Your browser is old and dusty. Try Google Chrome!

Details for sll0525

ORF sll0525
Accession NP_442807.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -389 -375 9.34103 0.0754
NP_440557.1_1 Forward -352 -333 0.392778 0.265
NP_440795.1_7 Forward -352 -345 14.6904 0.0123
NP_440795.1_7 Reverse -345 -352 14.6904 0.0123
NP_441418.1_6 Reverse -344 -363 -29.5982 0.23
NP_441418.1_6 Reverse -237 -256 -30.3848 0.274
NP_442291.1_5 Forward -354 -338 17.6598 0.0165
NP_442291.1_5 Reverse -343 -359 0.55019 0.162
NP_441453.1_4 Reverse -344 -352 16.539 0.00633
NP_441453.1_4 Forward -353 -345 16.539 0.00633
NP_442151.1_6 Forward -353 -339 16.9125 0.013
NP_442151.1_6 Reverse -344 -358 6.6861 0.224
NP_441818.1_1 Forward -352 -341 18.8393 0.00301
NP_441818.1_1 Reverse -345 -356 9.69459 0.232
NP_440226.1_1 Forward -353 -334 4.62101 0.184
NP_440226.1_1 Reverse -344 -363 4.22769 0.199
NP_441630.1_3 Reverse -336 -355 0.58944 0.272
NP_442173.1_1 Forward -352 -344 15.4574 0.00633
NP_442173.1_1 Reverse -345 -353 15.4574 0.00633
NP_442752.1_4 Forward -353 -346 13.8055 0.0199
NP_442752.1_4 Reverse -344 -351 13.8055 0.0199
NP_442752.1_4 Forward -110 -103 5.25066 0.256
NP_443027.1_4 Forward -355 -345 14.828 0.0437
NP_443027.1_4 Reverse -342 -352 14.0414 0.0452
NP_441812.1_3 Reverse -343 -357 17.8958 0.0479
NP_441812.1_3 Forward -354 -340 8.55439 0.251
NP_442975.1_10 Forward -357 -343 22.32 0.000414
NP_442975.1_10 Reverse -340 -354 4.71887 0.241
NP_442975.1_10 Reverse -233 -247 4.03056 0.249
NP_440784.1_7 Forward -352 -345 15.9687 0.0123
NP_440784.1_7 Reverse -345 -352 15.9687 0.0123
NP_441250.1_3 Forward -318 -299 3.34271 0.266
NP_442062.1_8 Reverse -344 -354 19.4496 0.000558
NP_442062.1_8 Forward -353 -343 17.3846 0.00193
NP_442062.1_8 Forward -110 -100 3.51995 0.267
NP_440304.1_4 Forward -355 -345 10.8948 0.051
NP_440304.1_4 Reverse -342 -352 10.8948 0.051
NP_442242.1_4 Forward -352 -345 14.3954 0.0124
NP_442242.1_4 Reverse -345 -352 14.3954 0.0124
NP_440044.1_8 Forward -352 -333 5.30933 0.103
NP_440044.1_8 Reverse -345 -364 -2.55715 0.264
NP_440370.1_10 Reverse -335 -354 9.14423 0.232
NP_442110.1_7 Forward -353 -339 9.14437 0.0755
NP_441083.1_5 Forward -353 -343 20.3345 0.00053
NP_441083.1_5 Reverse -344 -354 11.3864 0.0159
NP_442827.1_8 Reverse -336 -355 -1.27961 0.245
NP_441738.1_2 Forward -351 -344 15.28 0.0102
NP_441738.1_2 Reverse -346 -353 15.28 0.0102
NP_441558.1_5 Reverse -342 -361 12.5858 0.0675
NP_441558.1_5 Forward -355 -336 5.40766 0.251
NP_440209.1_1 Reverse -344 -352 18.1123 0.00295
NP_440209.1_1 Forward -353 -345 18.1123 0.00295
NP_442889.1_8 Forward -356 -342 20.9434 0.00339
NP_440178.1_7 Forward -354 -335 3.24438 0.0199
NP_440178.1_7 Reverse -343 -362 -12.7836 0.124
NP_442570.1_3 Forward -392 -373 -8.55534 0.288
NP_441716.1_1 Forward -167 -153 7.17775 0.178
NP_441716.1_1 Forward -353 -339 4.22782 0.256
NP_441716.1_1 Reverse -344 -358 4.22782 0.256
NP_441327.1_5 Forward -122 -113 16.2243 0.164
NP_440644.1_3 Forward -182 -163 8.94757 0.17
NP_441495.1_1 Forward -361 -342 6.98095 0.292
NP_440906.1_5 Forward -352 -345 15.8704 0.0124
NP_440906.1_5 Reverse -345 -352 15.8704 0.0124
NP_440747.1_1 Reverse -147 -165 6.50899 0.259
NP_440747.1_10 Reverse -341 -353 7.51213 0.00286
NP_440747.1_10 Forward -356 -344 -2.02597 0.0196
NP_441130.1_10 Forward -355 -341 10.816 0.11
NP_441130.1_10 Reverse -342 -356 8.65272 0.133
NP_441486.1_1 Forward -356 -342 19.9608 0.00312
NP_441486.1_1 Reverse -341 -355 19.6658 0.00323
NP_441014.1_10 Reverse -343 -362 20.3531 0.0349
NP_441014.1_10 Forward -354 -335 -0.29631 0.249
NP_442848.1_1 Reverse -338 -352 7.17775 0.0791
NP_442848.1_1 Forward -359 -345 -2.36035 0.263
NP_443018.1_3 Forward -352 -345 14.8871 0.0123
NP_443018.1_3 Reverse -345 -352 14.8871 0.0123
NP_443018.1_3 Forward -149 -142 7.6106 0.156
NP_441634.1_8 Reverse -342 -356 11.8976 0.0529
NP_440376.1_1 Forward -353 -344 19.4693 0.000692
NP_440376.1_1 Reverse -344 -353 19.4693 0.000692
NP_441588.1_4 Forward -351 -341 8.63316 0.14
NP_441588.1_4 Reverse -346 -356 6.96153 0.178
NP_442730.1_8 Reverse -138 -157 4.81688 0.27
NP_442687.1_7 Forward -354 -344 15.8113 0.0125
NP_442687.1_7 Reverse -343 -353 8.92815 0.0994
NP_441797.1_7 Forward -387 -369 11.1305 0.286
NP_441846.1_1 Reverse -110 -129 2.0644 0.299
NP_442958.1_3 Reverse -333 -352 0.0977854 0.267
NP_442658.1_1 Forward -355 -345 15.9091 0.00966
NP_442658.1_1 Reverse -373 -383 9.02601 0.169
NP_442658.1_1 Forward -129 -119 8.43603 0.194
NP_442658.1_1 Reverse -342 -352 6.76441 0.214
NP_440141.1_8 Reverse -366 -385 5.40766 0.275
NP_442544.1_2 Forward -391 -377 -0.492064 0.229
NP_441414.1_9 Forward -353 -334 -2.65548 0.12
NP_441414.1_9 Reverse -344 -363 -4.42544 0.153
NP_442937.1_5 Forward -30 -11 7.37428 0.254
NP_441958.1_5 Forward -354 -344 12.2714 0.00183
NP_441958.1_5 Reverse -343 -353 12.2714 0.00183
NP_442836.1_5 Reverse -338 -357 9.53756 0.131
NP_439905.1_1 Forward -383 -370 8.47575 0.234
NP_440984.1_7 Reverse -339 -353 7.57108 0.166
NP_442911.1_2 Reverse -334 -353 -2.45882 0.0982
NP_442911.1_2 Forward -256 -237 -5.70374 0.165
NP_442911.1_2 Forward -363 -344 -10.522 0.282
NP_440153.1_5 Forward -352 -338 8.75105 0.132
NP_440153.1_5 Reverse -345 -359 0.491246 0.299
NP_442064.1_1 Forward -30 -11 -12.5869 0.277
NP_440602.1_8 Forward -353 -339 17.5025 0.0898
NP_442002.1_9 Forward -354 -347 10.7572 0.185
NP_441294.1_7 Forward -357 -343 16.6418 0.0133
NP_441646.1_1 Forward -397 -378 -1.08219 0.278
NP_442438.1_10 Reverse -339 -353 7.86607 0.0859
NP_442438.1_10 Forward -358 -344 1.67122 0.19
NP_442438.1_10 Reverse -96 -110 -0.0987402 0.248
NP_442885.1_5 Reverse -69 -88 14.7483 0.276
NP_441000.1_6 Reverse -343 -357 5.01447 0.0933
NP_441000.1_6 Forward -354 -340 3.53951 0.111
NP_441000.1_6 Reverse -281 -295 -0.983719 0.21
NP_440147.1_4 Forward -355 -342 3.36254 0.188
NP_440147.1_4 Reverse -342 -355 0.805932 0.244
NP_441550.1_8 Reverse -342 -352 12.3692 0.0336
NP_441550.1_8 Forward -355 -345 6.0761 0.214
NP_441916.1_7 Reverse -344 -354 18.4663 0.00144
NP_441916.1_7 Forward -353 -343 10.3048 0.0261
NP_441041.1_4 Reverse -344 -363 5.11266 0.0533
NP_441041.1_4 Forward -353 -334 -13.0786 0.28
NP_441041.1_7 Forward -356 -344 10.916 0.0864
NP_441725.1_5 Forward -352 -342 11.2881 0.0247
NP_441725.1_5 Reverse -345 -355 11.2881 0.0247
NP_439966.1_7 Forward -355 -345 18.4657 0.00473
NP_439966.1_7 Reverse -342 -352 15.8108 0.0124
NP_439966.1_9 Forward -355 -346 0.983037 0.253
NP_442941.1_3 Forward -352 -342 19.9412 0.00262
NP_442941.1_3 Reverse -345 -355 11.4848 0.0116
NP_440289.1_2 Forward -356 -343 21.3571 0.00262
NP_440289.1_2 Reverse -341 -354 6.60746 0.0591
NP_440260.1_8 Forward -393 -375 5.03403 0.154
NP_441514.1_6 Forward -183 -176 14.2971 0.248
NP_439908.1_5 Reverse -235 -254 9.3409 0.298
NP_442281.1_1 Reverse -339 -353 17.2068 0.00633
NP_442281.1_1 Forward -358 -344 11.9953 0.0418
NP_442281.1_1 Reverse -136 -150 1.96562 0.282
NP_440437.1_1 Forward -359 -340 10.8159 0.0427
NP_440437.1_1 Reverse -338 -357 1.67108 0.145
NP_440437.1_1 Reverse -228 -247 -0.688862 0.185
NP_440498.1_1 Reverse -266 -284 1.00246 0.211
NP_441644.1_6 Forward -353 -343 17.3841 0.00127
NP_441644.1_6 Reverse -344 -354 10.1076 0.0628
NP_441644.1_6 Forward -25 -15 5.78111 0.176
NP_442215.1_2 Forward -355 -339 5.95839 0.0749
NP_442215.1_2 Forward -386 -370 1.73016 0.128
NP_442215.1_2 Reverse -372 -388 -0.0397962 0.159
NP_442215.1_2 Forward -27 -11 -1.71142 0.187
NP_442215.1_2 Forward -392 -376 -5.64466 0.254
NP_442215.1_2 Forward -248 -232 -6.62797 0.277
NP_442247.1_1 Reverse -375 -394 14.2574 0.29
NP_440253.1_2 Reverse -344 -362 20.177 0.00508
NP_440253.1_2 Forward -353 -335 12.0155 0.0302
NP_440929.1_8 Forward -353 -344 19.2726 0.000701
NP_440929.1_8 Reverse -344 -353 19.2726 0.000701
NP_442933.1_10 Forward -353 -344 17.601 0.00325
NP_442933.1_10 Reverse -344 -353 17.601 0.00325
NP_441751.2_8 Forward -352 -338 -3.24533 0.137
NP_441751.2_8 Reverse -345 -359 -4.22864 0.166
NP_442554.1_8 Forward -352 -342 15.9097 0.00747
NP_442554.1_8 Reverse -345 -355 13.8447 0.0145
NP_441762.1_7 Reverse -343 -355 2.89058 0.0676
NP_441762.1_7 Forward -354 -342 2.30059 0.0676
NP_442142.1_4 Reverse -341 -354 16.7349 0.0264
NP_442142.1_4 Forward -356 -343 15.85 0.0264
NP_442292.1_1 Forward -352 -343 18.486 0.00229
NP_442292.1_1 Reverse -345 -354 9.63616 0.0183
NP_440421.1_1 Reverse -296 -310 15.5359 0.19
NP_442381.1_8 Reverse -98 -117 -8.45701 0.222
NP_443009.1_5 Reverse -343 -354 18.3477 0.00265
NP_441371.1_3 Reverse -163 -181 5.91901 0.277
NP_441715.1_4 Reverse -345 -355 16.303 0.0117
NP_441715.1_4 Forward -352 -342 14.828 0.0268
NP_440881.1_4 Reverse -148 -167 0.786102 0.226
NP_440015.1_9 Reverse -141 -159 2.57575 0.204
NP_441468.1_1 Forward -352 -345 15.8704 0.0124
NP_441468.1_1 Reverse -345 -352 15.8704 0.0124
NP_441673.1_1 Forward -353 -344 20.8459 0.000698
NP_441673.1_1 Reverse -344 -353 20.8459 0.000698
NP_441172.1_8 Reverse -145 -159 19.0758 0.151
NP_441826.1_2 Reverse -338 -352 13.8643 0.0213
NP_441826.1_2 Forward -359 -345 2.2612 0.132
NP_442811.1_3 Forward -344 -325 6.98095 0.295
NP_442868.1_6 Reverse -342 -352 9.91146 0.038
NP_442868.1_6 Forward -355 -345 0.963343 0.205
NP_442719.1_2 Forward -390 -372 -11.4863 0.292
NP_441251.1_7 Reverse -302 -315 11.7207 0.27
NP_441056.1_1 Forward -353 -334 -8.85033 0.285
NP_441612.1_2 Forward -353 -343 8.54929 0.21
NP_442361.1_3 Forward -252 -239 9.06573 0.283
NP_442808.1_1 Forward -354 -344 18.4657 0.00201
NP_442808.1_1 Reverse -343 -353 8.63269 0.0481
NP_441315.1_2 Reverse -371 -389 14.9878 0.245
NP_440145.1_3 Forward -363 -344 -1.57384 0.154
NP_442542.1_2 Forward -355 -342 11.4257 0.114
NP_442050.1_5 Reverse -342 -352 16.4991 0.00812
NP_442050.1_5 Forward -355 -345 9.12434 0.193
NP_441114.1_3 Forward -382 -373 14.5527 0.193
NP_440558.1_2 Forward -159 -140 -6.09707 0.271
NP_441518.1_3 Reverse -334 -353 -13.7669 0.264
NP_441518.1_3 Forward -363 -344 -15.7335 0.299
NP_441878.1_6 Forward -354 -344 10.4031 0.0176
NP_441878.1_6 Reverse -343 -353 10.4031 0.0176
NP_441878.1_6 Reverse -374 -384 -7.39479 0.222
NP_441036.1_8 Forward -354 -344 17.7779 0.000554
NP_441036.1_8 Reverse -343 -353 8.33817 0.174
NP_442650.1_2 Reverse -375 -389 5.80112 0.139
NP_441557.1_5 Forward -353 -344 19.9609 0.000699
NP_441557.1_5 Reverse -344 -353 19.9609 0.000699
NP_441445.1_1 Forward -362 -343 9.63589 0.104
NP_441445.1_1 Reverse -335 -354 1.67108 0.248
NP_441308.1_8 Forward -355 -345 10.1081 0.22
NP_442183.1_1 Reverse -344 -358 10.226 0.0869
NP_442183.1_1 Forward -353 -339 7.37441 0.143
NP_442183.1_1 Forward -156 -142 5.21113 0.226
NP_442444.1_6 Reverse -144 -162 13.6944 0.237
NP_441549.1_9 Forward -165 -147 -10.1089 0.269
NP_442170.1_5 Reverse -344 -363 -3.24547 0.269
NP_442347.1_2 Forward -352 -343 12.4878 0.056
NP_442347.1_2 Reverse -345 -354 11.1111 0.056
NP_442347.1_2 Reverse -102 -111 4.42462 0.284
NP_442645.1_2 Reverse -336 -355 -4.72043 0.0608
NP_442645.1_2 Forward -158 -139 -12.5869 0.144
NP_442645.1_2 Forward -179 -160 -18.2901 0.27
NP_442965.1_2 Reverse -142 -161 -7.4737 0.27
NP_441037.1_4 Forward -355 -345 7.02532 0.237
NP_442317.1_6 Reverse -160 -179 4.62101 0.246
NP_441633.1_3 Reverse -342 -355 1.29759 0.109
NP_441633.1_3 Forward -355 -342 -3.81562 0.177
NP_440136.1_2 Forward -352 -345 15.9687 0.0123
NP_440136.1_2 Reverse -345 -352 15.9687 0.0123
NP_442998.1_5 Forward -89 -79 12.0747 0.176
NP_442998.1_5 Forward -182 -172 9.12481 0.252
NP_442998.1_10 Forward -351 -344 15.5754 0.0102
NP_442998.1_10 Reverse -346 -353 15.5754 0.0102
NP_440299.1_1 Forward -388 -375 6.11523 0.152
NP_440299.1_1 Forward -250 -237 5.72191 0.166
NP_440299.1_1 Reverse -340 -353 4.44361 0.207
NP_440299.1_1 Forward -54 -41 3.06699 0.261
NP_440299.1_1 Forward -357 -344 2.28034 0.292
NP_441799.1_1 Reverse -340 -354 12.5853 0.0421
NP_441799.1_1 Forward -357 -343 8.75042 0.106
NP_441007.1_10 Reverse -339 -352 0.805932 0.216
NP_440256.1_1 Reverse -341 -360 6.88262 0.0282
NP_440256.1_1 Forward -356 -337 -1.08219 0.0997
NP_441559.1_8 Forward -161 -147 -5.90027 0.271
NP_441559.1_8 Forward -358 -344 -6.19526 0.275
NP_440915.1_6 Forward -357 -343 -3.147 0.29
NP_441179.1_9 Reverse -283 -293 13.0576 0.272
NP_441866.1_4 Reverse -113 -126 14.023 0.273
NP_441704.1_8 Reverse -333 -352 5.40686 0.294
NP_442150.1_2 Forward -182 -163 22.3537 0.032
NP_441939.1_3 Forward -352 -333 9.73422 0.134
NP_442993.1_1 Reverse -344 -360 10.6783 0.0168
NP_442993.1_1 Forward -353 -337 -7.70961 0.146
NP_442993.1_1 Reverse -165 -181 -11.8395 0.26
NP_442386.1_9 Forward -354 -345 15.7322 0.0144
NP_442386.1_9 Reverse -343 -352 13.8639 0.0289
NP_442386.1_9 Forward -128 -119 6.58748 0.219
NP_442386.1_9 Reverse -380 -389 5.9975 0.23
NP_441340.1_5 Forward -352 -345 15.6737 0.0124
NP_441340.1_5 Reverse -345 -352 15.6737 0.0124
NP_440186.1_6 Forward -132 -113 16.0274 0.167
NP_442791.1_5 Reverse -93 -112 -10.817 0.281
NP_442240.1_2 Reverse -345 -364 -14.5535 0.182
NP_440586.1_8 Forward -352 -345 13.2151 0.026
NP_440586.1_8 Reverse -345 -352 13.2151 0.026
NP_440586.1_8 Reverse -283 -290 5.64364 0.297
NP_442251.1_6 Forward -352 -345 15.2804 0.0124
NP_442251.1_6 Reverse -345 -352 15.2804 0.0124
NP_441262.1_3 Reverse -344 -351 14.7888 0.0223
NP_441262.1_3 Forward -353 -346 14.7888 0.0223
NP_443051.1_1 Reverse -343 -352 10.4228 0.00754
NP_443051.1_1 Forward -354 -345 10.4228 0.00754
NP_439937.1_9 Reverse -76 -93 -9.49991 0.192
NP_441657.1_5 Forward -160 -141 31.2687 0.000234
NP_440439.1_1 Forward -356 -343 1.19926 0.159
NP_440439.1_1 Reverse -341 -354 0.117615 0.202
NP_440372.1_2 Forward -352 -345 16.3621 0.0124
NP_440372.1_2 Reverse -345 -352 16.3621 0.0124
NP_440574.1_3 Forward -358 -339 2.55606 0.173
NP_440267.1_2 Reverse -339 -353 8.45543 0.162
NP_442384.1_10 Forward -353 -340 1.10092 0.268
NP_442339.1_3 Forward -358 -340 17.7187 0.116
NP_442262.1_10 Forward -352 -345 14.1988 0.0123
NP_442262.1_10 Reverse -345 -352 14.1988 0.0123
NP_442262.1_10 Forward -149 -142 8.8889 0.219
NP_441689.1_5 Reverse -342 -352 15.3192 0.0403
NP_441689.1_5 Forward -355 -345 8.53436 0.132
NP_440163.1_10 Forward -356 -346 15.2213 0.0762
NP_440163.1_10 Reverse -341 -351 11.3864 0.169
NP_440344.1_10 Forward -360 -343 3.18543 0.0274
NP_440344.1_10 Reverse -94 -111 -13.2358 0.278
NP_440297.1_9 Forward -352 -342 9.32148 0.0917
NP_440297.1_9 Reverse -345 -355 9.32148 0.0917
NP_442280.1_10 Reverse -174 -192 5.74663 0.283
NP_440999.1_9 Forward -357 -343 4.62115 0.116
NP_440888.1_2 Forward -353 -339 18.0918 0.00261
NP_440888.1_2 Reverse -344 -358 15.5352 0.0102
NP_440888.1_2 Forward -390 -376 12.192 0.0495
NP_440052.1_5 Forward -395 -376 -3.54046 0.235
NP_442277.1_2 Forward -385 -371 10.226 0.287
NP_442807.1_1 Forward -59 -40 28.0238 0.000499
NP_441543.1_2 Reverse -345 -354 18.486 0.00236
NP_441543.1_2 Forward -352 -343 16.9127 0.00359
NP_442845.1_2 Reverse -338 -352 5.1128 0.243
NP_441469.1_8 Forward -354 -345 16.126 0.00797
NP_441469.1_8 Reverse -343 -352 6.48957 0.227
NP_443064.1_6 Forward -353 -343 12.5669 0.0796
NP_442337.1_8 Reverse -177 -196 8.25926 0.191
NP_442578.1_7 Forward -352 -345 14.5921 0.026
NP_442578.1_7 Reverse -345 -352 14.5921 0.026
NP_441462.1_2 Forward -353 -343 11.5831 0.00406
NP_441462.1_2 Reverse -344 -354 11.5831 0.00406
NP_443062.1_1 Reverse -344 -362 8.44842 0.153
NP_443062.1_1 Forward -353 -335 5.6207 0.224
NP_443062.1_6 Forward -361 -342 5.11266 0.209
NP_443062.1_6 Reverse -336 -355 4.03102 0.224
NP_440516.1_8 Forward -353 -344 16.9127 0.00442
NP_440516.1_8 Reverse -344 -353 16.9127 0.00442
NP_441785.1_1 Reverse -344 -358 11.3809 0.3
NP_442428.1_4 Forward -354 -335 3.83436 0.238
NP_442428.1_5 Forward -352 -345 15.8704 0.0124
NP_442428.1_5 Reverse -345 -352 15.8704 0.0124
NP_442859.1_2 Reverse -142 -161 14.8474 0.068
NP_440673.1_2 Forward -394 -375 7.85324 0.288
NP_440673.1_3 Forward -351 -344 12.4288 0.0426
NP_440673.1_3 Reverse -346 -353 12.4288 0.0426
NP_440673.1_3 Forward -148 -141 10.5605 0.123
NP_440673.1_3 Forward -169 -162 5.54565 0.288
NP_441052.1_2 Forward -353 -343 19.9412 0.00106
NP_441052.1_2 Reverse -344 -354 10.5014 0.0285
NP_442219.1_8 Reverse -364 -383 10.5829 0.202
NP_442219.1_8 Forward -357 -338 7.97384 0.257
NP_442219.1_9 Forward -352 -343 17.7976 0.00718
NP_442219.1_9 Reverse -345 -354 8.35786 0.0681
NP_440436.1_4 Reverse -345 -354 18.1905 0.00233
NP_440436.1_4 Forward -352 -343 17.2072 0.00233
NP_440436.1_4 Forward -383 -374 6.48915 0.157
NP_441884.1_9 Reverse -234 -253 -21.6334 0.256
NP_441884.1_9 Forward -356 -337 -23.1083 0.284
NP_441719.1_4 Forward -352 -345 16.3621 0.0124
NP_441719.1_4 Reverse -345 -352 16.3621 0.0124
NP_441733.1_10 Reverse -341 -354 9.95071 0.106
NP_441733.1_10 Reverse -98 -111 4.14919 0.273
NP_441004.1_1 Reverse -375 -394 -16.0285 0.281
NP_441577.1_10 Reverse -340 -359 8.84924 0.198
NP_442366.1_3 Forward -391 -373 2.57575 0.127
NP_442366.1_3 Forward -354 -336 1.29745 0.153
NP_442366.1_3 Reverse -343 -361 -4.79907 0.276
NP_442366.1_5 Reverse -247 -257 10.3043 0.276
NP_442873.1_9 Forward -256 -237 7.66846 0.236
NP_442694.1_4 Reverse -110 -119 12.2911 0.253
NP_443054.1_2 Reverse -342 -356 12.4876 0.0722
NP_443054.1_2 Forward -355 -341 3.34284 0.24
NP_443054.1_2 Reverse -379 -393 -0.000409212 0.283
NP_440864.1_9 Forward -105 -86 -5.50708 0.231
NP_441851.1_10 Forward -354 -344 16.008 0.00552
NP_441851.1_10 Reverse -343 -353 15.8113 0.00552
NP_442515.1_1 Reverse -343 -357 2.75286 0.13
NP_442515.1_1 Forward -354 -340 0.687908 0.183
NP_440593.1_3 Reverse -370 -389 -2.85214 0.228
NP_440593.1_3 Forward -388 -369 -5.31042 0.259
NP_441349.1_10 Reverse -334 -353 8.35759 0.0274
NP_441409.1_6 Forward -359 -340 -6.09707 0.119
NP_440432.1_9 Forward -352 -337 5.3881 0.0555
NP_440432.1_9 Reverse -345 -360 -2.77337 0.175
NP_442843.1_1 Forward -126 -107 4.52268 0.152
NP_440474.1_8 Reverse -345 -359 7.47213 0.204
NP_440431.1_3 Reverse -40 -59 -10.817 0.278
NP_442450.1_5 Reverse -342 -352 9.32148 0.115
NP_442450.1_5 Forward -355 -345 9.32148 0.115
NP_440943.1_4 Reverse -133 -145 14.6903 0.251
NP_442006.1_2 Reverse -381 -398 10.7569 0.0595
NP_442006.1_2 Forward -95 -78 -17.2674 0.271
NP_441003.1_9 Forward -399 -380 3.73603 0.291
NP_441570.1_1 Forward -353 -335 -0.374176 0.046
NP_441570.1_1 Reverse -344 -362 -16.5988 0.249
NP_441078.1_4 Forward -353 -344 19.6659 0.0007
NP_441078.1_4 Reverse -344 -353 19.6659 0.0007
NP_442443.1_4 Forward -124 -114 18.1707 0.14
NP_440526.1_3 Forward -352 -341 10.1862 0.0646
NP_440526.1_3 Reverse -345 -356 1.92649 0.267
NP_441432.1_8 Reverse -343 -352 16.8143 0.00595
NP_441432.1_8 Forward -354 -345 8.25953 0.0755
NP_441432.1_8 Reverse -380 -389 5.60459 0.147
NP_441432.1_8 Reverse -140 -149 2.55633 0.298
NP_442320.1_8 Reverse -338 -352 11.996 0.0175
NP_442320.1_8 Forward -359 -345 5.99778 0.0309
NP_441732.1_2 Forward -357 -341 -16.6577 0.186
NP_440199.1_10 Reverse -341 -351 16.7946 0.0381
NP_440199.1_10 Forward -356 -346 14.533 0.0861
NP_442489.1_7 Forward -353 -344 20.1576 0.000695
NP_442489.1_7 Reverse -344 -353 20.1576 0.000695
NP_440565.1_3 Forward -393 -374 15.7735 0.218
NP_442079.1_7 Reverse -345 -364 2.3594 0.229
NP_440559.1_1 Forward -352 -343 17.4043 0.00658
NP_440559.1_1 Reverse -345 -354 8.75118 0.0586
NP_441659.2_8 Forward -353 -343 18.1713 0.00133
NP_441659.2_8 Reverse -344 -354 11.9764 0.0147
NP_441659.2_8 Forward -246 -236 2.14332 0.211
NP_442913.1_9 Reverse -276 -295 9.53756 0.22
NP_442346.1_5 Reverse -343 -353 16.6963 0.00248
NP_442346.1_5 Forward -354 -344 9.02648 0.118
NP_442346.1_5 Forward -175 -165 6.66654 0.195
NP_442346.1_5 Forward -295 -285 4.89658 0.269
NP_442346.1_10 Forward -400 -381 -2.36049 0.294
NP_440025.1_1 Forward -357 -338 7.47261 0.243
NP_441629.1_1 Forward -361 -342 10.8159 0.154
NP_440459.1_2 Reverse -335 -352 7.80699 0.278
NP_442551.1_4 Forward -386 -371 -1.69173 0.247
NP_440847.1_8 Reverse -172 -191 13.5691 0.273
NP_441948.1_4 Forward -360 -342 -2.3408 0.163
NP_441948.1_4 Reverse -337 -355 -3.91409 0.21
NP_441833.1_4 Forward -352 -345 15.9687 0.0124
NP_441833.1_4 Reverse -345 -352 15.9687 0.0124
NP_442162.1_9 Forward -352 -345 16.2637 0.0124
NP_442162.1_9 Reverse -345 -352 16.2637 0.0124
NP_440671.1_4 Forward -359 -345 14.5526 0.0587
NP_440671.1_4 Reverse -338 -352 13.7659 0.0748
NP_440772.1_10 Reverse -41 -60 21.7934 0.061
NP_442140.1_3 Reverse -345 -355 8.33817 0.119
NP_442140.1_3 Reverse -283 -293 5.19158 0.221
NP_442140.1_3 Forward -352 -342 4.40493 0.243
NP_441609.1_1 Forward -31 -12 1.0811 0.197
NP_440875.1_9 Reverse -346 -356 8.37203 0.233
NP_441813.1_5 Forward -355 -345 17.188 0.00979
NP_441813.1_5 Reverse -342 -352 15.9097 0.01
NP_440590.1_4 Reverse -345 -358 5.23083 0.0585
NP_440590.1_4 Forward -352 -339 2.57589 0.0845
NP_440567.1_1 Forward -109 -95 0.491246 0.244
NP_442497.1_10 Forward -352 -343 10.4228 0.0087
NP_442497.1_10 Reverse -345 -354 10.4228 0.0087
NP_440821.1_4 Forward -355 -345 19.0562 0.00399
NP_440821.1_4 Reverse -342 -352 18.2696 0.00448
NP_441239.1_9 Forward -355 -343 13.3137 0.037
NP_441239.1_9 Reverse -342 -354 6.92215 0.173
NP_440706.1_1 Reverse -340 -359 -3.44213 0.258
NP_442270.1_9 Reverse -370 -389 -10.6203 0.259
NP_442270.1_9 Reverse -154 -173 -11.7019 0.277
NP_441017.1_6 Forward -357 -343 12.487 0.217
NP_441017.1_6 Reverse -340 -354 11.7987 0.242
NP_442772.1_4 Forward -138 -119 -3.04881 0.231
NP_441567.1_10 Reverse -228 -247 17.7965 0.206
NP_440391.1_6 Reverse -303 -322 18.4857 0.0312
NP_442052.1_8 Reverse -373 -383 13.4514 0.253
NP_440546.1_4 Reverse -344 -354 11.8882 0.0679
NP_440546.1_4 Forward -353 -343 10.046 0.109
NP_440462.1_6 Forward -355 -345 15.418 0.0142
NP_440462.1_6 Reverse -342 -352 7.74818 0.0699
NP_440462.1_6 Forward -112 -102 2.63497 0.28
NP_440868.1_4 Forward -357 -345 8.49544 0.0602
NP_440868.1_4 Reverse -340 -352 5.93884 0.0879
NP_440868.1_5 Forward -136 -117 20.3653 0.0803
NP_440270.1_6 Forward -50 -31 8.06259 0.274
NP_442402.1_4 Forward -349 -330 -7.57277 0.276
NP_442402.1_6 Reverse -369 -378 13.0777 0.289
NP_441848.1_7 Reverse -108 -127 -2.06626 0.261
NP_441084.1_6 Forward -296 -282 11.2833 0.208
NP_441084.1_6 Reverse -14 -28 10.6046 0.234
NP_442039.1_4 Forward -352 -345 15.1821 0.0124
NP_442039.1_4 Reverse -345 -352 15.1821 0.0124
NP_441926.1_3 Reverse -344 -360 6.25339 0.17
NP_441926.1_3 Forward -353 -337 5.56507 0.17
NP_442837.1_3 Forward -352 -345 15.7721 0.0124
NP_442837.1_3 Reverse -345 -352 15.7721 0.0124
NP_440160.1_9 Reverse -374 -393 12.2908 0.216
NP_442053.1_1 Forward -353 -344 18.3876 0.0007
NP_442053.1_1 Reverse -344 -353 18.3876 0.0007
NP_440505.1_3 Reverse -342 -352 16.303 0.00696
NP_440505.1_3 Forward -355 -345 13.8447 0.0247
NP_440505.1_3 Reverse -145 -155 9.02648 0.128
NP_440914.1_1 Forward -353 -343 17.5935 0.000537
NP_440914.1_1 Reverse -375 -385 10.6645 0.129
NP_440914.1_1 Reverse -344 -354 8.6151 0.186
NP_440914.1_1 Reverse -141 -151 6.76087 0.267
NP_441011.1_8 Reverse -345 -354 16.9127 0.00602
NP_441011.1_8 Forward -352 -343 8.25953 0.144
NP_442533.1_6 Forward -353 -344 17.2076 0.00137
NP_442533.1_6 Reverse -344 -353 17.2076 0.00137
NP_441482.1_7 Forward -359 -345 -8.94853 0.193
NP_441482.1_7 Reverse -338 -352 -8.94853 0.193
NP_439944.1_9 Forward -352 -342 19.0562 0.00329
NP_439944.1_9 Reverse -345 -355 10.3048 0.0887
NP_440116.1_8 Forward -352 -333 -10.0303 0.297
NP_440007.1_9 Forward -159 -145 8.55439 0.175
NP_441602.1_8 Forward -218 -199 22.3206 0.0856
NP_441106.1_1 Forward -354 -345 18.191 0.0028
NP_441106.1_1 Reverse -343 -352 9.63616 0.0311
NP_441286.1_1 Reverse -343 -355 14.4936 0.00418
NP_441286.1_1 Forward -354 -342 11.8387 0.0114
NP_442674.1_2 Reverse -225 -244 7.86593 0.262
NP_440670.1_8 Forward -353 -344 18.3876 0.000699
NP_440670.1_8 Reverse -344 -353 18.3876 0.000699
NP_440670.1_8 Reverse -237 -246 3.83464 0.219
NP_442908.1_1 Forward -30 -11 0.982764 0.277
NP_440886.1_7 Forward -354 -344 17.7774 0.0011
NP_440886.1_7 Reverse -343 -353 7.94438 0.0805
NP_442614.1_2 Forward -353 -339 5.80112 0.297
NP_442072.1_9 Forward -354 -336 -3.02911 0.0326
NP_442072.1_9 Reverse -343 -361 -4.60241 0.0476
NP_440907.2_8 Reverse -345 -355 7.84605 0.117
NP_441021.1_1 Forward -389 -370 -11.8986 0.275
NP_441021.1_8 Reverse -339 -357 11.8189 0.11
NP_441021.1_8 Forward -358 -340 2.0841 0.253
NP_441463.1_3 Forward -363 -344 -7.67036 0.259
NP_441463.1_6 Reverse -342 -356 5.64286 0.287
NP_441626.1_2 Forward -352 -345 15.7721 0.0124
NP_441626.1_2 Reverse -345 -352 15.7721 0.0124
NP_442615.1_1 Forward -362 -344 1.39578 0.0853
NP_442615.1_1 Reverse -335 -353 1.39578 0.0853
NP_440387.1_1 Reverse -344 -360 -3.08806 0.155
NP_440387.1_1 Forward -353 -337 -4.36636 0.185
NP_440387.1_1 Forward -284 -268 -5.34967 0.227
NP_441521.1_4 Reverse -155 -174 11.4058 0.297
NP_442084.1_6 Reverse -115 -133 12.6055 0.169
NP_440114.1_10 Reverse -344 -358 14.1593 0.0429
NP_440114.1_10 Forward -353 -339 10.4227 0.148
NP_441510.2_7 Reverse -375 -389 11.9953 0.28
NP_441510.2_7 Reverse -338 -352 10.3237 0.28
NP_440766.1_4 Reverse -340 -354 8.06273 0.0871
NP_441237.1_9 Forward -383 -373 10.0098 0.255
NP_442930.1_1 Forward -315 -305 12.9592 0.239
NP_439910.1_2 Forward -361 -344 24.6216 0.000724
NP_439910.1_2 Reverse -336 -353 5.25038 0.0287
NP_439910.1_2 Reverse -69 -86 -14.4158 0.183
NP_440457.1_1 Forward -357 -345 0.0389777 0.25
NP_440457.1_1 Reverse -340 -352 0.0389777 0.25
NP_442509.1_9 Reverse -344 -354 16.2041 0.00739
NP_442509.1_9 Forward -353 -343 8.14104 0.192
NP_440554.1_4 Reverse -345 -355 14.6313 0.02
NP_440554.1_4 Forward -352 -342 7.05986 0.106
NP_441885.1_5 Forward -353 -343 20.9245 0.000538
NP_441885.1_5 Reverse -344 -354 11.4848 0.00668
NP_442341.1_7 Reverse -343 -357 10.0294 0.0682
NP_442341.1_7 Forward -354 -340 8.35772 0.0881
NP_442341.1_9 Forward -355 -341 14.2569 0.0695
NP_441173.1_9 Forward -42 -34 10.9338 0.242
NP_443000.1_7 Reverse -342 -352 17.0896 0.00865
NP_443000.1_7 Forward -355 -345 8.73149 0.0437
NP_440552.1_8 Forward -52 -35 20.2009 0.0201
NP_442513.1_5 Reverse -336 -355 5.80018 0.287
NP_441842.1_10 Forward -253 -239 7.47274 0.257
NP_440275.1_3 Forward -355 -345 8.4365 0.0602
NP_440275.1_3 Reverse -342 -352 8.1415 0.0602
NP_440275.1_3 Forward -293 -283 2.83163 0.249
NP_440091.1_1 Forward -357 -345 18.3285 0.0114
NP_440091.1_1 Reverse -340 -352 16.4603 0.0153
NP_440091.1_1 Reverse -161 -173 0.23564 0.259
NP_441307.1_4 Forward -293 -274 0.196116 0.249
NP_443010.1_10 Forward -356 -339 6.24961 0.192
NP_442686.1_5 Reverse -94 -113 19.469 0.178
NP_441122.1_1 Forward -388 -373 13.9429 0.126
NP_442495.1_5 Forward -138 -119 7.17762 0.291
NP_440149.1_8 Forward -353 -334 4.62101 0.0809
NP_440216.1_1 Forward -353 -339 7.9644 0.00737
NP_440216.1_1 Reverse -344 -358 6.3911 0.0156
NP_440216.1_9 Reverse -377 -386 7.17789 0.286
NP_440216.1_9 Forward -125 -116 6.78456 0.289
NP_440216.1_9 Forward -148 -139 5.50626 0.292
NP_440172.1_1 Forward -353 -343 15.0247 0.00945
NP_440172.1_1 Reverse -344 -354 8.73149 0.0586
NP_442015.1_10 Forward -357 -344 0.904263 0.216
NP_442015.1_10 Reverse -340 -353 0.60927 0.221
NP_442015.1_10 Forward -388 -375 -0.177378 0.255
NP_441226.1_7 Forward -352 -345 14.4934 0.0123
NP_441226.1_7 Reverse -345 -352 14.4934 0.0123
NP_441111.1_7 Forward -352 -344 18.7023 0.00294
NP_441111.1_7 Reverse -345 -353 18.7023 0.00294
NP_442379.1_10 Reverse -337 -354 -1.43612 0.223
NP_441766.1_2 Forward -353 -344 17.5026 0.00297
NP_441766.1_2 Reverse -344 -353 17.5026 0.00297
NP_440416.1_9 Forward -391 -372 -6.49039 0.0901
NP_443052.1_8 Forward -363 -344 0.392778 0.0664
NP_443052.1_8 Reverse -334 -353 -2.85214 0.0953
NP_440261.1_1 Forward -393 -380 17.9155 0.186
NP_440261.1_5 Forward -352 -339 -10.6005 0.201
NP_440261.1_5 Forward -383 -370 -12.4687 0.297
NP_440261.1_5 Reverse -345 -358 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTTACACTTCCGCCTTTGCCATTGTCCACAGAGCTAGTTAAATAAACGGCGATCGCCATTTGTTTACTCATATTCTGGTGCCGTCAAATAATTCCCGATGAGAGCAAGCTATGATCGGAGTTAGCGTTAATCCAGAGAAACTAGGATCCACTATGGAGACCGTCAATGTTGACCAAATAGAAATCAATCTTCCTGAGCTTTTGTACAGTATCAAACCAGGGGAAGAAGTCATCGTTGCTGACCAGGGTATTCCCATTGCTAAGTTGGTTCCTCTGCAAAGGCAAAAATCCGTGGATCGATGCTCCAGCTTAGGGGTAGATCGAGGATTATTTGTAGTGCCAGATGACTTTAACGATCCTTTACCAAATGATATTTGGCCATTATCTTGAGAAGGATTAAC

CDS

GTGAAACTTTTGTTGGATACCCAGTGCTGGTTATGGTGGTTTACTGAGCCGGAAAAATTGAACGAAGATGCAATTTCCCAGATCATAGATGAGACAAACGAAATATGGCTTTCTGTTGCCAGTATTTGGGAAATGTCAATTAAGACTTCCATCGGTAAACTGCCCTTGCCAGAAAATATTGACGACTACATTCTCAGTCGCATGGTGAAATTGGGTGCTGAGTTCCTGGACATTAAAACCCGCCATGCCCTGCAAGTTGCGACATTGCCCCTACATCACCGTGATCCGTTTGACAGAATTATCATTGCCCAGGCACAAACAGAAAATATGCTGCTAATTAGTGCAGATTCAATGTTTAAAAATTATGGAGTCTCTTTGTTATGGGCGGGAGTATAG

Protein

MKLLLDTQCWLWWFTEPEKLNEDAISQIIDETNEIWLSVASIWEMSIKTSIGKLPLPENIDDYILSRMVKLGAEFLDIKTRHALQVATLPLHHRDPFDRIIIAQAQTENMLLISADSMFKNYGVSLLWAGV