Your browser is old and dusty. Try Google Chrome!

Details for sll0546

ORF sll0546
Accession NP_442417.1
Symbol
Category Protein modification and translation factors
Definition probable translation initiation factor
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -266 -280 4.03116 0.157
NP_441061.1_2 Forward -337 -323 1.08123 0.195
NP_441061.1_2 Reverse -370 -384 0.294584 0.213
NP_441453.1_1 Reverse -94 -112 4.04996 0.263
NP_441453.1_4 Forward -69 -61 6.80426 0.121
NP_441453.1_4 Reverse -60 -68 6.11594 0.121
NP_441453.1_7 Forward -305 -298 12.1338 0.295
NP_441818.1_1 Forward -331 -320 11.4645 0.177
NP_441818.1_9 Forward -286 -267 -0.787193 0.196
NP_440996.1_4 Forward -290 -280 16.008 0.265
NP_442173.1_1 Reverse -61 -69 12.0158 0.0316
NP_442173.1_1 Forward -68 -60 10.7375 0.0611
NP_442752.1_4 Forward -69 -62 13.8055 0.0199
NP_440784.1_7 Forward -68 -61 6.23397 0.241
NP_440784.1_7 Reverse -61 -68 6.13563 0.241
NP_442861.1_1 Reverse -378 -397 18.7807 0.19
NP_441250.1_6 Reverse -119 -138 19.3707 0.194
NP_441476.1_4 Reverse -225 -244 16.1249 0.298
NP_442062.1_8 Forward -69 -59 7.55152 0.0946
NP_442581.1_1 Reverse -380 -394 8.84938 0.235
NP_441859.1_3 Forward -123 -104 2.9486 0.253
NP_441581.1_9 Forward -155 -136 4.82192 0.296
NP_440370.1_10 Reverse -51 -70 7.57094 0.255
NP_442276.1_5 Reverse -56 -74 15.5554 0.135
NP_441925.1_2 Reverse -364 -383 2.94938 0.262
NP_441083.1_5 Forward -69 -59 7.05986 0.067
NP_441083.1_5 Reverse -60 -70 0.766681 0.218
NP_441738.1_2 Reverse -62 -69 15.28 0.0102
NP_441558.1_5 Forward -71 -52 3.93269 0.294
NP_440209.1_1 Forward -69 -61 8.57422 0.0425
NP_440870.1_3 Forward -251 -232 6.88262 0.122
NP_442889.1_8 Forward -166 -152 3.04726 0.291
NP_441598.1_4 Forward -237 -218 16.3224 0.247
NP_442111.1_4 Reverse -59 -73 18.1908 0.0079
NP_441624.1_7 Forward -384 -370 7.57108 0.249
NP_440906.1_5 Forward -68 -61 6.23397 0.234
NP_440906.1_5 Reverse -61 -68 6.13563 0.241
NP_441209.1_8 Reverse -141 -159 6.54708 0.296
NP_440747.1_10 Forward -72 -60 -2.4193 0.0434
NP_440747.1_10 Reverse -57 -69 -12.2524 0.254
NP_441130.1_10 Forward -71 -57 11.3077 0.107
NP_441486.1_1 Reverse -17 -31 3.14618 0.0662
NP_441486.1_1 Reverse -366 -380 -1.67204 0.174
NP_441012.1_4 Reverse -62 -75 5.62415 0.291
NP_439978.1_1 Reverse -42 -58 8.90832 0.297
NP_443018.1_3 Reverse -61 -68 11.7405 0.0655
NP_443018.1_3 Forward -68 -61 5.44732 0.193
NP_441634.1_9 Forward -285 -266 11.6017 0.244
NP_440376.1_1 Forward -69 -60 5.99792 0.111
NP_440376.1_1 Reverse -60 -69 -0.196935 0.285
NP_441002.1_5 Forward -225 -206 12.2908 0.221
NP_441588.1_4 Forward -63 -53 7.45319 0.178
NP_442687.1_7 Forward -70 -60 4.50326 0.245
NP_442530.1_2 Forward -24 -14 15.6147 0.203
NP_441013.1_3 Forward -343 -324 9.14423 0.233
NP_441080.1_7 Reverse -190 -208 8.76983 0.238
NP_442658.1_1 Forward -71 -61 7.35439 0.214
NP_442198.1_3 Reverse -51 -70 3.14605 0.294
NP_442198.1_3 Forward -368 -349 2.16274 0.3
NP_440141.1_8 Forward -315 -296 15.5357 0.151
NP_440141.1_8 Reverse -376 -395 11.8975 0.193
NP_442782.1_2 Reverse -370 -384 2.85119 0.271
NP_440656.1_8 Reverse -279 -298 -9.44032 0.286
NP_440720.1_1 Forward -246 -227 0.687771 0.292
NP_441487.1_9 Forward -70 -51 9.3409 0.0988
NP_441958.1_5 Reverse -59 -69 0.865012 0.12
NP_441958.1_5 Forward -70 -60 0.865012 0.12
NP_440984.1_1 Forward -71 -52 11.7008 0.275
NP_439990.1_5 Forward -337 -324 8.67241 0.166
NP_442690.1_1 Reverse -186 -205 -14.7502 0.273
NP_442911.1_2 Reverse -50 -69 -10.7186 0.286
NP_440369.1_5 Forward -344 -325 8.45592 0.286
NP_440827.1_3 Reverse -364 -383 10.7175 0.297
NP_441129.1_3 Reverse -56 -75 -17.3068 0.281
NP_442002.1_9 Forward -70 -63 10.7572 0.185
NP_440809.1_9 Reverse -51 -69 -5.88071 0.225
NP_440377.1_1 Forward -30 -13 12.4333 0.26
NP_441000.1_6 Reverse -59 -73 5.21113 0.0933
NP_441000.1_6 Forward -70 -56 2.5562 0.136
NP_440147.1_4 Forward -71 -58 6.80412 0.0829
NP_441550.1_8 Reverse -58 -68 13.9425 0.0202
NP_441550.1_8 Forward -71 -61 7.55106 0.154
NP_441547.1_2 Forward -80 -62 7.19731 0.215
NP_441725.1_4 Forward -74 -60 2.5556 0.284
NP_441725.1_5 Forward -68 -58 0.766681 0.149
NP_439966.1_7 Forward -71 -61 8.23937 0.14
NP_439966.1_7 Reverse -58 -68 5.09279 0.243
NP_439966.1_9 Forward -71 -62 0.884706 0.253
NP_442941.1_3 Reverse -61 -71 0.963343 0.16
NP_440289.1_2 Forward -72 -59 -4.9956 0.294
NP_442281.1_1 Forward -74 -60 8.55376 0.0798
NP_442281.1_1 Reverse -318 -332 5.40719 0.159
NP_441079.1_3 Forward -304 -285 24.9755 0.0101
NP_441644.1_6 Forward -69 -59 3.61784 0.272
NP_441071.1_3 Forward -144 -125 7.57013 0.276
NP_442215.1_2 Reverse -367 -383 -0.138127 0.162
NP_442029.1_6 Reverse -44 -63 8.35759 0.207
NP_440253.1_2 Forward -299 -281 -1.65248 0.245
NP_440929.1_8 Reverse -60 -69 14.651 0.0105
NP_440929.1_8 Forward -69 -60 7.66954 0.0624
NP_440780.1_1 Forward -156 -137 7.20922 0.282
NP_442926.1_1 Reverse -335 -354 -1.18052 0.278
NP_442554.1_8 Forward -68 -58 9.41981 0.0594
NP_442554.1_8 Reverse -61 -71 4.3066 0.189
NP_441762.1_7 Reverse -59 -71 -5.76255 0.238
NP_441762.1_7 Reverse -40 -52 -6.84419 0.284
NP_442292.1_1 Reverse -61 -70 -0.196935 0.239
NP_442292.1_1 Forward -68 -59 -0.786921 0.287
NP_442476.1_6 Reverse -61 -75 0.491246 0.258
NP_441711.1_3 Reverse -221 -239 17.7187 0.217
NP_441715.1_4 Reverse -102 -112 13.5497 0.0431
NP_441715.1_4 Reverse -61 -71 9.02648 0.105
NP_440620.1_4 Forward -206 -192 16.4362 0.236
NP_441448.1_1 Reverse -374 -393 10.5209 0.191
NP_441468.1_1 Forward -68 -61 6.13563 0.209
NP_441468.1_1 Reverse -61 -68 6.0373 0.223
NP_441673.1_1 Forward -69 -60 1.37636 0.114
NP_441673.1_1 Reverse -60 -69 1.1797 0.163
NP_441731.1_3 Forward -77 -58 4.42435 0.159
NP_441637.1_9 Forward -368 -350 -3.71743 0.296
NP_442868.1_6 Reverse -321 -331 3.32329 0.2
NP_442868.1_6 Forward -71 -61 0.57002 0.217
NP_442868.1_6 Reverse -58 -68 -0.216628 0.273
NP_442719.1_2 Forward -29 -11 -11.0929 0.287
NP_441612.1_2 Reverse -233 -243 11.8409 0.21
NP_442808.1_1 Forward -229 -219 3.51951 0.238
NP_440918.1_2 Forward -348 -329 10.0292 0.282
NP_440145.1_3 Forward -79 -60 -3.73712 0.208
NP_442542.1_2 Forward -71 -58 5.52582 0.262
NP_442050.1_5 Reverse -58 -68 10.8943 0.126
NP_441114.1_3 Forward -28 -19 15.1427 0.193
NP_441114.1_3 Reverse -324 -333 7.37455 0.239
NP_440558.1_2 Reverse -319 -338 5.99764 0.137
NP_440558.1_2 Forward -341 -322 -2.0655 0.222
NP_441878.1_6 Reverse -59 -69 0.57002 0.14
NP_441036.1_3 Forward -228 -209 -2.45882 0.235
NP_441036.1_8 Forward -70 -60 6.8632 0.213
NP_441557.1_5 Reverse -60 -69 7.57121 0.049
NP_441557.1_5 Forward -69 -60 1.08137 0.0794
NP_441433.1_8 Reverse -371 -390 -3.63879 0.283
NP_441914.1_2 Forward -340 -322 19.1937 0.0907
NP_442183.1_3 Forward -392 -373 15.3382 0.243
NP_440861.1_3 Forward -358 -340 9.16393 0.296
NP_442347.1_2 Reverse -61 -70 8.94785 0.0718
NP_441411.1_3 Reverse -292 -311 13.0775 0.0705
NP_442738.1_4 Forward -113 -94 12.3892 0.247
NP_441633.1_3 Forward -71 -58 -4.30728 0.191
NP_441633.1_3 Reverse -58 -71 -4.40561 0.195
NP_440136.1_2 Forward -68 -61 6.23397 0.171
NP_440136.1_2 Reverse -61 -68 6.13563 0.193
NP_442998.1_5 Reverse -382 -392 12.6647 0.162
NP_442998.1_10 Reverse -62 -69 15.5754 0.0102
NP_441799.1_1 Reverse -56 -70 5.70218 0.197
NP_440256.1_1 Reverse -366 -385 -8.16202 0.253
NP_441118.1_2 Reverse -63 -82 11.2092 0.237
NP_442852.1_1 Reverse -295 -313 15.358 0.296
NP_441559.1_8 Forward -74 -60 -7.17857 0.287
NP_440915.1_6 Forward -73 -59 10.9143 0.0297
NP_442158.1_4 Forward -367 -357 12.0747 0.259
NP_441464.1_8 Forward -69 -55 9.2427 0.192
NP_442993.1_1 Forward -398 -382 -10.5612 0.222
NP_442993.1_1 Reverse -212 -228 -14.0028 0.295
NP_442386.1_9 Reverse -19 -28 8.75075 0.184
NP_442386.1_9 Forward -70 -61 5.9975 0.23
NP_442386.1_9 Reverse -322 -331 5.30919 0.257
NP_441340.1_5 Forward -68 -61 13.5105 0.0314
NP_441340.1_5 Reverse -61 -68 5.84064 0.208
NP_441947.1_4 Reverse -327 -346 11.7008 0.253
NP_440327.1_8 Reverse -44 -63 15.5357 0.238
NP_440211.1_4 Forward -373 -363 15.418 0.22
NP_440586.1_8 Reverse -61 -68 9.47853 0.146
NP_440586.1_8 Forward -68 -61 5.74197 0.283
NP_442251.1_6 Reverse -102 -109 8.10225 0.245
NP_442959.1_7 Reverse -321 -340 -1.37718 0.247
NP_441262.1_3 Forward -69 -62 14.7888 0.0223
NP_443051.1_1 Forward -70 -61 7.47288 0.0571
NP_443051.1_1 Reverse -59 -68 6.19458 0.0849
NP_439937.1_9 Forward -395 -378 -2.02679 0.14
NP_439937.1_9 Reverse -59 -76 -9.59824 0.196
NP_439937.1_9 Forward -70 -53 -16.7764 0.287
NP_440439.1_1 Forward -72 -59 8.9674 0.0488
NP_440439.1_1 Reverse -57 -70 -0.570702 0.226
NP_440372.1_2 Forward -68 -61 13.8055 0.0214
NP_440372.1_2 Reverse -61 -68 6.52896 0.188
NP_440819.1_5 Reverse -5 -13 7.98423 0.228
NP_440819.1_5 Forward -229 -221 7.98423 0.228
NP_441572.1_7 Forward -75 -56 7.07928 0.0785
NP_442384.1_10 Reverse -60 -73 7.09911 0.0875
NP_442790.1_4 Forward -119 -100 -11.0136 0.22
NP_442790.1_4 Forward -78 -59 -13.8652 0.268
NP_442262.1_10 Reverse -61 -68 13.2155 0.0213
NP_442910.1_1 Forward -76 -57 3.04771 0.118
NP_440297.1_9 Forward -68 -58 0.176696 0.282
NP_442280.1_10 Forward -341 -323 4.67522 0.296
NP_441896.1_3 Forward -346 -327 -2.0655 0.275
NP_442067.1_4 Reverse -117 -136 2.16274 0.298
NP_440999.1_9 Forward -73 -59 -1.77037 0.249
NP_442948.1_2 Reverse -59 -78 3.6377 0.283
NP_440575.1_1 Forward -369 -350 4.22689 0.236
NP_442077.1_9 Forward -26 -7 0.0977854 0.22
NP_441543.1_2 Reverse -61 -70 8.65285 0.0968
NP_441469.1_8 Forward -70 -61 6.39124 0.227
NP_442337.1_8 Forward -291 -272 0.196116 0.255
NP_442578.1_7 Forward -68 -61 6.0373 0.18
NP_441462.1_2 Forward -69 -59 9.51814 0.0171
NP_441621.1_7 Reverse -58 -72 -4.62196 0.238
NP_443062.1_1 Reverse -60 -78 6.01073 0.211
NP_443062.1_1 Reverse -154 -172 3.57305 0.293
NP_440519.1_8 Reverse -370 -386 10.8749 0.193
NP_442204.1_1 Forward -73 -62 11.5634 0.0565
NP_440516.1_2 Reverse -54 -72 -0.0791831 0.243
NP_440516.1_6 Forward -393 -379 13.4703 0.188
NP_440516.1_8 Forward -69 -60 9.53783 0.0136
NP_440516.1_8 Reverse -60 -69 5.01461 0.118
NP_442428.1_5 Forward -68 -61 6.13563 0.209
NP_442428.1_5 Reverse -61 -68 6.0373 0.212
NP_441867.1_2 Reverse -375 -394 -6.98204 0.189
NP_440673.1_3 Reverse -62 -69 12.4288 0.0426
NP_442219.1_9 Forward -28 -19 2.16301 0.284
NP_440436.1_4 Reverse -61 -70 8.55409 0.0997
NP_442086.1_3 Forward -68 -49 7.37428 0.272
NP_440314.1_9 Reverse -102 -121 -10.1286 0.286
NP_441719.1_4 Forward -68 -61 6.82395 0.0855
NP_441719.1_4 Reverse -61 -68 6.52896 0.188
NP_442366.1_3 Reverse -59 -77 -2.93078 0.235
NP_439949.1_8 Forward -56 -37 21.6314 0.147
NP_440129.1_10 Forward -76 -62 13.7659 0.0534
NP_442206.1_10 Reverse -323 -338 2.92983 0.196
NP_441851.1_10 Forward -70 -60 6.17489 0.182
NP_441851.1_10 Reverse -59 -69 6.07655 0.187
NP_441668.1_4 Reverse -168 -187 -1.67217 0.278
NP_442515.1_1 Forward -70 -56 -0.393733 0.222
NP_441982.1_6 Reverse -380 -389 10.48 0.296
NP_442689.1_8 Reverse -190 -207 -1.73112 0.221
NP_440396.1_10 Forward -58 -42 12.1525 0.171
NP_440588.1_2 Forward -78 -59 4.42435 0.0817
NP_442335.1_7 Reverse -61 -75 12.782 0.264
NP_440943.1_7 Forward -53 -34 19.7631 0.293
NP_441570.1_1 Forward -110 -92 -10.2073 0.163
NP_441570.1_6 Forward -44 -25 4.12936 0.264
NP_441078.1_4 Forward -69 -60 0.196389 0.205
NP_441078.1_4 Reverse -60 -69 -0.000272808 0.205
NP_441432.1_8 Forward -70 -61 5.50626 0.151
NP_441432.1_8 Reverse -322 -331 5.40793 0.158
NP_441432.1_8 Forward -332 -323 2.65466 0.292
NP_442320.1_8 Forward -75 -61 -3.54032 0.124
NP_442797.1_1 Reverse -339 -358 -3.44213 0.279
NP_442274.1_8 Forward -386 -368 13.5697 0.286
NP_442489.1_7 Forward -69 -60 0.688044 0.152
NP_442489.1_7 Reverse -60 -69 0.688044 0.152
NP_440559.1_1 Forward -68 -59 13.6677 0.0368
NP_441659.2_8 Forward -69 -59 6.46988 0.0744
NP_441968.1_1 Reverse -358 -366 14.3753 0.286
NP_442008.1_2 Reverse -57 -76 2.45773 0.286
NP_440545.1_3 Reverse -56 -73 1.12048 0.125
NP_440847.1_3 Forward -392 -378 11.5037 0.263
NP_441888.1_7 Forward -74 -60 5.89945 0.225
NP_441948.1_4 Reverse -53 -71 -1.25915 0.145
NP_441833.1_4 Reverse -61 -68 6.52896 0.0924
NP_441833.1_4 Forward -68 -61 6.23397 0.163
NP_442162.1_9 Forward -68 -61 12.9205 0.0282
NP_442162.1_9 Reverse -61 -68 12.9205 0.0282
NP_440671.1_4 Forward -75 -61 10.816 0.149
NP_442045.1_5 Forward -135 -116 -2.95047 0.294
NP_442140.1_3 Reverse -61 -71 12.1731 0.0637
NP_440875.1_9 Reverse -62 -72 17.327 0.0126
NP_441813.1_5 Reverse -58 -68 14.4347 0.0152
NP_441813.1_5 Forward -71 -61 9.7148 0.0241
NP_441259.1_3 Reverse -339 -358 10.6192 0.251
NP_440590.1_4 Reverse -61 -74 -3.22564 0.255
NP_440590.1_4 Forward -68 -55 -4.9956 0.272
NP_442497.1_10 Forward -68 -59 8.25953 0.047
NP_442497.1_10 Reverse -61 -70 0.589713 0.153
NP_440821.1_4 Reverse -58 -68 0.57002 0.169
NP_440821.1_4 Forward -71 -61 0.471689 0.174
NP_441239.1_9 Reverse -58 -70 13.9036 0.0335
NP_441239.1_9 Forward -71 -59 3.87389 0.272
NP_440400.1_1 Reverse -325 -344 -3.34455 0.294
NP_442669.1_1 Reverse -130 -149 14.3558 0.00897
NP_442643.1_5 Reverse -138 -157 3.14605 0.25
NP_440546.1_4 Forward -69 -59 6.94336 0.269
NP_441509.1_1 Forward -370 -351 7.27595 0.245
NP_440462.1_6 Forward -71 -61 7.74818 0.0699
NP_440868.1_4 Forward -73 -61 8.00379 0.0602
NP_442402.1_10 Forward -390 -380 16.2041 0.118
NP_441848.1_7 Reverse -283 -302 -4.72118 0.298
NP_440696.1_3 Reverse -56 -74 -1.45582 0.259
NP_442023.1_3 Reverse -269 -288 11.11 0.294
NP_442039.1_4 Forward -68 -61 11.6422 0.0747
NP_442039.1_7 Forward -376 -366 7.35486 0.277
NP_442837.1_3 Forward -68 -61 6.0373 0.25
NP_442837.1_3 Reverse -61 -68 6.0373 0.25
NP_442053.1_1 Reverse -60 -69 7.07956 0.105
NP_440505.1_3 Forward -71 -61 14.3364 0.0224
NP_440505.1_3 Reverse -321 -331 4.3066 0.3
NP_441252.1_6 Forward -302 -295 14.3954 0.168
NP_441252.1_6 Reverse -18 -25 14.3954 0.168
NP_441252.1_6 Reverse -380 -387 11.6422 0.288
NP_441408.2_7 Reverse -335 -354 0.294447 0.228
NP_440914.1_1 Reverse -323 -333 11.6404 0.0843
NP_441011.1_8 Reverse -61 -70 7.07956 0.179
NP_442533.1_6 Reverse -60 -69 4.42462 0.179
NP_442322.1_4 Reverse -257 -274 -8.61494 0.286
NP_441482.1_7 Forward -75 -61 -2.85201 0.1
NP_441028.1_6 Forward -389 -379 9.71433 0.21
NP_441028.1_6 Forward -78 -68 5.78111 0.243
NP_440115.1_6 Forward -72 -62 7.64985 0.146
NP_440007.1_9 Reverse -319 -333 6.6861 0.219
NP_440007.1_9 Forward -382 -368 6.6861 0.219
NP_440007.1_9 Forward -73 -59 0.88457 0.29
NP_441680.1_4 Reverse -308 -327 -2.16383 0.266
NP_442492.1_2 Reverse -128 -147 -1.18052 0.292
NP_440608.1_6 Reverse -324 -343 7.37347 0.238
NP_441106.1_1 Forward -70 -61 8.45619 0.0548
NP_442588.1_1 Forward -349 -330 10.9142 0.177
NP_440670.1_8 Forward -69 -60 16.0277 0.00443
NP_440670.1_8 Reverse -60 -69 12.5861 0.0253
NP_442614.1_2 Reverse -20 -34 10.0294 0.235
NP_442614.1_2 Forward -69 -55 9.83269 0.242
NP_440907.2_8 Reverse -61 -71 6.17443 0.178
NP_441021.1_1 Reverse -102 -121 -12.7836 0.295
NP_441463.1_2 Reverse -137 -155 8.53999 0.14
NP_441626.1_2 Forward -68 -61 12.2322 0.0511
NP_441626.1_2 Reverse -61 -68 5.93897 0.231
NP_441431.1_2 Forward -72 -58 5.89884 0.284
NP_440114.1_10 Forward -69 -55 12.3893 0.0845
NP_442698.1_10 Reverse -62 -81 2.75272 0.284
NP_440293.1_9 Forward -269 -255 12.1173 0.25
NP_440766.1_4 Forward -73 -59 2.06454 0.2
NP_440422.1_10 Reverse -133 -152 8.85527 0.212
NP_439910.1_2 Reverse -52 -69 -13.0392 0.127
NP_440457.1_1 Forward -73 -61 9.87208 0.092
NP_440798.1_6 Forward -68 -55 3.06754 0.153
NP_442509.1_9 Forward -69 -59 10.8943 0.152
NP_442509.1_9 Reverse -60 -70 9.41933 0.192
NP_440554.1_4 Reverse -61 -71 13.5497 0.0245
NP_441885.1_5 Forward -69 -59 -0.0199663 0.186
NP_441173.1_9 Forward -389 -381 13.1954 0.184
NP_441173.1_9 Forward -174 -166 12.9004 0.206
NP_441173.1_9 Forward -388 -380 12.507 0.206
NP_442395.2_4 Forward -385 -366 0.195343 0.276
NP_443000.1_7 Forward -71 -61 1.84832 0.228
NP_440507.2_3 Forward -341 -322 6.78348 0.299
NP_440275.1_3 Forward -71 -61 12.8614 0.0299
NP_440275.1_3 Reverse -58 -68 7.45319 0.0714
NP_441902.1_3 Reverse -231 -241 12.3014 0.256
NP_442638.1_3 Reverse -36 -55 13.1297 0.298
NP_440175.1_4 Forward -340 -321 -13.2752 0.246
NP_441105.1_3 Forward -80 -61 -8.26035 0.269
NP_440216.1_1 Forward -69 -55 -2.95034 0.0635
NP_440216.1_1 Reverse -60 -74 -4.52363 0.111
NP_442015.1_10 Reverse -56 -69 12.409 0.0372
NP_442015.1_10 Forward -73 -60 2.18257 0.199
NP_441226.1_7 Forward -68 -61 12.7234 0.0312
NP_441226.1_7 Reverse -61 -68 11.5435 0.0757
NP_441226.1_7 Reverse -370 -377 9.47853 0.147
NP_441226.1_7 Reverse -338 -345 5.64364 0.286
NP_441111.1_7 Reverse -61 -69 8.86921 0.0589
NP_441766.1_2 Reverse -60 -69 12.6844 0.0158
NP_442417.1_2 Forward -330 -312 20.3737 0.127
NP_442417.1_5 Reverse -60 -74 9.14437 0.138
NP_442417.1_9 Forward -69 -50 20.5506 0.246
NP_440416.1_9 Forward -76 -57 4.42435 0.0355
NP_443052.1_8 Reverse -50 -69 -1.67217 0.081
NP_442226.1_8 Forward -290 -280 17.3846 0.164
NP_440261.1_5 Forward -68 -55 -6.47056 0.201
NP_440261.1_5 Reverse -61 -74 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTGGCGGCCCATTTTCCCCAATACCGTTGGCAAATTTATCTTGGTGCCACCCTTTGGGTCGGCTTCATTGGCATTGCCAGTATGTATTGTCGGGTTCATTGGGCAACAGATATTTTGGCTGGTTACGGAGTGGGCTTTATCTGGTTAACCCTCAGTTTGTTTTTGCTCAAGCGGGAAAAGCCTGATGTCTATTTAAAATCTCAGTAAAACTAAAGTGCCCTCAAGATTCTACCAACATGCCATAGATCAAAACTTTACAAATAAGCTCTCCCACTAACAGCGTTGAATCTGGTAATCTCATTAGTAGGCGTAATGTGTACTATTTTACCCCGGCGATCGGACGCTAATTCCTCAATCACTCCCTACTTGTTAGCGTTGCCCAATATTTTTTTCCAGTCCT

CDS

ATGGCCAGTTCCAAACCTCCAGCTCGCATTGTTTATCAAGAATTTGGTCCGGTGGCAGACCCCCTATCGGAGGAGCAAATTGATCTTCCCCCCCAACAGCAAAATGTCCGCATCCAAGCAACTCGTTCTGGCCGCAAAGGAAAAACGGTGACGGTAGTGAGTGGTTTGCAATTATCGGCCATGGGACAGCAAGCTCTACTCAAGGCCCTGAAAAGTTTTTGTGGCAGTGGGGGCACCTTGAAAGAAGACTGCGTGGAAATCCAGGGGGATCAACGGGAGAAAATTCTTGCTTATTTGTTAAAGCAGGGCTACAAGGCTAAAATTAGTGGTGGTTAG

Protein

MASSKPPARIVYQEFGPVADPLSEEQIDLPPQQQNVRIQATRSGRKGKTVTVVSGLQLSAMGQQALLKALKSFCGSGGTLKEDCVEIQGDQREKILAYLLKQGYKAKISGG