Your browser is old and dusty. Try Google Chrome!

Details for sll0508

ORF sll0508
Accession NP_442755.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -69 -62 10.8555 0.132
NP_441418.1_6 Reverse -337 -356 -19.6667 0.093
NP_441418.1_6 Reverse -265 -284 -22.715 0.184
NP_440897.1_6 Reverse -140 -159 -0.197979 0.182
NP_441960.1_3 Forward -194 -175 16.852 0.155
NP_442169.1_1 Forward -194 -175 -0.39387 0.261
NP_440931.1_7 Forward -332 -314 15.948 0.212
NP_442655.1_10 Reverse -337 -356 -11.2103 0.241
NP_442173.1_1 Reverse -227 -235 4.73931 0.258
NP_443027.1_4 Forward -72 -62 9.91146 0.147
NP_441225.1_4 Forward -267 -248 -12.3902 0.284
NP_440784.1_7 Reverse -62 -69 9.67555 0.104
NP_440784.1_7 Forward -345 -338 5.84064 0.248
NP_440631.1_2 Reverse -338 -357 11.6025 0.2
NP_440878.1_4 Forward -341 -323 14.8671 0.191
NP_442062.1_8 Reverse -322 -332 3.81494 0.252
NP_440761.1_4 Forward -75 -56 -2.85214 0.132
NP_441900.1_2 Forward -365 -347 -1.75153 0.273
NP_441781.1_7 Forward -263 -244 -1.57384 0.275
NP_439918.1_3 Forward -24 -5 2.26107 0.297
NP_441200.1_4 Reverse -318 -337 5.01433 0.299
NP_441208.1_9 Reverse -334 -348 5.40779 0.267
NP_441208.1_9 Reverse -304 -318 5.30946 0.271
NP_440132.1_1 Reverse -278 -296 10.5406 0.218
NP_440132.1_1 Reverse -335 -353 9.55725 0.234
NP_440856.1_7 Reverse -334 -353 -1.47551 0.182
NP_442889.1_8 Forward -266 -252 4.42388 0.267
NP_440447.1_5 Forward -367 -357 13.943 0.277
NP_442445.1_1 Reverse -254 -273 13.8641 0.213
NP_442445.1_1 Reverse -318 -337 11.2092 0.271
NP_441716.1_1 Reverse -337 -351 4.42448 0.256
NP_442634.1_4 Reverse -335 -349 10.7177 0.0479
NP_441012.1_4 Forward -350 -337 11.0324 0.257
NP_443018.1_3 Forward -240 -233 7.6106 0.156
NP_443018.1_3 Forward -69 -62 4.07068 0.299
NP_441857.1_5 Forward -96 -78 1.78911 0.29
NP_440642.1_10 Forward -369 -355 7.57046 0.221
NP_440642.1_10 Forward -368 -354 5.50552 0.241
NP_440667.1_2 Forward -27 -8 -7.76869 0.285
NP_440360.1_9 Forward -49 -30 12.5858 0.243
NP_442544.1_2 Forward -339 -325 -0.0987402 0.217
NP_441256.1_8 Reverse -335 -354 3.93269 0.272
NP_442321.1_4 Forward -284 -265 -5.40875 0.284
NP_441127.1_1 Forward -391 -377 8.16106 0.3
NP_440203.1_5 Forward -329 -319 12.1726 0.164
NP_440203.1_5 Reverse -268 -278 11.6809 0.182
NP_442816.1_7 Forward -214 -195 4.63094 0.27
NP_439905.1_2 Forward -372 -358 7.66941 0.296
NP_440985.1_10 Reverse -88 -107 14.9458 0.225
NP_442690.1_1 Reverse -198 -217 -5.80207 0.163
NP_442690.1_1 Reverse -31 -50 -8.35868 0.187
NP_442911.1_2 Reverse -90 -109 -9.93197 0.267
NP_440153.1_6 Reverse -336 -355 22.3206 0.111
NP_440062.1_5 Reverse -350 -369 24.1889 0.00891
NP_443044.1_1 Reverse -364 -383 3.83436 0.279
NP_442002.1_9 Forward -383 -376 11.3472 0.185
NP_441654.1_7 Reverse -8 -27 12.3396 0.27
NP_441292.1_2 Reverse -220 -239 -9.63698 0.291
NP_441752.1_6 Forward -353 -334 -0.983855 0.279
NP_440147.1_4 Forward -318 -305 1.00259 0.242
NP_441550.1_8 Reverse -59 -69 5.78111 0.23
NP_441041.1_4 Reverse -248 -267 -9.44032 0.216
NP_442281.1_1 Forward -114 -100 1.67063 0.293
NP_440437.1_1 Forward -295 -276 -2.85214 0.227
NP_442012.1_5 Reverse -259 -278 6.39097 0.253
NP_441556.1_4 Reverse -325 -344 10.3907 0.284
NP_441556.1_7 Forward -290 -271 0.785326 0.29
NP_442982.1_5 Forward -356 -337 -3.14714 0.296
NP_442982.1_5 Forward -285 -266 -3.3438 0.297
NP_440375.1_8 Forward -330 -311 0.58944 0.26
NP_441644.1_6 Forward -241 -231 6.56775 0.154
NP_441644.1_6 Forward -70 -60 6.37109 0.161
NP_441644.1_6 Reverse -337 -347 4.30615 0.242
NP_442142.1_4 Forward -283 -270 4.34528 0.223
NP_442292.1_1 Forward -256 -247 2.06468 0.23
NP_440919.1_1 Forward -395 -376 -1.47551 0.221
NP_441865.1_3 Reverse -100 -118 20.0787 0.0644
NP_440947.1_7 Reverse -267 -286 7.47261 0.228
NP_441448.1_1 Forward -70 -51 4.22769 0.279
NP_440183.1_7 Forward -360 -341 20.649 0.0551
NP_441468.1_1 Forward -69 -62 4.07068 0.263
NP_441569.1_7 Reverse -183 -197 16.3219 0.296
NP_441015.1_10 Forward -75 -56 -9.93197 0.282
NP_441015.1_10 Reverse -347 -366 -11.0136 0.29
NP_441330.1_1 Forward -280 -261 -6.1954 0.146
NP_441637.1_9 Reverse -34 -52 -2.24246 0.292
NP_441764.1_4 Reverse -1 -18 10.4591 0.255
NP_442427.1_8 Reverse -372 -391 11.0125 0.155
NP_442427.1_8 Forward -399 -380 8.75091 0.194
NP_441101.1_4 Reverse -98 -117 11.7008 0.153
NP_440145.1_3 Reverse -327 -346 -5.70374 0.275
NP_442718.1_1 Reverse -274 -293 6.78429 0.17
NP_442050.1_8 Reverse -346 -365 12.3342 0.272
NP_441114.1_3 Forward -273 -264 7.27622 0.247
NP_440558.1_2 Forward -278 -259 6.09597 0.137
NP_440558.1_2 Reverse -313 -332 -5.11376 0.253
NP_440558.1_2 Forward -272 -253 -5.40875 0.258
NP_442789.1_4 Reverse -335 -354 9.0459 0.0985
NP_441878.1_6 Reverse -336 -346 1.65166 0.0795
NP_441878.1_6 Reverse -265 -275 -7.49312 0.231
NP_441520.1_5 Forward -82 -63 9.63589 0.253
NP_441433.1_8 Reverse -141 -160 -2.75381 0.27
NP_441773.1_2 Forward -44 -31 14.08 0.292
NP_441638.1_2 Forward -277 -258 17.7974 0.0703
NP_442965.1_2 Reverse -260 -279 -6.09707 0.257
NP_442888.1_8 Reverse -179 -198 9.63589 0.275
NP_442317.1_6 Forward -351 -332 6.4893 0.238
NP_441405.1_1 Forward -346 -336 15.9097 0.284
NP_442998.1_5 Forward -195 -185 9.41981 0.241
NP_440899.1_5 Forward -311 -292 6.09597 0.242
NP_441799.1_1 Forward -245 -231 4.12889 0.266
NP_442504.1_4 Forward -118 -99 2.19602 0.211
NP_441559.1_8 Forward -279 -265 -3.54032 0.205
NP_440717.1_2 Reverse -343 -362 -11.3086 0.283
NP_441464.1_8 Forward -346 -332 7.86607 0.205
NP_440702.1_2 Reverse -334 -353 -8.45701 0.294
NP_441494.1_6 Forward -64 -51 7.00078 0.269
NP_442386.1_9 Reverse -60 -69 4.91586 0.276
NP_440168.1_9 Reverse -335 -354 1.86774 0.237
NP_440251.1_6 Reverse -33 -51 19.0986 0.0957
NP_440586.1_8 Forward -69 -62 7.41359 0.251
NP_442959.1_5 Reverse -30 -49 5.60432 0.276
NP_441262.1_1 Reverse -307 -325 27.1585 0.00361
NP_441262.1_5 Reverse -378 -397 4.32602 0.284
NP_440027.1_3 Reverse -167 -185 4.04996 0.262
NP_439984.1_3 Reverse -306 -320 13.077 0.239
NP_439937.1_8 Reverse -344 -363 -1.67217 0.249
NP_441657.1_5 Forward -279 -260 3.53937 0.142
NP_442239.1_8 Reverse -300 -319 4.916 0.288
NP_440770.1_5 Forward -49 -30 14.5621 0.292
NP_441181.1_6 Reverse -338 -356 5.82068 0.22
NP_440316.1_10 Forward -310 -300 5.97822 0.275
NP_439977.1_5 Forward -269 -250 -0.0988766 0.217
NP_439977.1_5 Forward -263 -244 -2.75381 0.289
NP_441572.1_7 Reverse -301 -320 -5.50708 0.263
NP_440267.1_2 Forward -351 -337 7.47213 0.196
NP_442384.1_10 Reverse -337 -350 10.344 0.0461
NP_442384.1_10 Forward -70 -57 6.90245 0.092
NP_442262.1_10 Forward -240 -233 8.8889 0.219
NP_441335.1_8 Reverse -378 -397 16.1257 0.124
NP_441335.1_8 Forward -393 -374 6.4893 0.284
NP_442750.1_3 Reverse -334 -353 -10.9153 0.236
NP_440888.1_2 Reverse -61 -75 7.27547 0.202
NP_440888.1_2 Forward -361 -347 6.58715 0.228
NP_442454.1_2 Reverse -29 -48 7.49569 0.291
NP_441543.1_2 Forward -262 -253 9.73449 0.0818
NP_442845.1_2 Reverse -253 -267 5.60446 0.228
NP_441469.1_8 Reverse -265 -274 7.57121 0.227
NP_440220.1_4 Forward -281 -262 8.25844 0.176
NP_443062.1_1 Forward -268 -250 5.42569 0.229
NP_443062.1_1 Reverse -254 -272 3.57305 0.293
NP_441410.1_5 Reverse -164 -183 18.289 0.175
NP_440519.1_2 Reverse -180 -199 12.3892 0.194
NP_440519.1_6 Forward -246 -232 10.7177 0.29
NP_440519.1_8 Reverse -337 -353 5.07341 0.21
NP_442872.1_1 Forward -354 -335 -12.6852 0.255
NP_442428.1_5 Forward -69 -62 4.56234 0.249
NP_442859.1_2 Reverse -261 -280 2.45773 0.28
NP_441867.1_2 Forward -399 -380 -13.9635 0.277
NP_440673.1_3 Reverse -63 -70 10.9539 0.106
NP_441052.1_2 Reverse -61 -71 5.38824 0.12
NP_441052.1_2 Forward -346 -336 2.04498 0.22
NP_441052.1_2 Reverse -337 -347 1.94665 0.221
NP_442219.1_8 Forward -74 -55 6.23444 0.3
NP_442219.1_9 Reverse -62 -71 5.40793 0.166
NP_440436.1_4 Reverse -168 -177 4.52254 0.256
NP_441884.1_9 Forward -292 -273 -23.5016 0.284
NP_441884.1_9 Reverse -334 -353 -23.895 0.284
NP_441004.1_1 Forward -320 -301 -13.0786 0.253
NP_441004.1_1 Reverse -260 -279 -13.5702 0.259
NP_441004.1_4 Forward -393 -383 8.63316 0.269
NP_439949.1_7 Reverse -84 -98 13.0776 0.257
NP_441034.1_4 Forward -280 -261 15.0363 0.235
NP_440129.1_10 Forward -281 -267 3.34284 0.214
NP_440296.1_10 Reverse -334 -353 -12.8819 0.269
NP_441966.1_7 Forward -356 -337 4.81688 0.192
NP_440864.1_9 Forward -319 -300 -7.37537 0.29
NP_442208.1_5 Reverse -350 -369 -2.0655 0.252
NP_440432.1_9 Forward -345 -330 2.92983 0.105
NP_439960.1_10 Reverse -342 -360 4.34571 0.161
NP_440396.1_1 Forward -331 -312 13.0775 0.141
NP_440431.1_3 Forward -60 -41 -3.44213 0.178
NP_442168.1_5 Reverse -51 -70 -2.26216 0.264
NP_440588.1_2 Forward -355 -336 -0.688862 0.152
NP_442006.1_2 Reverse -271 -288 -5.66436 0.145
NP_442006.1_2 Forward -391 -374 -9.89259 0.197
NP_441003.1_9 Forward -355 -336 8.35759 0.224
NP_441570.1_1 Reverse -337 -355 -11.7806 0.203
NP_441078.1_4 Reverse -337 -346 -1.96689 0.282
NP_440539.1_9 Forward -324 -305 6.68596 0.23
NP_440707.1_9 Reverse -347 -366 5.11266 0.255
NP_440526.1_3 Reverse -51 -62 5.56471 0.241
NP_440526.1_3 Forward -345 -334 1.92649 0.267
NP_440526.1_3 Reverse -62 -73 0.844851 0.267
NP_441432.1_8 Reverse -253 -262 2.94966 0.28
NP_441333.1_1 Reverse -39 -49 13.3058 0.217
NP_441732.1_2 Forward -350 -334 -16.7561 0.195
NP_441732.1_2 Forward -267 -251 -17.0511 0.231
NP_441732.1_2 Forward -293 -277 -17.346 0.253
NP_440629.1_6 Forward -352 -333 12.4078 0.289
NP_440760.1_1 Reverse -381 -400 -23.305 0.293
NP_442797.1_6 Forward -365 -346 11.1337 0.238
NP_442489.1_7 Reverse -337 -346 -1.6719 0.235
NP_442079.1_7 Reverse -255 -274 -0.0988766 0.29
NP_442763.1_8 Forward -208 -189 7.17762 0.159
NP_441659.2_8 Forward -257 -247 0.176696 0.271
NP_439956.1_7 Reverse -221 -240 3.53937 0.257
NP_442346.1_5 Reverse -336 -346 9.41981 0.118
NP_442346.1_5 Forward -347 -337 7.35486 0.172
NP_442346.1_5 Reverse -60 -70 6.76487 0.192
NP_440545.1_3 Reverse -333 -350 -6.35267 0.276
NP_440486.1_6 Forward -359 -340 6.98095 0.278
NP_440847.1_3 Reverse -184 -198 11.4053 0.263
NP_442603.1_7 Forward -70 -56 7.47213 0.205
NP_442199.1_7 Forward -283 -264 1.6703 0.271
NP_441692.1_2 Forward -55 -36 6.19431 0.139
NP_441671.1_10 Reverse -347 -366 12.9791 0.137
NP_440875.1_2 Reverse -261 -280 7.66927 0.21
NP_441892.1_1 Reverse -349 -366 -2.61609 0.224
NP_442643.1_5 Reverse -325 -344 -5.60541 0.293
NP_440833.1_6 Reverse -119 -133 8.06211 0.277
NP_441526.1_7 Reverse -20 -39 14.0608 0.298
NP_441249.1_8 Reverse -337 -356 0.58944 0.294
NP_442402.1_4 Forward -212 -193 -7.76943 0.278
NP_441848.1_4 Forward -116 -100 7.1687 0.295
NP_441084.1_6 Reverse -78 -92 9.34412 0.287
NP_440825.1_6 Forward -392 -373 11.7008 0.277
NP_442360.1_5 Forward -308 -298 15.0247 0.172
NP_441701.1_3 Reverse -256 -273 7.61033 0.259
NP_441252.1_6 Forward -385 -378 14.3954 0.168
NP_441576.1_10 Reverse -99 -118 13.8641 0.234
NP_440914.1_1 Forward -70 -60 12.0308 0.0684
NP_442533.1_1 Reverse -334 -353 -17.3068 0.285
NP_442533.1_6 Forward -346 -337 5.11294 0.155
NP_442533.1_6 Reverse -337 -346 3.83464 0.202
NP_440854.1_2 Forward -59 -40 11.2092 0.26
NP_441219.1_6 Reverse -348 -366 11.1305 0.225
NP_441527.1_4 Reverse -352 -371 -9.88384 0.262
NP_440429.1_2 Forward -366 -347 9.0459 0.272
NP_439903.1_6 Forward -278 -259 8.16011 0.143
NP_441930.1_2 Reverse -265 -275 16.008 0.19
NP_440828.1_4 Forward -290 -271 0.588665 0.181
NP_442072.1_9 Forward -317 -299 -23.482 0.297
NP_441808.1_8 Reverse -337 -356 5.70265 0.298
NP_441463.1_6 Reverse -263 -277 9.12168 0.25
NP_442061.1_5 Forward -44 -26 16.0508 0.293
NP_442211.1_3 Reverse -254 -273 7.18021 0.288
NP_442362.1_7 Reverse -319 -337 20.2753 0.148
NP_441460.1_5 Forward -167 -153 15.0436 0.251
NP_442794.1_1 Reverse -57 -69 6.52882 0.172
NP_441401.1_4 Forward -117 -104 14.6706 0.215
NP_441962.1_9 Reverse -301 -320 8.45592 0.258
NP_441836.1_2 Reverse -346 -365 -2.75381 0.231
NP_441193.1_6 Forward -42 -23 2.55606 0.257
NP_440143.1_1 Reverse -349 -368 15.0441 0.246
NP_442323.1_7 Forward -280 -261 5.2102 0.207
NP_440293.1_9 Forward -372 -358 11.4409 0.257
NP_440766.1_5 Reverse -237 -249 8.03776 0.286
NP_440766.1_5 Forward -124 -112 6.89186 0.291
NP_440422.1_10 Reverse -97 -116 4.20826 0.296
NP_442743.1_1 Forward -341 -322 8.06178 0.264
NP_440524.1_2 Forward -88 -69 -5.40875 0.294
NP_442703.1_6 Reverse -98 -117 15.8035 0.267
NP_441173.1_9 Forward -355 -347 11.0321 0.228
NP_443000.1_7 Forward -348 -338 1.94665 0.226
NP_441842.1_7 Reverse -377 -396 10.2251 0.261
NP_440091.1_1 Forward -74 -62 0.23564 0.259
NP_440880.1_2 Forward -49 -30 15.708 0.263
NP_440216.1_9 Reverse -261 -270 11.7011 0.254
NP_440216.1_9 Reverse -359 -368 8.65285 0.286
NP_440216.1_9 Reverse -360 -369 7.27622 0.286
NP_440216.1_9 Forward -239 -230 5.89959 0.289
NP_440172.1_1 Reverse -337 -347 2.14332 0.283
NP_440244.1_1 Reverse -348 -367 -0.295539 0.187
NP_441766.1_9 Reverse -272 -291 6.58763 0.18
NP_443052.1_8 Reverse -327 -346 -4.91709 0.124
NP_442154.1_1 Reverse -335 -353 -5.09406 0.127
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACGCTGTTGGGCCAATTGGGCAATTAATTCATTTTCCCTGGCCTCTTCCACCAAGGTCATCACCCCTTTATCAATGCCTAGGCTGGCCAACTGCTCTGGGGTAACCTCAAATTCCATATCCACCAGGGCATTTCCCATGCCATAGACATCGTATTTGTGACCCATTGCAACCTCACGGATTCCACTTTATAACGAATGTTATCCTAGGGCAGAATGGCTTGACTGACAATGGTTAGATTAATTTACCGGATGGAAACGACGTTTATTATGGTCAGTTTGCGCCAAAATAATAGCAATATCACTGCTTAATTAGCACTGGCATTAATTAGTAGCGATGACGAGAGGATTGCTAAAATAAACAATAGTTAATCGAGGTTTGAGTGTAATTTTTGGTGACAAT

CDS

ATGCCCACATCTATGTCGGAATGGAATCAATTTTTAGCCTATTTTCCCCTCGATAAAGCCAATTGGAATTTCAAAGCTTCTCAAAATTTAACTGCCCCTTTAATTTTGTACTATTCTGGTGTCCTTGCTGCCACTCCTAACCTAAGGCATTTACTGTTAGTTTCCCAGCTTAAGGGCACAGATACGGAAAGTTTTGGCAACCAGTCCATGCCCAGACCGAAAATGTTTGATCATCATGCTAGTCACGATTTCACGATGCTCTATGCCCAGGGCTCTGCGCCCCAACGGCGGGATTTATTGTTTCACTTTCAAATTAGTGGTTCTGATATTACAGCCAAGCAATTAGCCTATTTCTTGGTGGAAGCCTGTAGCAAAGCCAAAGATGAGGACCATGTTTACCTAGGCGATCGCCGCCACCGTAATTTCTGGGCCGATCTGGGCCGGACCAAATTGAGCCAATTGAATGTGGATTCTCGCATTTGGGAAGATGAGCAATCCTTGCAAATTATTTGA

Protein

MPTSMSEWNQFLAYFPLDKANWNFKASQNLTAPLILYYSGVLAATPNLRHLLLVSQLKGTDTESFGNQSMPRPKMFDHHASHDFTMLYAQGSAPQRRDLLFHFQISGSDITAKQLAYFLVEACSKAKDEDHVYLGDRRHRNFWADLGRTKLSQLNVDSRIWEDEQSLQII