Your browser is old and dusty. Try Google Chrome!

Details for sll0541

ORF sll0541
Accession NP_442430.1
Symbol desC,des9
Category acyl-lipid desaturase (delta 9)
Definition Fatty acid, phospholipid and sterol metabolism
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -369 -383 2.16287 0.178
NP_440557.1_1 Reverse -369 -388 8.75091 0.126
NP_440795.1_7 Forward -376 -369 14.6904 0.0123
NP_440795.1_7 Reverse -369 -376 14.6904 0.0123
NP_441418.1_6 Forward -377 -358 -27.1399 0.202
NP_441418.1_6 Reverse -167 -186 -30.4831 0.28
NP_441418.1_6 Reverse -242 -261 -30.7781 0.296
NP_440897.1_6 Forward -323 -304 -2.26292 0.206
NP_441453.1_4 Forward -377 -369 16.539 0.00633
NP_441453.1_4 Reverse -368 -376 7.8859 0.0536
NP_442151.1_6 Reverse -368 -382 8.94771 0.162
NP_440561.1_8 Reverse -306 -325 5.50599 0.289
NP_441818.1_1 Reverse -369 -380 9.20294 0.25
NP_441818.1_9 Reverse -314 -333 -1.47551 0.2
NP_440226.1_1 Reverse -368 -387 7.27595 0.109
NP_440226.1_1 Forward -377 -358 6.29264 0.132
NP_440813.1_1 Reverse -362 -376 18.8785 0.112
NP_442623.1_3 Forward -376 -357 -9.73531 0.154
NP_442287.1_4 Reverse -368 -387 15.2399 0.232
NP_442173.1_1 Reverse -369 -377 15.4574 0.00633
NP_442173.1_1 Forward -376 -368 14.1791 0.0165
NP_442752.1_4 Forward -377 -370 13.8055 0.0199
NP_442752.1_4 Reverse -314 -321 10.5605 0.1
NP_443027.1_4 Reverse -366 -376 14.238 0.0452
NP_443027.1_4 Forward -379 -369 13.2547 0.0521
NP_442975.1_10 Forward -381 -367 9.73373 0.0646
NP_440074.1_6 Reverse -112 -131 10.9134 0.268
NP_440784.1_7 Forward -376 -369 15.9687 0.0123
NP_440784.1_7 Reverse -369 -376 15.9687 0.0123
NP_442909.1_2 Reverse -264 -283 12.7825 0.254
NP_440061.1_9 Forward -265 -251 6.39049 0.248
NP_440110.1_8 Reverse -327 -346 2.3594 0.211
NP_442062.1_3 Forward -112 -93 -1.86883 0.264
NP_442062.1_8 Forward -377 -367 9.61647 0.0587
NP_440761.1_9 Reverse -52 -71 9.93088 0.212
NP_441859.1_3 Reverse -166 -185 1.86696 0.272
NP_440304.1_4 Forward -379 -369 10.8948 0.051
NP_442242.1_4 Forward -376 -369 14.3954 0.0124
NP_442242.1_4 Reverse -369 -376 14.3954 0.0124
NP_442762.1_10 Reverse -243 -262 -0.0988766 0.0837
NP_439918.1_2 Reverse -296 -315 -2.75381 0.249
NP_441208.1_9 Forward -153 -139 8.25939 0.219
NP_441594.1_6 Reverse -264 -283 8.16093 0.163
NP_440370.1_10 Reverse -359 -378 10.2259 0.211
NP_442110.1_7 Forward -377 -363 3.93283 0.209
NP_442110.1_7 Reverse -368 -382 3.73617 0.21
NP_442110.1_7 Forward -338 -324 2.35953 0.222
NP_442367.1_1 Reverse -260 -279 -10.9153 0.264
NP_440856.1_7 Reverse -258 -277 -8.35868 0.27
NP_441083.1_5 Forward -49 -39 4.0116 0.159
NP_441083.1_5 Reverse -368 -378 1.94665 0.197
NP_441083.1_5 Forward -377 -367 1.55333 0.204
NP_441738.1_2 Reverse -370 -377 15.28 0.0102
NP_441738.1_2 Forward -375 -368 11.5435 0.084
NP_441558.1_5 Reverse -366 -385 18.4857 0.0131
NP_440209.1_1 Forward -377 -369 18.1123 0.00295
NP_440209.1_1 Reverse -368 -376 8.47588 0.0457
NP_440178.1_7 Reverse -367 -386 -21.535 0.229
NP_441716.1_1 Reverse -267 -281 10.816 0.0936
NP_441716.1_1 Forward -270 -256 5.60446 0.224
NP_442111.1_1 Forward -284 -265 12.585 0.29
NP_442111.1_4 Forward -378 -364 17.7975 0.00941
NP_442111.1_4 Reverse -367 -381 10.6193 0.0531
NP_440906.1_5 Forward -376 -369 15.8704 0.0124
NP_440906.1_5 Reverse -369 -376 15.8704 0.0124
NP_442596.1_1 Forward -376 -362 17.6002 0.244
NP_440747.1_10 Reverse -365 -377 7.31547 0.00577
NP_440747.1_10 Forward -380 -368 -2.32097 0.0331
NP_440747.1_10 Forward -273 -261 -12.0557 0.199
NP_441854.1_10 Forward -325 -306 1.17943 0.282
NP_442634.1_4 Forward -379 -365 17.0108 0.01
NP_442634.1_4 Reverse -366 -380 -2.36035 0.149
NP_442848.1_1 Forward -383 -369 -3.147 0.263
NP_442848.1_1 Reverse -362 -376 -3.44199 0.267
NP_442848.1_5 Forward -271 -253 -1.94747 0.276
NP_443018.1_3 Forward -376 -369 14.8871 0.0123
NP_443018.1_3 Reverse -369 -376 14.8871 0.0123
NP_441316.1_7 Forward -379 -364 -3.16669 0.273
NP_440376.1_1 Forward -377 -368 9.73449 0.0365
NP_440376.1_1 Reverse -368 -377 9.63616 0.0385
NP_441588.1_4 Reverse -370 -380 6.76487 0.185
NP_443065.1_6 Reverse -364 -383 2.3594 0.221
NP_442191.1_4 Reverse -369 -383 15.0653 0.0724
NP_441077.1_6 Reverse -88 -104 12.0569 0.136
NP_440066.1_1 Forward -339 -320 5.40766 0.283
NP_442485.1_3 Forward -281 -262 -4.72043 0.285
NP_441846.1_10 Reverse -314 -333 -22.8133 0.266
NP_441422.1_7 Forward -379 -362 -0.649475 0.168
NP_441950.1_7 Reverse -317 -336 10.4225 0.119
NP_441763.1_5 Forward -321 -302 -4.52377 0.24
NP_442658.1_1 Forward -379 -369 14.2375 0.0237
NP_442658.1_1 Reverse -366 -376 12.3692 0.0569
NP_442782.1_2 Forward -377 -363 1.57289 0.281
NP_441487.1_9 Forward -339 -320 -2.55715 0.293
NP_442321.1_4 Reverse -62 -81 -6.78538 0.284
NP_441958.1_5 Forward -378 -368 12.0747 0.00222
NP_441958.1_5 Reverse -367 -377 11.3864 0.0074
NP_441127.1_1 Reverse -323 -337 11.8976 0.215
NP_441127.1_1 Reverse -314 -328 9.73436 0.268
NP_439905.1_2 Forward -243 -229 10.4227 0.214
NP_439990.1_5 Forward -382 -369 9.45906 0.142
NP_439990.1_5 Reverse -363 -376 8.86907 0.158
NP_439990.1_6 Forward -231 -212 8.45592 0.233
NP_442690.1_1 Forward -100 -81 -5.21209 0.157
NP_442690.1_1 Forward -188 -169 -16.6185 0.29
NP_442911.1_2 Reverse -358 -377 -8.55534 0.237
NP_440153.1_5 Forward -376 -362 7.47274 0.161
NP_443055.1_6 Forward -251 -233 -1.84987 0.284
NP_443055.1_6 Forward -284 -266 -2.53818 0.296
NP_440993.1_2 Reverse -363 -379 2.32015 0.268
NP_440993.1_2 Forward -268 -252 2.22182 0.269
NP_440993.1_4 Reverse -261 -278 3.48043 0.289
NP_441429.1_4 Reverse -174 -193 9.63507 0.229
NP_441099.1_5 Forward -333 -314 8.45592 0.0373
NP_441099.1_5 Forward -387 -368 -3.63879 0.137
NP_441099.1_5 Reverse -358 -377 -5.21209 0.15
NP_440809.1_5 Reverse -251 -270 14.3558 0.0472
NP_441294.1_7 Forward -381 -367 9.53859 0.241
NP_441646.1_1 Reverse -361 -380 3.6377 0.206
NP_441646.1_1 Reverse -227 -246 -1.96717 0.298
NP_442438.1_10 Reverse -321 -335 0.294584 0.232
NP_442885.1_4 Reverse -303 -316 15.1488 0.266
NP_441000.1_6 Reverse -367 -381 -2.65535 0.22
NP_440484.1_3 Forward -379 -365 11.6026 0.242
NP_440147.1_4 Forward -379 -366 7.98409 0.0579
NP_440147.1_4 Reverse -366 -379 7.88576 0.0598
NP_441175.1_7 Reverse -368 -387 5.30933 0.283
NP_441550.1_8 Forward -379 -369 15.8108 0.0132
NP_441550.1_8 Reverse -366 -376 12.5659 0.0336
NP_441916.1_7 Reverse -368 -378 10.6981 0.0261
NP_441916.1_7 Forward -377 -367 9.61647 0.0333
NP_441916.1_7 Reverse -329 -339 2.24165 0.261
NP_441041.1_4 Reverse -368 -387 0.58944 0.085
NP_441041.1_4 Forward -377 -358 -3.73712 0.125
NP_441041.1_4 Reverse -314 -333 -10.227 0.228
NP_441041.1_7 Reverse -365 -377 11.4991 0.0783
NP_441041.1_7 Forward -380 -368 7.61196 0.162
NP_442996.1_1 Reverse -91 -110 5.20389 0.246
NP_441725.1_4 Reverse -363 -377 13.7653 0.0693
NP_441725.1_4 Forward -382 -368 11.602 0.0797
NP_441725.1_5 Reverse -369 -379 1.94665 0.115
NP_441725.1_5 Forward -376 -366 0.668351 0.156
NP_439966.1_7 Forward -379 -369 14.3359 0.0203
NP_439966.1_7 Reverse -366 -376 11.7793 0.0573
NP_439966.1_7 Forward -325 -315 4.01116 0.295
NP_439966.1_9 Reverse -2 -11 4.42462 0.253
NP_442941.1_3 Reverse -369 -379 19.2529 0.00262
NP_442941.1_3 Forward -376 -366 9.81313 0.0263
NP_440289.1_2 Forward -380 -367 -3.32397 0.267
NP_440983.1_5 Reverse -170 -189 -8.26035 0.294
NP_440260.1_8 Reverse -252 -270 -4.79907 0.273
NP_441514.1_6 Reverse -69 -76 12.8221 0.252
NP_441678.1_9 Forward -168 -149 -5.60541 0.297
NP_442281.1_1 Forward -382 -368 13.2736 0.0288
NP_442281.1_1 Reverse -363 -377 8.84875 0.075
NP_441334.1_7 Reverse -366 -385 -10.0303 0.12
NP_442575.1_8 Reverse -326 -345 -1.27885 0.232
NP_442256.1_2 Reverse -366 -384 -7.45401 0.214
NP_440498.1_1 Reverse -359 -377 6.70565 0.0845
NP_441644.1_6 Forward -377 -367 16.5975 0.00319
NP_441644.1_6 Forward -323 -313 11.091 0.0552
NP_441644.1_6 Reverse -368 -378 9.71433 0.0705
NP_441644.1_6 Forward -270 -260 3.12618 0.297
NP_440929.1_8 Forward -377 -368 17.4043 0.00289
NP_440929.1_8 Reverse -368 -377 17.4043 0.00289
NP_440566.1_6 Reverse -366 -385 12.9791 0.18
NP_442933.1_10 Forward -377 -368 9.04618 0.063
NP_442933.1_10 Reverse -368 -377 8.94785 0.0643
NP_441751.2_8 Reverse -369 -383 2.94952 0.0757
NP_441751.2_8 Forward -376 -362 -3.24533 0.137
NP_442554.1_8 Reverse -369 -379 17.2863 0.00543
NP_442554.1_8 Forward -376 -366 13.943 0.0145
NP_441762.1_7 Reverse -166 -178 -7.63084 0.296
NP_442142.1_4 Reverse -365 -378 6.50855 0.163
NP_442142.1_4 Reverse -219 -232 3.65697 0.248
NP_442142.1_4 Forward -380 -367 3.06699 0.268
NP_442292.1_1 Reverse -369 -378 17.5026 0.00435
NP_442292.1_1 Forward -376 -367 16.9127 0.00594
NP_442381.1_8 Forward -380 -361 -13.2752 0.268
NP_443009.1_5 Forward -378 -367 14.7094 0.02
NP_443009.1_5 Forward -81 -70 7.53132 0.126
NP_443009.1_5 Reverse -367 -378 6.05637 0.177
NP_442301.1_2 Forward -333 -314 11.6017 0.159
NP_442301.1_2 Forward -339 -320 6.29183 0.263
NP_441715.1_4 Reverse -369 -379 16.7946 0.0106
NP_441715.1_4 Forward -376 -366 7.64985 0.108
NP_440158.1_8 Reverse -300 -319 12.5858 0.222
NP_441198.1_8 Reverse -69 -79 10.4392 0.271
NP_441468.1_1 Forward -376 -369 15.8704 0.0124
NP_441468.1_1 Reverse -369 -376 15.8704 0.0124
NP_439939.1_6 Reverse -261 -280 12.0942 0.28
NP_441015.1_10 Reverse -309 -328 -2.85214 0.183
NP_441015.1_10 Reverse -324 -343 -7.57203 0.269
NP_441673.1_1 Forward -377 -368 11.1111 0.0121
NP_441673.1_1 Reverse -368 -377 11.0128 0.018
NP_442490.1_9 Reverse -261 -280 -2.16383 0.206
NP_441764.1_8 Reverse -141 -151 11.1193 0.287
NP_442868.1_6 Forward -379 -369 10.4031 0.038
NP_442868.1_6 Reverse -366 -376 1.455 0.205
NP_442719.1_2 Forward -205 -187 4.44329 0.153
NP_441056.1_1 Reverse -368 -387 -1.18052 0.176
NP_441056.1_1 Forward -377 -358 -6.78538 0.271
NP_441612.1_2 Forward -270 -260 10.9696 0.21
NP_442361.1_3 Forward -383 -370 9.55739 0.276
NP_442808.1_1 Forward -324 -314 7.35439 0.0814
NP_440871.1_2 Reverse -225 -244 12.0942 0.289
NP_440145.1_3 Reverse -358 -377 2.3594 0.12
NP_440145.1_3 Forward -387 -368 -1.37718 0.151
NP_440145.1_4 Forward -322 -312 15.3192 0.219
NP_442050.1_5 Forward -379 -369 15.9091 0.0091
NP_442050.1_5 Reverse -366 -376 15.3192 0.0127
NP_442342.1_9 Forward -325 -309 2.32015 0.29
NP_440558.1_2 Reverse -359 -378 7.7676 0.117
NP_440558.1_2 Forward -279 -260 -5.60541 0.262
NP_441518.1_3 Forward -387 -368 -5.11376 0.123
NP_441878.1_6 Forward -378 -368 0.766681 0.134
NP_441878.1_6 Reverse -367 -377 0.668351 0.139
NP_441878.1_6 Reverse -260 -270 -7.68978 0.255
NP_441036.1_8 Reverse -367 -377 14.7297 0.0187
NP_441036.1_8 Forward -378 -368 6.07655 0.242
NP_441036.1_8 Forward -339 -329 5.68323 0.265
NP_441036.1_8 Reverse -166 -176 5.48657 0.279
NP_441557.1_5 Reverse -368 -377 17.4043 0.0023
NP_441557.1_5 Forward -377 -368 10.8161 0.00464
NP_441557.1_8 Forward -260 -250 10.6976 0.28
NP_441445.1_1 Reverse -252 -271 7.07928 0.138
NP_441590.1_4 Forward -335 -316 2.16195 0.297
NP_442066.2_9 Forward -180 -167 8.77074 0.185
NP_440101.1_3 Reverse -265 -284 3.83436 0.224
NP_440101.1_3 Reverse -363 -382 0.687771 0.297
NP_442183.1_1 Forward -377 -363 9.93102 0.0903
NP_442166.1_7 Reverse -369 -383 19.0758 0.0726
NP_442347.1_2 Reverse -369 -378 3.34298 0.284
NP_441037.1_4 Forward -379 -369 7.22024 0.237
NP_441037.1_4 Reverse -366 -376 6.14821 0.278
NP_442317.1_6 Forward -316 -297 7.66927 0.226
NP_441633.1_3 Reverse -165 -178 0.510939 0.122
NP_441633.1_3 Reverse -366 -379 -2.04567 0.171
NP_440136.1_2 Forward -376 -369 15.9687 0.0123
NP_440136.1_2 Reverse -369 -376 15.9687 0.0123
NP_442998.1_5 Forward -201 -191 8.73149 0.261
NP_442998.1_10 Reverse -370 -377 15.5754 0.0102
NP_442998.1_10 Forward -375 -368 5.84064 0.235
NP_440899.1_5 Forward -333 -314 3.34271 0.263
NP_440299.1_1 Reverse -364 -377 9.65513 0.0681
NP_441799.1_1 Reverse -238 -252 7.47213 0.141
NP_441799.1_1 Forward -381 -367 4.8172 0.236
NP_441799.1_1 Reverse -163 -177 3.73557 0.284
NP_441007.1_10 Forward -382 -369 4.54251 0.182
NP_441007.1_10 Reverse -363 -376 0.117615 0.25
NP_442333.2_1 Reverse -2 -21 6.78429 0.101
NP_440256.1_1 Reverse -365 -384 8.25926 0.0239
NP_440256.1_1 Forward -380 -361 0.884433 0.0791
NP_442961.1_4 Reverse -303 -322 5.70265 0.23
NP_441559.1_8 Reverse -363 -377 1.17956 0.156
NP_441559.1_8 Forward -372 -358 -6.19526 0.275
NP_441559.1_8 Forward -382 -368 -7.47356 0.294
NP_440915.1_6 Forward -381 -367 11.0127 0.0288
NP_440915.1_6 Reverse -364 -378 10.226 0.0333
NP_440915.1_6 Forward -255 -241 1.76955 0.131
NP_440915.1_6 Reverse -310 -324 -1.5737 0.239
NP_442452.1_3 Reverse -303 -322 11.0125 0.163
NP_441464.1_1 Reverse -364 -383 7.57094 0.261
NP_441464.1_8 Forward -270 -256 3.93283 0.283
NP_440026.1_8 Reverse -171 -189 12.6055 0.223
NP_440306.1_5 Reverse -174 -193 -0.295539 0.265
NP_441939.1_3 Reverse -369 -388 19.174 0.0131
NP_442993.1_1 Forward -251 -235 -5.84132 0.146
NP_440677.1_1 Reverse -158 -177 17.404 0.0932
NP_440677.1_6 Reverse -245 -264 8.55425 0.276
NP_442386.1_9 Forward -378 -369 6.39082 0.219
NP_442386.1_9 Reverse -357 -366 5.60418 0.245
NP_442386.1_9 Reverse -367 -376 5.11253 0.266
NP_442054.1_3 Forward -319 -300 -0.197208 0.243
NP_441750.1_1 Reverse -308 -327 3.6377 0.128
NP_441750.1_4 Reverse -364 -383 0.58944 0.297
NP_441340.1_5 Forward -376 -369 15.6737 0.0124
NP_441340.1_5 Reverse -369 -376 15.6737 0.0124
NP_442327.1_3 Forward -110 -91 14.7531 0.158
NP_440768.1_1 Forward -262 -248 8.35772 0.239
NP_440168.1_4 Forward -280 -261 0.196116 0.22
NP_440168.1_9 Reverse -259 -278 -4.6221 0.296
NP_441506.1_1 Reverse -179 -198 12.2875 0.292
NP_442240.1_2 Reverse -369 -388 -20.4534 0.295
NP_440586.1_1 Reverse -251 -270 -1.47551 0.237
NP_440586.1_8 Forward -376 -369 13.2151 0.026
NP_440586.1_8 Reverse -369 -376 13.2151 0.026
NP_442251.1_6 Forward -376 -369 15.2804 0.0124
NP_442251.1_6 Reverse -369 -376 15.2804 0.0124
NP_440192.1_4 Reverse -297 -316 14.6367 0.169
NP_442959.1_5 Reverse -60 -79 9.3409 0.224
NP_441262.1_3 Reverse -368 -375 14.8871 0.0223
NP_441262.1_3 Forward -377 -370 14.7888 0.0223
NP_440027.1_3 Reverse -358 -376 3.8533 0.263
NP_443051.1_1 Forward -378 -369 19.5676 0.00335
NP_443051.1_1 Reverse -367 -376 17.5026 0.0066
NP_440926.1_10 Forward -156 -137 13.7658 0.259
NP_440439.1_1 Reverse -365 -378 7.98409 0.0577
NP_440439.1_1 Forward -380 -367 2.47756 0.133
NP_439943.1_7 Reverse -363 -382 2.75272 0.292
NP_440372.1_2 Forward -376 -369 16.3621 0.0124
NP_440372.1_2 Reverse -369 -376 16.3621 0.0124
NP_440316.1_10 Reverse -313 -323 5.97822 0.275
NP_441803.1_2 Forward -275 -256 7.27595 0.141
NP_439977.1_5 Forward -383 -364 6.19431 0.135
NP_439977.1_5 Reverse -362 -381 1.67108 0.19
NP_441572.1_7 Forward -383 -364 -5.60541 0.265
NP_440267.1_2 Reverse -363 -377 12.192 0.125
NP_442384.1_10 Forward -377 -364 9.16406 0.0571
NP_442384.1_10 Reverse -261 -274 3.85419 0.176
NP_442384.1_10 Reverse -368 -381 2.57589 0.22
NP_441018.1_7 Forward -381 -362 6.09597 0.299
NP_442262.1_10 Forward -376 -369 14.1988 0.0123
NP_442262.1_10 Reverse -369 -376 14.1988 0.0123
NP_441689.1_5 Forward -379 -369 8.3377 0.132
NP_440163.1_10 Forward -341 -331 9.61647 0.229
NP_440163.1_10 Reverse -264 -274 8.73149 0.262
NP_440344.1_10 Reverse -64 -81 -13.5308 0.287
NP_440282.1_10 Forward -280 -261 -10.1286 0.294
NP_441965.1_10 Reverse -258 -274 4.58176 0.237
NP_442556.1_10 Forward -203 -184 9.02179 0.28
NP_440297.1_9 Forward -376 -366 0.0783647 0.282
NP_440297.1_9 Reverse -369 -379 -0.216628 0.282
NP_441896.1_3 Forward -386 -367 -2.95047 0.294
NP_440999.1_9 Reverse -364 -378 6.3911 0.0979
NP_440999.1_9 Forward -381 -367 -1.08205 0.226
NP_440888.1_2 Reverse -368 -382 7.27547 0.202
NP_440888.1_2 Reverse -242 -256 6.68548 0.223
NP_440792.1_5 Forward -376 -357 6.19431 0.237
NP_440600.1_4 Reverse -360 -378 2.0841 0.125
NP_440491.1_1 Reverse -219 -238 9.15853 0.219
NP_440491.1_1 Forward -167 -148 7.50176 0.265
NP_440052.1_4 Reverse -59 -78 9.83255 0.239
NP_442277.1_7 Reverse -84 -100 -1.04361 0.264
NP_442033.1_10 Forward -379 -360 -2.45882 0.153
NP_441543.1_2 Reverse -369 -378 15.9293 0.00518
NP_441543.1_2 Forward -269 -260 8.55452 0.0988
NP_441543.1_2 Forward -376 -367 6.39124 0.153
NP_440380.1_1 Reverse -243 -262 2.65439 0.128
NP_441304.1_10 Reverse -68 -77 15.1427 0.164
NP_440982.1_1 Forward -323 -304 17.4032 0.0714
NP_441469.1_8 Forward -221 -212 9.63616 0.227
NP_441469.1_8 Reverse -367 -376 6.98123 0.227
NP_441469.1_8 Forward -378 -369 6.5879 0.227
NP_442315.1_2 Forward -85 -73 9.87208 0.291
NP_442578.1_7 Forward -376 -369 14.5921 0.026
NP_442578.1_7 Reverse -369 -376 14.5921 0.026
NP_441462.1_2 Forward -377 -367 11.3864 0.00425
NP_441462.1_2 Reverse -368 -378 10.4031 0.011
NP_443062.1_1 Reverse -368 -386 16.639 0.0304
NP_443062.1_1 Forward -377 -359 10.0085 0.122
NP_442204.1_1 Forward -381 -370 11.7601 0.0565
NP_442204.1_1 Reverse -364 -375 11.2684 0.0565
NP_442204.1_1 Reverse -310 -321 10.7767 0.0678
NP_442204.1_1 Forward -235 -224 -0.0396598 0.285
NP_440544.1_5 Forward -148 -141 13.8024 0.28
NP_440516.1_2 Reverse -362 -380 3.85406 0.143
NP_440516.1_8 Forward -377 -368 9.53783 0.0136
NP_440516.1_8 Reverse -368 -377 7.07956 0.0867
NP_440516.1_8 Reverse -314 -323 -0.590259 0.283
NP_442428.1_5 Forward -376 -369 15.8704 0.0124
NP_442428.1_5 Reverse -369 -376 15.8704 0.0124
NP_440783.1_5 Forward -377 -358 -4.03212 0.276
NP_441443.1_10 Forward -189 -171 3.16499 0.275
NP_441790.1_3 Reverse -369 -388 2.26107 0.18
NP_441790.1_3 Reverse -315 -334 -4.32711 0.291
NP_442823.1_8 Reverse -37 -56 11.4058 0.286
NP_440673.1_3 Reverse -370 -377 12.4288 0.0426
NP_440673.1_3 Forward -375 -368 5.34899 0.298
NP_441052.1_2 Reverse -261 -271 11.2881 0.0285
NP_441052.1_2 Forward -270 -260 4.3066 0.161
NP_441052.1_2 Forward -276 -266 2.33998 0.209
NP_441052.1_2 Reverse -368 -378 1.84832 0.225
NP_441052.1_2 Forward -377 -367 0.668351 0.256
NP_442219.1_9 Reverse -369 -378 8.25953 0.0681
NP_440436.1_4 Reverse -369 -378 9.24241 0.0871
NP_441884.1_8 Forward -378 -359 -7.96535 0.255
NP_440648.1_1 Reverse -222 -241 5.60432 0.213
NP_439982.1_1 Forward -383 -364 18.5839 0.127
NP_441719.1_4 Forward -376 -369 16.3621 0.0124
NP_441719.1_4 Reverse -369 -376 16.3621 0.0124
NP_441004.1_1 Reverse -308 -327 -17.5035 0.292
NP_441004.1_1 Reverse -249 -268 -17.7001 0.294
NP_442366.1_3 Reverse -253 -271 -3.71743 0.255
NP_440129.1_10 Forward -258 -244 2.75286 0.247
NP_441115.1_4 Reverse -367 -385 7.19654 0.295
NP_442206.1_10 Forward -377 -362 19.8428 0.0799
NP_440328.1_4 Forward -383 -364 1.67108 0.222
NP_440328.1_4 Reverse -31 -50 -0.983855 0.295
NP_442430.1_1 Forward -247 -228 26.8438 0.00449
NP_442430.1_2 Forward -280 -261 31.8587 0.000106
NP_442430.1_3 Forward -190 -171 29.5971 0.0005
NP_442430.1_4 Forward -325 -306 27.9255 0.000575
NP_442430.1_6 Forward -170 -151 29.0071 0.000734
NP_442430.1_7 Forward -220 -201 22.602 0.0483
NP_442430.1_8 Forward -346 -327 20.2556 0.214
NP_442430.1_9 Forward -367 -348 31.5637 0.000124
NP_442430.1_10 Forward -387 -368 25.8596 0.000544
NP_441851.1_10 Forward -378 -368 8.33817 0.118
NP_441851.1_10 Reverse -367 -377 6.96153 0.151
NP_440611.1_1 Reverse -34 -53 15.4374 0.195
NP_441396.1_5 Reverse -315 -324 8.75118 0.21
NP_440593.1_3 Forward -268 -249 10.2259 0.107
NP_440463.1_8 Forward -333 -314 6.43495 0.269
NP_440165.1_5 Forward -378 -359 4.12936 0.0987
NP_442689.1_8 Forward -184 -167 -5.46769 0.272
NP_442689.1_8 Forward -96 -79 -8.22096 0.294
NP_441409.1_8 Reverse -130 -149 6.92008 0.298
NP_440432.1_9 Reverse -369 -384 5.09311 0.0595
NP_442843.1_1 Forward -376 -357 -12.0953 0.298
NP_440588.1_2 Forward -288 -269 -2.95047 0.174
NP_441570.1_1 Forward -377 -359 0.510803 0.0391
NP_441570.1_1 Reverse -368 -386 -11.2889 0.191
NP_441078.1_4 Forward -377 -368 9.93116 0.0203
NP_441078.1_4 Reverse -368 -377 9.83282 0.0226
NP_441078.1_4 Reverse -261 -270 5.99792 0.0932
NP_441078.1_4 Forward -270 -261 -1.77023 0.266
NP_442729.1_5 Reverse -266 -276 7.94484 0.254
NP_442729.1_8 Forward -180 -167 7.19745 0.161
NP_441663.1_8 Forward -237 -218 1.37609 0.212
NP_442443.1_1 Reverse -294 -313 -3.83545 0.267
NP_440526.1_3 Reverse -369 -380 1.92649 0.267
NP_440526.1_3 Forward -269 -258 1.3365 0.267
NP_441432.1_8 Forward -378 -369 16.8143 0.00595
NP_441432.1_8 Reverse -367 -376 6.98123 0.112
NP_441432.1_8 Reverse -260 -269 2.94966 0.28
NP_442320.1_8 Forward -383 -369 -1.67204 0.0821
NP_441732.1_2 Reverse -364 -380 -16.4611 0.167
NP_441030.1_4 Reverse -73 -92 6.63627 0.277
NP_440629.1_4 Forward -322 -303 7.7676 0.287
NP_440760.1_1 Reverse -368 -387 -2.95047 0.0334
NP_440760.1_1 Forward -377 -358 -20.5517 0.223
NP_440760.1_7 Forward -88 -69 2.26028 0.286
NP_442797.1_1 Forward -333 -314 -4.13045 0.286
NP_440913.1_1 Reverse -366 -384 10.3439 0.175
NP_442489.1_7 Forward -377 -368 10.4228 0.0151
NP_442489.1_7 Reverse -368 -377 10.3245 0.0193
NP_442489.1_7 Forward -176 -167 4.91628 0.0892
NP_442489.1_7 Reverse -261 -270 -1.77023 0.247
NP_440559.1_1 Reverse -369 -378 8.65285 0.0586
NP_440559.1_1 Forward -376 -367 7.76787 0.0918
NP_441659.2_8 Forward -377 -367 17.5813 0.0024
NP_441659.2_8 Reverse -368 -378 11.3864 0.0184
NP_442913.1_10 Reverse -359 -378 6.68596 0.058
NP_442913.1_10 Forward -386 -367 -2.45882 0.186
NP_442913.1_10 Reverse -31 -50 -3.63879 0.214
NP_442913.1_10 Reverse -252 -271 -4.81876 0.248
NP_440335.1_9 Reverse -130 -148 9.0656 0.298
NP_442776.1_1 Forward -388 -369 4.12936 0.278
NP_442346.1_5 Forward -378 -368 15.0247 0.00889
NP_442346.1_5 Reverse -260 -270 7.74818 0.159
NP_442346.1_5 Reverse -367 -377 6.8632 0.188
NP_440545.1_3 Forward -381 -364 6.43035 0.0557
NP_440545.1_3 Reverse -364 -381 4.16874 0.0738
NP_440486.1_6 Forward -390 -371 6.4893 0.283
NP_440459.1_2 Forward -386 -369 7.31533 0.296
NP_441653.1_2 Forward -388 -369 9.61754 0.146
NP_440010.1_4 Forward -280 -261 2.55527 0.222
NP_442027.1_4 Forward -110 -91 16.3764 0.145
NP_441888.1_7 Reverse -363 -377 11.5043 0.0846
NP_441593.1_8 Forward -97 -78 14.1591 0.232
NP_441833.1_4 Forward -376 -369 15.9687 0.0124
NP_441833.1_4 Reverse -369 -376 15.9687 0.0124
NP_442162.1_9 Forward -376 -369 16.2637 0.0124
NP_442162.1_9 Reverse -369 -376 16.2637 0.0124
NP_440671.1_4 Reverse -362 -376 6.88276 0.233
NP_442199.1_5 Reverse -29 -48 -2.0655 0.185
NP_442199.1_5 Forward -385 -366 -2.26216 0.185
NP_442140.1_3 Forward -230 -220 12.0747 0.0664
NP_442140.1_3 Forward -376 -366 5.68323 0.198
NP_442140.1_3 Reverse -369 -379 4.69992 0.238
NP_440951.1_4 Forward -212 -193 17.7974 0.236
NP_440875.1_9 Reverse -370 -380 15.867 0.0233
NP_440875.1_9 Forward -375 -365 14.9909 0.034
NP_441813.1_5 Forward -379 -369 18.1713 0.00743
NP_441813.1_5 Reverse -366 -376 17.3846 0.00979
NP_440594.1_5 Forward -78 -59 6.29183 0.293
NP_440152.1_3 Forward -26 -7 11.5042 0.279
NP_442089.1_9 Reverse -295 -314 13.8641 0.26
NP_440590.1_4 Reverse -369 -382 12.704 0.013
NP_440590.1_4 Forward -48 -35 -4.7006 0.265
NP_440567.1_1 Reverse -369 -383 7.66941 0.067
NP_442497.1_10 Reverse -369 -378 17.601 0.00813
NP_442497.1_10 Forward -376 -367 15.7327 0.0087
NP_440821.1_4 Forward -379 -369 2.24165 0.131
NP_440821.1_4 Reverse -366 -376 1.65166 0.132
NP_441239.1_9 Reverse -366 -378 13.0187 0.0389
NP_441239.1_9 Forward -379 -367 8.88877 0.12
NP_441239.1_9 Forward -325 -313 5.34885 0.223
NP_442568.1_8 Reverse -132 -146 7.76774 0.296
NP_441892.1_1 Forward -386 -369 -5.27103 0.276
NP_442044.1_1 Forward -284 -265 -6.58872 0.208
NP_442216.1_4 Forward -78 -70 8.1805 0.255
NP_440876.1_5 Reverse -370 -389 9.0459 0.277
NP_440354.1_7 Forward -182 -164 6.50899 0.282
NP_442138.1_10 Reverse -368 -387 -8.06369 0.296
NP_440546.1_4 Forward -377 -367 6.65249 0.288
NP_440546.1_6 Reverse -316 -335 9.73422 0.247
NP_442131.1_1 Reverse -224 -243 -7.17871 0.123
NP_440462.1_6 Forward -379 -369 18.7612 0.00454
NP_440462.1_6 Reverse -366 -376 10.1081 0.041
NP_442611.1_1 Reverse -309 -328 6.78429 0.155
NP_442611.1_1 Forward -377 -358 0.196116 0.261
NP_440868.1_4 Forward -381 -369 1.02229 0.193
NP_440868.1_4 Reverse -364 -376 -0.0593532 0.242
NP_441848.1_4 Forward -318 -302 9.17403 0.288
NP_441848.1_9 Forward -324 -313 20.7076 0.109
NP_440843.1_8 Reverse -296 -315 12.3892 0.297
NP_442923.1_6 Reverse -90 -104 19.683 0.0914
NP_442039.1_4 Forward -376 -369 15.1821 0.0124
NP_442039.1_4 Reverse -369 -376 15.1821 0.0124
NP_441811.1_8 Reverse -34 -48 7.76774 0.241
NP_442679.1_3 Reverse -137 -155 2.37909 0.239
NP_440825.1_6 Forward -107 -88 7.66927 0.285
NP_442837.1_3 Forward -376 -369 15.7721 0.0124
NP_442837.1_3 Reverse -369 -376 15.7721 0.0124
NP_442053.1_1 Forward -377 -368 9.34117 0.0666
NP_442053.1_1 Reverse -368 -377 8.84951 0.072
NP_440505.1_3 Forward -379 -369 17.188 0.00332
NP_440505.1_3 Reverse -366 -376 7.35486 0.157
NP_442532.1_7 Forward -377 -363 4.71948 0.171
NP_442532.1_7 Reverse -314 -328 3.44117 0.197
NP_440548.1_10 Forward -338 -319 3.83436 0.275
NP_441408.2_7 Reverse -168 -187 -3.93378 0.279
NP_440914.1_1 Forward -377 -367 14.0802 0.0188
NP_440914.1_1 Reverse -368 -378 7.24882 0.242
NP_441011.1_8 Reverse -369 -378 16.6177 0.00602
NP_441011.1_8 Forward -376 -367 8.94785 0.141
NP_441011.1_8 Reverse -315 -324 5.50626 0.256
NP_442533.1_6 Forward -377 -368 7.86621 0.0862
NP_442533.1_6 Reverse -368 -377 7.37455 0.0898
NP_442533.1_6 Forward -270 -261 5.80125 0.128
NP_442533.1_6 Forward -323 -314 2.16301 0.27
NP_441482.1_7 Reverse -362 -376 14.1593 0.013
NP_441482.1_7 Forward -383 -369 6.98109 0.0257
NP_439944.1_9 Reverse -369 -379 9.12481 0.1
NP_439944.1_9 Forward -376 -366 6.8632 0.165
NP_442202.1_4 Forward -337 -323 13.2231 0.259
NP_442202.1_4 Forward -178 -164 12.8353 0.281
NP_440116.1_8 Forward -376 -357 0.786102 0.0948
NP_441527.1_4 Reverse -133 -152 -1.19407 0.146
NP_441527.1_4 Reverse -130 -149 -6.54162 0.221
NP_440115.1_6 Forward -380 -370 4.89658 0.28
NP_440115.1_6 Reverse -365 -375 4.79825 0.282
NP_440007.1_7 Forward -245 -226 6.4893 0.278
NP_440007.1_9 Forward -381 -367 20.3541 0.0702
NP_440007.1_9 Reverse -364 -378 0.982901 0.29
NP_440608.1_1 Reverse -76 -95 7.37386 0.223
NP_441602.1_4 Forward -388 -369 12.5858 0.278
NP_441972.1_5 Forward -262 -243 1.0811 0.141
NP_441106.1_1 Forward -378 -369 18.486 0.0028
NP_441106.1_1 Reverse -367 -376 9.34117 0.0333
NP_440429.1_2 Forward -269 -250 7.57094 0.284
NP_441825.1_4 Reverse -299 -309 13.8447 0.249
NP_439903.1_6 Reverse -365 -384 2.6536 0.222
NP_439903.1_6 Forward -380 -361 -0.00131823 0.275
NP_442306.1_10 Forward -336 -317 -21.6334 0.282
NP_441286.1_1 Reverse -367 -379 -4.77924 0.175
NP_440670.1_8 Forward -377 -368 16.3227 0.00291
NP_440670.1_8 Reverse -368 -377 15.1427 0.00768
NP_440886.1_7 Forward -324 -314 15.6142 0.0243
NP_440828.1_4 Forward -271 -252 -6.29447 0.269
NP_442072.1_9 Reverse -367 -385 -13.2555 0.106
NP_440223.1_7 Reverse -317 -331 12.586 0.244
NP_440907.2_8 Reverse -369 -379 9.616 0.103
NP_440907.2_8 Forward -376 -366 7.74772 0.117
NP_441021.1_1 Reverse -369 -388 1.96607 0.083
NP_440666.1_5 Reverse -326 -345 13.9625 0.297
NP_441463.1_6 Reverse -265 -279 6.12603 0.283
NP_441626.1_2 Forward -376 -369 15.7721 0.0124
NP_441626.1_2 Reverse -369 -376 15.7721 0.0124
NP_442794.1_1 Reverse -364 -376 9.28209 0.0795
NP_441962.1_4 Reverse -321 -340 -3.73712 0.151
NP_441962.1_4 Forward -382 -363 -9.83364 0.222
NP_441962.1_4 Reverse -256 -275 -14.7502 0.293
NP_440387.1_1 Forward -377 -361 5.56507 0.0315
NP_440387.1_1 Reverse -368 -384 -2.00642 0.145
NP_440387.1_1 Forward -338 -322 -5.05468 0.212
NP_441488.1_8 Forward -382 -368 15.8302 0.146
NP_441193.1_1 Forward -312 -293 10.7167 0.263
NP_441993.1_1 Reverse -368 -387 3.70092 0.23
NP_440143.1_1 Reverse -252 -271 14.6508 0.246
NP_442805.1_4 Reverse -161 -179 17.5221 0.285
NP_440467.1_3 Forward -388 -369 10.8656 0.296
NP_442323.1_7 Reverse -363 -382 8.55343 0.163
NP_440287.1_6 Forward -48 -29 2.94938 0.226
NP_440457.1_1 Forward -381 -369 6.43049 0.121
NP_440457.1_1 Reverse -364 -376 4.8572 0.151
NP_440942.1_9 Forward -319 -300 7.86512 0.223
NP_441984.1_1 Reverse -34 -52 6.01734 0.288
NP_441332.1_6 Forward -324 -314 15.3256 0.121
NP_440554.1_4 Forward -376 -366 19.2529 0.0131
NP_440554.1_4 Reverse -369 -379 17.9746 0.0131
NP_440554.1_4 Forward -322 -312 2.33998 0.267
NP_441885.1_5 Forward -377 -367 2.24165 0.0822
NP_441885.1_5 Reverse -368 -378 1.55333 0.109
NP_441885.1_5 Reverse -261 -271 0.0783647 0.183
NP_442341.1_7 Forward -271 -257 5.70279 0.148
NP_442341.1_7 Forward -177 -163 5.40779 0.157
NP_442341.1_9 Reverse -366 -380 7.57046 0.196
NP_441756.1_5 Reverse -364 -383 4.916 0.189
NP_441756.1_5 Forward -255 -236 0.786102 0.224
NP_442395.2_4 Forward -324 -305 1.6703 0.235
NP_443000.1_7 Forward -379 -369 20.3345 0.00223
NP_443000.1_7 Reverse -366 -376 11.2881 0.0345
NP_440275.1_3 Reverse -366 -376 16.2046 0.0155
NP_440275.1_3 Forward -379 -369 16.1063 0.0155
NP_443060.1_1 Forward -370 -351 8.4551 0.276
NP_442495.1_4 Reverse -313 -323 11.4848 0.271
NP_441105.1_3 Forward -388 -369 2.75272 0.0984
NP_440216.1_1 Reverse -368 -382 -1.8687 0.0412
NP_440216.1_1 Forward -377 -363 -2.45868 0.0513
NP_440216.1_9 Reverse -184 -193 5.89959 0.289
NP_440172.1_1 Forward -377 -367 10.9931 0.0445
NP_440172.1_1 Reverse -368 -378 7.74818 0.0738
NP_442015.1_3 Forward -325 -306 14.9449 0.185
NP_442015.1_10 Reverse -364 -377 15.7522 0.02
NP_441226.1_7 Forward -376 -369 14.4934 0.0123
NP_441226.1_7 Reverse -369 -376 14.4934 0.0123
NP_441111.1_7 Reverse -369 -377 18.7023 0.00294
NP_441111.1_7 Forward -376 -368 8.96754 0.0463
NP_441766.1_2 Reverse -368 -377 16.2243 0.0047
NP_441766.1_2 Forward -377 -368 9.14451 0.0337
NP_442417.1_5 Forward -377 -363 14.9459 0.0611
NP_440416.1_1 Forward -377 -358 -10.522 0.272
NP_440416.1_1 Reverse -343 -362 -12.4886 0.272
NP_440416.1_9 Reverse -373 -392 -13.4719 0.166
NP_440416.1_9 Forward -384 -365 -14.3569 0.176
NP_440416.1_9 Reverse -361 -380 -20.945 0.289
NP_443052.1_9 Forward -333 -314 -2.16383 0.233
NP_443052.1_9 Forward -268 -249 -4.42544 0.258
NP_443052.1_9 Forward -336 -317 -5.50708 0.271
NP_442154.1_1 Reverse -300 -318 -2.3408 0.125
NP_442154.1_1 Reverse -315 -333 -13.6489 0.217
NP_440261.1_5 Forward -230 -217 -5.29059 0.19
NP_440261.1_5 Reverse -369 -382 -12.1738 0.272
NP_440261.1_5 Forward -376 -363 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGCAAAATGCCGTACAACGCACAGGCGATCGCATGGGTTCCGGACACAAACTGTACCCGTACAGCGGCCGACTCTGCCCCCATCACCTGAGCAAAAACCCCGTCCAGAGTATCTCTGCCTAGGTCATCATGGCCATAACCACTCACCCCGGCGAAGTGCTGTACCCCTACCCGATGGTGCCGAAATGCCTCTATGACTTTGTACAGATTTTCCTTGACCTTTGCGTCGATTTCCGAAAAGATTGGGACTAGGTTTTCTTCTGCTTGTTTAAGGAAGCTGGAATATTTCATTAAGACATTATTTAACTTTTGATGTTATTTGGGAATTCCCCTTAAACTATCTTTCAATCTTCGAGATCATCACCGATTCGATTTTCTTGGATGGTTGGTAAATCCCGGCG

CDS

ATGTTAAACCCATTAAACATTGAATACCTATATTTAAGCAAACTTTTTGACAATAGTTTAATCGTTTTTAACAAGCGCCAATTATTCCGTTTTTTCGTTAGGTTTTTTTTCATGACTGCTGCTCTTCCCAACGATTCCAAGCCCAAGTTGACTCCAGCTTGGACTGTGATCTTCTTTTTTACCTCCATTCATTTGGTGGCCCTGTTGGCTTTCCTGCCCCAGTTTTTCAGTTGGAAAGCAGTGGGGATGGCTTTCTTGCTCTATGTAATTACCGGCGGCATTGGCATTACTTTAGGTTTTCACCGTTGTATTTCCCACCGCAGTTTCAATGTTCCTAAATGGTTAGAGTATATTTTCGTAATCTGTGGCACCCTAGCCTGTCAGGGGGGCGTATTTGAGTGGGTCGGCTTACACCGTATGCACCACAAATTTTCTGACACCACCCCGGATCCCCACGATTCTAATAAGGGTTTTTGGTGGAGTCACATCGGCTGGATGATGTTTGAAATTCCTGCTAAAGCTGATATTCCCCGCTACACCAAGGATATCCAAGACGATAAATTTTATCAATTTTGCCAGAATAATCTAATTCTTATCCAGGTCGCCCTAGGCTTGATTTTATTTGCCTTAGGGGGCTGGCCCTTCGTTATTTGGGGCATTTTTGTCCGCCTAGTGTTTGTTTTCCACTTCACTTGGTTTGTCAACAGTGCCACCCATAAGTTCGGCTACGTTAGCCATGAATCCAATGATTATTCCCGCAATTGTTGGTGGGTAGCATTGTTAACTTTCGGTGAAGGTTGGCACAATAATCACCACGCCTATCAGTACTCTGCTCGCCATGGTTTGCAATGGTGGGAAGTGGATTTAACTTGGATGACCATTAAATTCCTATCTTTGCTGGGGTTAGCCAAGGATATTAAACTTCCTCCGGAAACTGCGATGGCCAACAAAGCCTAG

Protein

MLNPLNIEYLYLSKLFDNSLIVFNKRQLFRFFVRFFFMTAALPNDSKPKLTPAWTVIFFFTSIHLVALLAFLPQFFSWKAVGMAFLLYVITGGIGITLGFHRCISHRSFNVPKWLEYIFVICGTLACQGGVFEWVGLHRMHHKFSDTTPDPHDSNKGFWWSHIGWMMFEIPAKADIPRYTKDIQDDKFYQFCQNNLILIQVALGLILFALGGWPFVIWGIFVRLVFVFHFTWFVNSATHKFGYVSHESNDYSRNCWWVALLTFGEGWHNNHHAYQYSARHGLQWWEVDLTWMTIKFLSLLGLAKDIKLPPETAMANKA