 0.227
NP_443010.1_10 Forward -36 -19 21.2278 0.0127
NP_443010.1_10 Reverse -21 -38 7.79575 0.165
NP_442451.1_2 Forward -41 -22 -5.60541 0.226
NP_442451.1_2 Forward -390 -371 -8.16202 0.241
NP_442638.1_2 Forward -362 -343 11.0125 0.289
NP_439962.1_6 Forward -130 -112 15.6538 0.169
NP_440149.1_8 Reverse -24 -43 -0.983855 0.154
NP_441105.1_3 Reverse -202 -221 2.45773 0.103
NP_441105.1_3 Forward -131 -112 -2.85214 0.169
NP_441105.1_3 Forward -227 -208 -5.9004 0.225
NP_441105.1_3 Reverse -13 -32 -8.06369 0.265
NP_442373.1_1 Forward -342 -323 -11.2103 0.29
NP_440216.1_1 Reverse -24 -38 7.86607 0.00793
NP_440216.1_1 Forward -33 -19 -1.27871 0.0303
NP_440216.1_9 Forward -214 -205 5.89959 0.289
NP_440172.1_1 Forward -33 -23 16.303 0.00854
NP_440172.1_1 Reverse -24 -34 8.73149 0.0586
NP_442371.1_1 Forward -306 -296 14.2375 0.191
NP_442015.1_10 Forward -37 -24 9.85238 0.0433
NP_442015.1_10 Reverse -20 -33 3.65753 0.178
NP_441226.1_7 Forward -32 -25 14.4934 0.0123
NP_441226.1_7 Reverse -25 -32 14.4934 0.0123
NP_441111.1_7 Forward -32 -24 18.7023 0.00294
NP_441111.1_7 Reverse -25 -33 18.7023 0.00294
NP_442379.1_10 Forward -40 -23 5.05372 0.135
NP_440415.1_9 Reverse -28 -47 19.5673 0.097
NP_441766.1_2 Forward -33 -24 17.5026 0.00297
NP_441766.1_2 Reverse -24 -33 17.5026 0.00297
NP_441766.1_9 Reverse -25 -44 4.03102 0.205
NP_440416.1_9 Forward -40 -21 -4.81876 0.0783
NP_440416.1_9 Reverse -104 -123 -17.7985 0.247
NP_440416.1_9 Forward -328 -309 -18.0934 0.251
NP_440416.1_9 Reverse -206 -225 -18.3884 0.256
NP_443052.1_8 Forward -43 -24 -0.983855 0.0754
NP_443052.1_8 Reverse -14 -33 -3.14714 0.0981
NP_443052.1_9 Reverse -113 -132 1.76941 0.181
NP_443052.1_9 Forward -319 -300 -6.49039 0.283
NP_443052.1_9 Forward -131 -112 -6.78538 0.289
NP_442403.1_8 Reverse -26 -45 -2.0655 0.263
NP_442403.1_9 Forward -339 -320 3.53937 0.267
NP_440591.1_9 Forward -127 -109 10.1472 0.13
NP_440591.1_9 Reverse -206 -224 8.18062 0.187
NP_442154.1_1 Reverse -181 -199 -9.91228 0.195
NP_442226.1_8 Reverse -185 -195 15.6147 0.167
NP_442226.1_8 Reverse -235 -245 13.0581 0.274
NP_440261.1_5 Forward -32 -19 16.5389 0.0105
NP_440261.1_5 Reverse -25 -38 -12.1738 0.272
NP_440988.1_10 Forward -218 -204 9.44903 0.204
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAGAAGTTAGGCAGTACCAGCAAGCTTCCTGGAGCCGGAAAAAGGAGATGTACATTAAGTAACCGCTGAACACCGCCATGGACGTACCCCCCACCAGGAGAAATTTTCCGGTGAGATCTTCCAGGGAGTTACGCTGTTTTTTGTTGCTCTCCTCACTGACCAAAAAGGGCACCAAAGCGGCAATGCCCATGGCCAGATAAGCTGCCAGCCCAAAAACACTGAGGGGAATGTCAAAAACTTTGGCGTAGGCACTCTGTAACACCAGGTCACAACTGGAGCTACCGGTGGCCTGGTCCACGGGACAAAGGGCTTCTCCCCCGGTGAAGGAAATATAGGCCAGGTAGGAGGTGATCAAGATCCCCAGGACGGCGATCGCCCCCATAATGAAACGGGAATAGCG

CDS

ATGAATCCAAGGCACCGAACGACGACGAACCATAAATTAAAAGAGCAATTGATTTACAACCAGGTTAGCAAAAACCCGCCATGGGATAAGCTGACCGCCCTAGTCCCCGGTGGGGCATGGTTACAAACACCAACGGCCATGGCTTTCCCTGCGACTTTTAACCATTCTAGGGGCAACCTCCCAGTTCCAATTCAACGGTGCCAAATTCTATCAAGGGCAAAATTTGTGGGCAAGCAACCATCTCGAAGAAAGCAATTGAGGATTTCCAAACGGTTACTGTTAGTGGTGTTAACCCTAGCGTTTAGTATGGCTAGTGTGGGCATTATGGAGGATTTTCAGGGTAATTTTTGGCTCAAAACTTATTTGCTGCTGGGGGCGTTATTTTGGGGCAATTTGCTCATTTATCTGAGTTTTTATCCCCGGTGGGGGCAAAAGTTATTGCAACGGGAACAAAAGAAAAGCGGTCCAATTTCTGGCCCCAAATCCCGCCACGGGCAAAAAAACTAA

Protein

MNPRHRTTTNHKLKEQLIYNQVSKNPPWDKLTALVPGGAWLQTPTAMAFPATFNHSRGNLPVPIQRCQILSRAKFVGKQPSRRKQLRISKRLLLVVLTLAFSMASVGIMEDFQGNFWLKTYLLLGALFWGNLLIYLSFYPRWGQKLLQREQKKSGPISGPKSRHGQKN