Your browser is old and dusty. Try Google Chrome!

Details for sll0504

ORF sll0504
Accession NP_442760.1
Symbol lysA
Category Branched chain family
Definition diaminopimelate decarboxylase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -318 -304 5.60446 0.132
NP_441061.1_2 Reverse -341 -355 0.687908 0.202
NP_441418.1_6 Reverse -340 -359 -19.2734 0.0867
NP_441418.1_6 Forward -78 -59 -24.0916 0.199
NP_441418.1_6 Forward -349 -330 -28.5165 0.205
NP_441453.1_4 Reverse -340 -348 14.8674 0.00947
NP_441453.1_4 Forward -349 -341 6.80426 0.121
NP_442151.1_1 Reverse -34 -53 3.24438 0.291
NP_440259.1_4 Reverse -140 -154 13.9382 0.217
NP_440996.1_2 Forward -211 -202 15.241 0.248
NP_442173.1_1 Forward -348 -340 13.8841 0.0225
NP_442173.1_1 Reverse -341 -349 12.0158 0.0316
NP_442752.1_4 Forward -349 -342 13.8055 0.0199
NP_442752.1_4 Reverse -379 -386 7.90559 0.144
NP_440613.1_8 Forward -100 -81 14.7491 0.207
NP_440784.1_7 Forward -348 -341 6.23397 0.241
NP_440784.1_7 Reverse -341 -348 6.13563 0.241
NP_440061.1_9 Reverse -279 -293 6.39049 0.248
NP_440878.1_9 Reverse -145 -164 -0.787193 0.221
NP_442062.1_8 Forward -349 -339 7.94484 0.0848
NP_442062.1_8 Reverse -340 -350 5.09324 0.184
NP_441859.1_2 Forward -318 -299 10.3234 0.27
NP_441859.1_3 Forward -350 -331 4.03023 0.228
NP_441859.1_3 Forward -142 -123 1.08032 0.296
NP_440304.1_4 Reverse -383 -393 2.33998 0.299
NP_440044.1_8 Reverse -341 -360 4.03102 0.121
NP_441200.1_4 Reverse -163 -182 5.50599 0.294
NP_441594.1_6 Forward -370 -351 4.42435 0.221
NP_442742.1_9 Reverse -243 -262 -10.7186 0.269
NP_442110.1_7 Reverse -304 -318 3.44117 0.21
NP_442110.1_7 Forward -85 -71 2.35953 0.222
NP_442110.1_7 Forward -361 -347 0.982901 0.241
NP_442726.1_4 Forward -278 -259 3.73603 0.285
NP_441925.1_2 Reverse -203 -222 1.57275 0.278
NP_440856.1_7 Forward -364 -345 -5.01543 0.224
NP_441083.1_5 Reverse -340 -350 9.81313 0.0224
NP_441083.1_5 Forward -349 -339 6.96153 0.0717
NP_441738.1_2 Reverse -342 -349 15.28 0.0102
NP_441738.1_2 Forward -13 -6 8.29857 0.176
NP_440209.1_1 Forward -349 -341 8.57422 0.0425
NP_442889.1_8 Reverse -337 -351 5.99717 0.207
NP_442570.1_3 Forward -87 -68 -5.31042 0.242
NP_441792.1_1 Forward -395 -376 4.71934 0.286
NP_442111.1_4 Reverse -339 -353 7.37441 0.0975
NP_440906.1_5 Forward -348 -341 6.23397 0.234
NP_440906.1_5 Reverse -341 -348 6.13563 0.241
NP_441924.1_5 Forward -297 -278 11.7008 0.258
NP_440747.1_10 Forward -352 -340 5.15219 0.0179
NP_441486.1_1 Forward -352 -338 6.6861 0.0344
NP_441486.1_1 Reverse -337 -351 -4.91696 0.213
NP_442330.1_4 Forward -315 -296 15.2389 0.263
NP_442634.1_4 Reverse -302 -316 -2.36035 0.149
NP_440470.1_5 Reverse -85 -104 5.87233 0.291
NP_443018.1_3 Reverse -341 -348 11.7405 0.0655
NP_443018.1_3 Forward -348 -341 5.44732 0.193
NP_440376.1_1 Forward -349 -340 5.89959 0.116
NP_440376.1_1 Reverse -340 -349 -0.0986038 0.285
NP_441588.1_4 Reverse -342 -352 9.02648 0.14
NP_442687.1_7 Forward -350 -340 5.68323 0.189
NP_441077.1_7 Reverse -135 -154 12.3892 0.285
NP_440642.1_10 Forward -81 -67 8.75042 0.198
NP_440642.1_10 Forward -395 -381 1.96562 0.284
NP_441013.1_2 Reverse -270 -288 5.82068 0.208
NP_442296.1_5 Forward -305 -286 1.27776 0.286
NP_440617.1_3 Forward -396 -377 5.80098 0.228
NP_441855.2_4 Reverse -332 -351 17.5248 0.0563
NP_442937.1_5 Forward -354 -335 8.75091 0.212
NP_441958.1_5 Forward -350 -340 8.73149 0.0255
NP_441958.1_5 Reverse -339 -349 0.963343 0.12
NP_440203.1_5 Reverse -343 -353 14.2375 0.0886
NP_440203.1_5 Forward -12 -2 9.12434 0.271
NP_442816.1_7 Reverse -190 -209 4.05798 0.281
NP_442690.1_1 Reverse -200 -219 -7.17871 0.174
NP_441429.1_4 Reverse -68 -87 8.16011 0.269
NP_441646.1_1 Forward -85 -66 -0.197208 0.259
NP_442885.1_5 Forward -398 -379 13.5683 0.279
NP_440147.1_4 Forward -351 -338 7.88576 0.0598
NP_440147.1_4 Reverse -338 -351 1.39592 0.23
NP_441550.1_8 Forward -351 -341 13.3526 0.0252
NP_441550.1_8 Reverse -338 -348 11.8776 0.0415
NP_441916.1_7 Forward -349 -339 5.09324 0.146
NP_441916.1_7 Reverse -340 -350 1.35667 0.286
NP_441916.1_10 Reverse -68 -87 4.42435 0.223
NP_441916.1_10 Reverse -67 -86 4.22769 0.223
NP_441041.1_4 Reverse -340 -359 -3.04881 0.119
NP_442941.1_3 Reverse -341 -351 1.25834 0.15
NP_440983.1_9 Forward -288 -269 3.24438 0.285
NP_440260.1_8 Forward -358 -340 -5.29072 0.273
NP_442281.1_1 Reverse -335 -349 11.897 0.0428
NP_442281.1_1 Forward -354 -340 4.8172 0.18
NP_442575.1_8 Reverse -373 -392 -0.688862 0.232
NP_442012.1_1 Forward -355 -336 11.5042 0.0742
NP_442012.1_6 Reverse -370 -389 13.4708 0.284
NP_442049.1_6 Forward -357 -338 5.80098 0.231
NP_441644.1_6 Reverse -340 -350 14.7292 0.0105
NP_442501.1_2 Reverse -287 -306 -2.75381 0.255
NP_442215.1_2 Forward -390 -374 -2.5964 0.201
NP_442247.1_8 Forward -351 -337 9.5377 0.247
NP_440929.1_8 Reverse -340 -349 7.17789 0.0713
NP_442933.1_10 Reverse -340 -349 8.06287 0.0885
NP_442933.1_10 Forward -349 -340 7.96454 0.0937
NP_442554.1_8 Reverse -46 -56 6.56821 0.112
NP_442554.1_8 Reverse -341 -351 5.48657 0.146
NP_442554.1_8 Forward -348 -338 2.24165 0.276
NP_441762.1_7 Reverse -339 -351 0.923956 0.0747
NP_442292.1_1 Reverse -341 -350 8.65285 0.0335
NP_441024.1_1 Forward -349 -335 19.2725 0.224
NP_443009.1_5 Forward -350 -339 4.97473 0.222
NP_440947.1_8 Reverse -273 -292 23.9922 0.0113
NP_441448.1_1 Reverse -347 -366 8.06259 0.21
NP_441448.1_1 Forward -366 -347 5.80098 0.261
NP_441448.1_1 Reverse -299 -318 3.53937 0.296
NP_442076.1_5 Reverse -378 -397 7.57094 0.256
NP_440183.1_9 Forward -52 -33 -18.8801 0.276
NP_441468.1_1 Forward -348 -341 6.13563 0.209
NP_441468.1_1 Reverse -341 -348 6.0373 0.223
NP_441020.2_6 Forward -351 -334 10.2653 0.149
NP_441015.1_10 Forward -289 -270 2.55606 0.15
NP_441015.1_10 Reverse -168 -187 -0.39387 0.169
NP_441673.1_1 Forward -349 -340 1.27803 0.155
NP_441673.1_1 Reverse -340 -349 1.27803 0.155
NP_441731.1_3 Forward -357 -338 5.40766 0.159
NP_441096.1_5 Forward -189 -171 15.653 0.297
NP_441876.1_9 Reverse -295 -305 12.0743 0.267
NP_441876.1_9 Reverse -285 -295 11.7793 0.273
NP_441826.1_5 Forward -289 -270 13.8641 0.115
NP_441826.1_5 Reverse -361 -380 0.786102 0.3
NP_441330.1_8 Reverse -275 -294 10.4225 0.276
NP_441637.1_9 Reverse -324 -342 -0.374176 0.292
NP_441764.1_8 Reverse -21 -31 11.5021 0.284
NP_442868.1_6 Forward -351 -341 0.0783647 0.248
NP_441251.1_7 Reverse -193 -206 16.0472 0.266
NP_441612.1_2 Forward -290 -280 7.58116 0.25
NP_442361.1_3 Forward -355 -342 15.8506 0.0811
NP_441911.1_10 Forward -157 -138 10.2943 0.226
NP_442050.1_1 Forward -310 -291 8.45592 0.25
NP_440558.1_2 Forward -293 -274 -1.18052 0.211
NP_440558.1_2 Forward -391 -372 -1.67217 0.217
NP_441878.1_6 Forward -291 -281 1.06167 0.116
NP_441878.1_6 Reverse -339 -349 0.668351 0.139
NP_441878.1_6 Reverse -378 -388 -7.78811 0.266
NP_442650.1_2 Reverse -304 -318 3.04785 0.225
NP_441557.1_5 Forward -349 -340 8.94785 0.0289
NP_441557.1_5 Reverse -340 -349 0.688044 0.128
NP_441445.1_1 Forward -358 -339 -0.4922 0.294
NP_440101.1_3 Forward -366 -347 3.24438 0.235
NP_442183.1_1 Reverse -45 -59 4.42448 0.261
NP_441574.1_1 Forward -361 -342 -7.67036 0.293
NP_442347.1_2 Reverse -341 -350 10.3245 0.058
NP_442347.1_2 Reverse -247 -256 5.70292 0.226
NP_442965.1_2 Forward -307 -288 3.24438 0.168
NP_440136.1_2 Forward -348 -341 6.23397 0.171
NP_440136.1_2 Reverse -341 -348 6.13563 0.193
NP_442590.1_9 Forward -365 -346 12.3892 0.223
NP_442998.1_10 Reverse -342 -349 15.5754 0.0102
NP_440299.1_1 Forward -353 -340 12.9 0.0333
NP_440299.1_1 Forward -174 -161 11.6217 0.0469
NP_440299.1_1 Reverse -336 -349 6.41022 0.143
NP_441799.1_1 Reverse -41 -55 5.89884 0.19
NP_441799.1_1 Reverse -228 -242 5.40719 0.21
NP_440256.1_1 Forward -352 -333 0.982764 0.0791
NP_441559.1_8 Forward -368 -354 -6.09693 0.274
NP_440915.1_6 Forward -353 -339 2.06454 0.126
NP_441296.1_8 Forward -354 -335 15.7324 0.258
NP_441464.1_10 Forward -87 -73 10.521 0.254
NP_440026.1_1 Forward -71 -52 14.2574 0.262
NP_440695.1_5 Forward -349 -330 0.58944 0.284
NP_442386.1_10 Forward -309 -296 5.42749 0.262
NP_440570.1_5 Reverse -271 -290 -4.03212 0.299
NP_441340.1_5 Forward -348 -341 13.5105 0.0314
NP_441340.1_5 Reverse -341 -348 5.84064 0.208
NP_441340.1_9 Forward -213 -203 9.12288 0.236
NP_440186.1_6 Forward -157 -138 17.994 0.113
NP_442484.1_2 Forward -360 -341 1.47442 0.233
NP_442484.1_2 Reverse -270 -289 0.491109 0.247
NP_441254.1_1 Forward -18 -5 20.6681 0.0504
NP_442950.1_1 Reverse -176 -195 1.0811 0.206
NP_441160.1_1 Forward -306 -287 -9.44032 0.254
NP_440586.1_8 Reverse -341 -348 9.47853 0.146
NP_440586.1_8 Forward -348 -341 5.74197 0.283
NP_440192.1_4 Forward -312 -293 11.144 0.218
NP_441262.1_3 Forward -349 -342 14.7888 0.0223
NP_440027.1_8 Reverse -300 -319 5.30853 0.28
NP_443051.1_1 Forward -350 -341 7.47288 0.0571
NP_443051.1_1 Reverse -339 -348 -1.08191 0.281
NP_439937.1_9 Reverse -288 -305 -13.0398 0.279
NP_443039.1_7 Forward -15 -1 4.32555 0.266
NP_440439.1_1 Forward -352 -339 0.707601 0.179
NP_442239.1_8 Forward -376 -357 5.211 0.281
NP_439943.1_1 Forward -78 -59 -8.06369 0.263
NP_439943.1_4 Reverse -161 -180 5.30933 0.287
NP_440372.1_2 Forward -348 -341 13.8055 0.0214
NP_440372.1_2 Reverse -341 -348 6.52896 0.188
NP_440819.1_5 Forward -213 -205 8.08256 0.185
NP_440316.1_10 Forward -319 -309 5.78156 0.281
NP_439977.1_5 Forward -394 -375 -2.55715 0.284
NP_442384.1_10 Reverse -340 -353 13.7856 0.0186
NP_442384.1_10 Forward -241 -228 0.510939 0.289
NP_442114.1_8 Forward -156 -142 3.73557 0.281
NP_441018.1_7 Forward -89 -70 12.6841 0.154
NP_441018.1_7 Forward -88 -69 12.1925 0.167
NP_441018.1_7 Reverse -151 -170 6.19431 0.297
NP_442790.1_4 Forward -358 -339 -15.2418 0.289
NP_442262.1_10 Reverse -341 -348 13.2155 0.0213
NP_440344.1_10 Reverse -333 -350 -3.00942 0.0772
NP_442910.1_1 Forward -356 -337 10.3242 0.0765
NP_440826.1_3 Reverse -330 -349 16.0274 0.298
NP_441965.1_10 Forward -141 -125 4.58176 0.237
NP_440350.1_5 Reverse -205 -224 6.4893 0.134
NP_440350.1_5 Reverse -139 -158 -4.22878 0.273
NP_440350.1_5 Reverse -189 -208 -6.1954 0.296
NP_442280.1_10 Reverse -271 -289 6.13623 0.28
NP_440600.1_4 Reverse -332 -350 -0.374176 0.151
NP_440179.1_6 Forward -53 -34 11.3075 0.182
NP_442277.1_2 Forward -395 -381 13.0776 0.244
NP_441949.1_5 Forward -31 -12 11.0656 0.274
NP_441543.1_2 Reverse -341 -350 7.07956 0.131
NP_441543.1_5 Forward -356 -337 3.34271 0.2
NP_442845.1_2 Reverse -378 -392 6.48943 0.209
NP_442845.1_2 Forward -355 -341 4.32615 0.261
NP_441304.1_10 Reverse -4 -13 14.651 0.164
NP_442315.1_2 Forward -89 -77 8.59377 0.293
NP_443064.1_6 Forward -349 -339 9.07643 0.247
NP_442578.1_7 Forward -348 -341 6.0373 0.18
NP_441462.1_2 Forward -349 -339 17.3846 0.00406
NP_441601.1_4 Reverse -273 -292 -5.21209 0.293
NP_442204.1_1 Forward -353 -342 8.7118 0.0852
NP_442204.1_1 Reverse -169 -180 4.87689 0.231
NP_441560.1_3 Forward -289 -271 5.03403 0.298
NP_440516.1_6 Reverse -281 -295 7.57046 0.27
NP_440516.1_8 Forward -349 -340 9.4395 0.0183
NP_440516.1_8 Reverse -340 -349 5.11294 0.118
NP_440128.1_10 Forward -285 -266 13.6675 0.282
NP_442428.1_5 Forward -348 -341 6.13563 0.209
NP_442428.1_5 Reverse -341 -348 6.0373 0.212
NP_440618.1_1 Reverse -51 -70 -2.85214 0.196
NP_441867.1_2 Forward -130 -111 -13.3736 0.277
NP_440673.1_3 Reverse -342 -349 12.4288 0.0426
NP_440673.1_3 Forward -392 -385 6.23397 0.283
NP_443048.1_4 Reverse -343 -362 16.6147 0.205
NP_441052.1_2 Forward -241 -231 2.33998 0.209
NP_441052.1_2 Reverse -340 -350 1.65166 0.233
NP_441052.1_2 Forward -290 -280 0.963343 0.255
NP_442219.1_8 Forward -359 -340 9.03681 0.234
NP_442219.1_9 Reverse -341 -350 7.96454 0.0696
NP_440436.1_4 Reverse -341 -350 7.57079 0.124
NP_440436.1_4 Forward -348 -339 5.11253 0.222
NP_441884.1_9 Reverse -337 -356 -25.4683 0.29
NP_442907.1_7 Reverse -215 -234 15.1424 0.192
NP_441719.1_4 Forward -348 -341 6.82395 0.0855
NP_441719.1_4 Reverse -341 -348 6.52896 0.188
NP_441733.1_10 Forward -352 -339 5.32916 0.218
NP_441004.1_1 Reverse -373 -392 -10.1286 0.218
NP_441004.1_1 Reverse -155 -174 -10.1286 0.218
NP_441004.1_1 Forward -289 -270 -16.0285 0.281
NP_441004.1_5 Reverse -219 -233 11.406 0.241
NP_442813.1_4 Reverse -140 -159 4.22769 0.197
NP_442366.1_3 Reverse -339 -357 3.95239 0.102
NP_442366.1_5 Forward -352 -342 14.0409 0.0497
NP_442206.1_10 Reverse -340 -355 1.35653 0.233
NP_442206.1_10 Forward -349 -334 1.06154 0.238
NP_441851.1_10 Forward -350 -340 7.35486 0.142
NP_442208.1_5 Forward -315 -296 -6.78538 0.269
NP_442208.1_5 Reverse -55 -74 -8.45701 0.275
NP_442515.1_1 Reverse -384 -398 -4.52363 0.298
NP_440593.1_3 Forward -393 -374 9.63589 0.107
NP_440338.1_4 Reverse -79 -98 5.80018 0.293
NP_442843.1_1 Forward -289 -270 -8.35868 0.255
NP_440726.1_2 Reverse -342 -361 -0.885524 0.296
NP_440588.1_2 Reverse -223 -242 1.86774 0.127
NP_442335.1_7 Reverse -276 -290 12.3887 0.27
NP_442006.1_2 Forward -307 -290 -19.0374 0.297
NP_441003.1_9 Reverse -271 -290 5.40766 0.264
NP_442243.1_1 Forward -394 -376 1.49337 0.214
NP_441570.1_1 Reverse -340 -358 -11.6822 0.201
NP_441078.1_4 Reverse -340 -349 0.0980582 0.205
NP_441078.1_4 Forward -349 -340 0.0980582 0.205
NP_442729.1_5 Reverse -345 -355 16.303 0.19
NP_442348.1_2 Reverse -6 -15 17.011 0.055
NP_442443.1_1 Forward -279 -260 -0.0988766 0.222
NP_440793.1_1 Forward -82 -68 9.34041 0.293
NP_440526.1_3 Forward -140 -129 5.46638 0.247
NP_441432.1_8 Forward -350 -341 14.0611 0.0258
NP_441432.1_9 Reverse -140 -153 12.0888 0.221
NP_440497.1_2 Reverse -341 -360 3.93269 0.293
NP_442815.1_2 Reverse -374 -392 3.16574 0.277
NP_439900.1_4 Forward -392 -378 13.7653 0.236
NP_440713.1_4 Forward -359 -340 3.44104 0.244
NP_442489.1_7 Reverse -340 -349 0.786375 0.152
NP_442489.1_7 Forward -349 -340 0.589713 0.17
NP_440559.1_1 Forward -348 -339 14.651 0.0144
NP_440559.1_1 Reverse -341 -350 7.76787 0.0918
NP_441659.2_8 Reverse -340 -350 12.7631 0.0147
NP_441659.2_8 Forward -349 -339 0.176696 0.271
NP_441968.1_1 Forward -213 -205 14.1787 0.286
NP_441800.1_3 Forward -393 -375 3.75572 0.289
NP_442346.1_5 Forward -350 -340 7.05986 0.183
NP_442346.1_5 Reverse -339 -349 5.97822 0.219
NP_440545.1_3 Reverse -300 -317 -6.84433 0.289
NP_440545.1_8 Reverse -354 -373 19.2723 0.0751
NP_440010.1_10 Forward -361 -342 1.86774 0.292
NP_442603.1_7 Forward -349 -335 5.70218 0.277
NP_441233.1_1 Forward -348 -329 2.94938 0.28
NP_441233.1_10 Forward -308 -291 21.2783 0.139
NP_441585.1_5 Forward -383 -364 0.490334 0.291
NP_441833.1_4 Reverse -341 -348 6.52896 0.0924
NP_441833.1_4 Forward -348 -341 6.23397 0.163
NP_441329.1_6 Forward -156 -137 6.34979 0.182
NP_441329.1_6 Forward -154 -135 2.62561 0.225
NP_442162.1_9 Forward -348 -341 12.9205 0.0282
NP_442162.1_9 Reverse -341 -348 12.9205 0.0282
NP_442199.1_5 Forward -62 -43 -6.58872 0.277
NP_442140.1_3 Reverse -341 -351 10.2065 0.0902
NP_442140.1_3 Forward -348 -338 4.0116 0.265
NP_441813.1_5 Reverse -338 -348 4.89658 0.143
NP_440594.1_5 Forward -330 -311 3.83357 0.293
NP_439901.1_1 Forward -326 -307 3.14605 0.269
NP_440590.1_4 Reverse -341 -354 -5.78224 0.289
NP_440567.1_1 Reverse -341 -355 1.57289 0.2
NP_440567.1_1 Forward -348 -334 0.786239 0.232
NP_442497.1_10 Forward -348 -339 8.25953 0.047
NP_442497.1_10 Reverse -341 -350 0.589713 0.153
NP_440821.1_4 Forward -351 -341 -0.314959 0.251
NP_441239.1_9 Reverse -338 -350 7.90546 0.147
NP_441239.1_9 Forward -56 -44 7.02048 0.173
NP_441727.1_3 Reverse -333 -352 8.65258 0.202
NP_441892.1_1 Reverse -370 -387 -5.1727 0.275
NP_441892.1_1 Forward -358 -341 -5.76269 0.288
NP_441541.1_1 Forward -30 -12 2.48478 0.197
NP_441541.1_1 Forward -29 -11 -3.91318 0.27
NP_440546.1_4 Forward -349 -339 15.4756 0.0459
NP_440546.1_4 Reverse -340 -350 8.20381 0.199
NP_440546.1_7 Reverse -298 -308 14.238 0.279
NP_441656.1_6 Reverse -274 -293 6.58763 0.255
NP_441184.1_3 Reverse -301 -320 7.57094 0.231
NP_442340.1_3 Reverse -291 -310 -5.99873 0.223
NP_442340.1_3 Forward -392 -373 -7.57203 0.236
NP_442611.1_1 Reverse -168 -187 -3.24547 0.3
NP_440868.1_4 Forward -353 -341 3.57889 0.134
NP_442402.1_1 Reverse -285 -304 18.7807 0.0691
NP_442402.1_2 Reverse -290 -304 15.6336 0.263
NP_442402.1_4 Reverse -285 -304 -0.39464 0.189
NP_442402.1_6 Forward -305 -296 13.1761 0.289
NP_442402.1_10 Reverse -293 -303 10.4026 0.29
NP_441848.1_4 Reverse -15 -31 11.2749 0.228
NP_441848.1_4 Reverse -97 -113 8.69657 0.288
NP_441848.1_4 Forward -203 -187 7.45517 0.288
NP_442039.1_4 Forward -348 -341 11.6422 0.0747
NP_441811.1_8 Reverse -373 -387 5.70279 0.293
NP_442679.1_1 Forward -160 -141 6.4893 0.147
NP_442829.1_2 Forward -221 -205 8.04446 0.287
NP_440825.1_7 Reverse -341 -351 10.9578 0.278
NP_442837.1_3 Forward -348 -341 6.0373 0.25
NP_442837.1_3 Reverse -341 -348 6.0373 0.25
NP_440160.1_2 Forward -302 -283 -1.67217 0.243
NP_442053.1_1 Reverse -340 -349 7.17789 0.104
NP_440505.1_3 Forward -351 -341 7.64985 0.151
NP_441408.2_7 Forward -292 -273 -4.03212 0.279
NP_440914.1_1 Reverse -340 -350 14.373 0.0158
NP_441011.1_8 Forward -348 -339 12.0944 0.0517
NP_441011.1_8 Forward -240 -231 5.3096 0.271
NP_442533.1_1 Reverse -161 -180 -17.0118 0.279
NP_442533.1_6 Forward -349 -340 5.40793 0.14
NP_442533.1_6 Reverse -340 -349 4.52295 0.179
NP_442541.1_10 Reverse -298 -312 0.982316 0.292
NP_442229.1_1 Forward -56 -42 6.88214 0.202
NP_441482.1_7 Reverse -334 -348 -4.7203 0.156
NP_441482.1_7 Forward -355 -341 -10.7185 0.213
NP_441482.1_7 Reverse -373 -387 -11.0135 0.229
NP_441482.1_7 Forward -319 -305 -11.4068 0.262
NP_441697.1_5 Forward -34 -15 -9.78835 0.274
NP_441697.1_5 Forward -106 -87 -10.0748 0.278
NP_441028.1_6 Reverse -294 -304 12.9592 0.166
NP_441028.1_6 Forward -75 -65 6.37109 0.23
NP_441028.1_6 Reverse -206 -216 4.89613 0.275
NP_441028.1_6 Forward -74 -64 4.10949 0.278
NP_442664.1_3 Forward -380 -366 10.521 0.288
NP_440116.1_5 Forward -352 -335 15.5751 0.0544
NP_440116.1_8 Forward -348 -329 -4.42544 0.171
NP_441527.1_4 Forward -156 -137 -3.48588 0.167
NP_441527.1_4 Forward -152 -133 -5.10924 0.195
NP_441527.1_4 Forward -153 -134 -8.26048 0.242
NP_441527.1_4 Forward -221 -202 -10.0748 0.264
NP_441527.1_4 Forward -154 -135 -10.2658 0.268
NP_440115.1_6 Forward -352 -342 9.32148 0.115
NP_440007.1_9 Reverse -300 -314 1.76955 0.285
NP_441680.1_4 Forward -317 -298 4.12936 0.213
NP_441680.1_4 Reverse -55 -74 -1.08219 0.256
NP_441972.1_5 Reverse -341 -360 -5.01543 0.213
NP_441972.1_5 Forward -387 -368 -7.67036 0.252
NP_440429.1_9 Reverse -363 -382 7.7676 0.211
NP_442249.1_5 Reverse -272 -291 10.2259 0.19
NP_440480.1_10 Forward -222 -208 14.2569 0.295
NP_001035870.1_5 Forward -398 -379 15.6332 0.214
NP_441286.1_1 Forward -350 -338 -3.20594 0.145
NP_442674.1_3 Reverse -371 -390 3.04693 0.296
NP_440670.1_8 Forward -349 -340 8.65285 0.0627
NP_440670.1_8 Reverse -340 -349 6.29291 0.124
NP_441479.1_9 Reverse -249 -267 15.3588 0.271
NP_441705.1_3 Reverse -54 -73 2.75272 0.23
NP_440513.1_4 Reverse -300 -319 9.93088 0.276
NP_440907.2_8 Reverse -341 -351 5.87944 0.184
NP_440907.2_8 Forward -348 -338 3.8145 0.297
NP_441021.1_1 Forward -393 -374 -10.6203 0.242
NP_441626.1_2 Forward -348 -341 12.2322 0.0511
NP_441626.1_2 Reverse -341 -348 5.93897 0.231
NP_442365.1_5 Forward -348 -329 7.07928 0.257
NP_442794.1_1 Forward -353 -341 12.232 0.0721
NP_441962.1_4 Forward -363 -344 -10.0303 0.223
NP_440387.1_1 Reverse -340 -356 -6.23465 0.273
NP_441431.1_2 Reverse -306 -320 9.34041 0.19
NP_441431.1_2 Forward -352 -338 5.70218 0.291
NP_442647.1_7 Reverse -270 -283 5.72248 0.257
NP_441993.1_1 Forward -290 -271 0.972113 0.288
NP_442224.1_1 Reverse -338 -357 18.584 0.0573
NP_441425.1_4 Forward -214 -200 16.8142 0.282
NP_442698.1_5 Reverse -191 -205 20.1574 0.233
NP_441510.2_7 Forward -355 -341 10.3237 0.28
NP_440293.1_3 Reverse -371 -390 -3.83545 0.254
NP_440766.1_4 Forward -353 -339 10.0294 0.0871
NP_442743.1_5 Reverse -341 -360 4.22769 0.226
NP_442930.1_1 Forward -32 -22 10.5993 0.276
NP_440457.1_1 Forward -353 -341 1.80894 0.223
NP_441801.1_4 Reverse -295 -305 2.83163 0.231
NP_440801.1_8 Reverse -339 -358 10.8159 0.134
NP_442509.1_9 Forward -299 -289 6.86274 0.248
NP_442439.1_8 Reverse -160 -179 8.45592 0.253
NP_442514.1_5 Reverse -332 -351 -2.06626 0.214
NP_442514.1_5 Forward -394 -375 -5.70449 0.261
NP_441885.1_5 Forward -349 -339 7.84651 0.0419
NP_441885.1_5 Reverse -340 -350 1.35667 0.11
NP_442703.1_9 Forward -262 -244 5.23069 0.244
NP_442341.1_7 Reverse -339 -353 4.12949 0.2
NP_442341.1_7 Forward -350 -336 2.85119 0.243
NP_441756.1_5 Reverse -271 -290 -4.72043 0.295
NP_441173.1_9 Forward -322 -314 12.1137 0.21
NP_441173.1_9 Reverse -295 -303 12.0154 0.214
NP_440423.1_6 Forward -318 -299 -19.9617 0.248
NP_440423.1_10 Reverse -122 -141 8.55425 0.289
NP_443000.1_7 Forward -351 -341 0.57002 0.294
NP_440507.2_3 Forward -397 -378 8.75009 0.244
NP_441842.1_1 Forward -52 -39 12.2117 0.222
NP_441842.1_10 Forward -356 -342 6.09611 0.299
NP_440275.1_3 Forward -351 -341 5.48657 0.145
NP_443010.1_10 Forward -144 -127 2.09436 0.283
NP_442451.1_2 Reverse -273 -292 -8.26035 0.244
NP_441122.1_1 Forward -353 -338 2.73316 0.298
NP_439962.1_4 Reverse -52 -71 -4.72043 0.272
NP_440175.1_4 Forward -292 -273 -13.0786 0.239
NP_440216.1_9 Reverse -386 -395 8.75118 0.286
NP_440172.1_1 Forward -349 -339 8.82982 0.0586
NP_440172.1_1 Reverse -340 -350 2.33998 0.279
NP_442371.1_1 Forward -213 -203 14.3359 0.191
NP_442015.1_10 Reverse -336 -349 2.57589 0.19
NP_442015.1_10 Forward -353 -340 0.510939 0.224
NP_441226.1_7 Forward -348 -341 12.7234 0.0312
NP_441226.1_7 Reverse -341 -348 11.5435 0.0757
NP_442834.1_9 Reverse -344 -363 9.93088 0.172
NP_441111.1_7 Reverse -341 -349 8.86921 0.0589
NP_440244.1_1 Reverse -67 -86 -4.52377 0.24
NP_441766.1_2 Forward -349 -340 8.1612 0.0645
NP_441766.1_2 Reverse -340 -349 5.89959 0.103
NP_442417.1_5 Reverse -340 -354 8.45605 0.158
NP_440416.1_9 Forward -356 -337 -9.047 0.125
NP_443052.1_9 Reverse -299 -318 5.89931 0.138
NP_442226.1_8 Reverse -149 -159 18.0729 0.129
NP_442564.1_10 Forward -309 -295 9.14437 0.296
NP_440261.1_5 Forward -240 -227 -6.2739 0.199
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTATATTTCCGTTGCCCTCACCCAAGCTAGTGTGGCCGGAGTGTCCACCTTGGCGATCGGTCAAGTGACCAAAACCTATTTAGCCAATGGGGCCGCCTGGGGAGAAACGGGGCCAAGGACAGTGGTGCGGGATATTCTCAACTCTTTGGATCAAAATTCCGTTATGGCCCGCATTAAGCAAGAACTGCAGGAAAAATTAACTCCAGAAAGAATTGTGTCCCCCTCTCCTTGACCATAGTTACAGCCAAAAAAGAAGGAAAACAATCATCCCTAAGATTGATAAACTGGGATATTACAAGAGTTATTGATACTTTTAGGGTTTTGCTTTGCCCCCGGTTGTTGTAGCTCCGATGTCCGACCAGTCCGACTAAATTTTATCTGTATTAAAAATCCCCCTGCC

CDS

ATGCTCTCCACTGAAATGCCCCTTCCAACCACCGGAAGCACCTTATTAAAAACCCCGGCCTCCCCCTCCCCCAACCAAAATCTTTTACCGTTGACGGCCGTTATTAATAAAAACGGTGAACTAGAAATTGGTGGTTGCTCCGTCCCAGCCTTGGTGGAACAGTTTGGTTCTCCCCTCTACATTTTGGATGAAACCACCCTGCGGCAAGCGGCCCAGCAGTATCGTCAATCCTTCCAAGCCCACTATCCGGGTTCCAGTCAAGTAATCTACGCTTCCAAAGCCTGGAGTTGTTTAGCCGTAGTGGCGATCGCCGCCCAGGAAGGGTTGGGATTTGATGTCGTATCCGGCGGGGAATTATTCACCACGGTTTCAGCCCTGAAGCAATTAGGCTGGGACGAAGCTGAGATTGCAGAAAAAATTTACTTCCACGGCAATAACAAATCGGTGCAGGAACTCCAAGAGGCGATCGCCATTAACTGCACCATCATTGTCGATAACTGGTTGGAACTGGAAACCCTGACCAAACTAGCGGCCGACTCAGGGGCACCGGTAAAGATTATGTTGCGCCTCACCCCAGGCATCGAATGCCACACCCATGAATATATTAAAACGGGGCATCTGGACAGCAAATTTGGCTTTGATCCCAACCAACTAGAAGCGGTTTTCACCTACATTGCCCAACAACCCTCACTCCATTGTCTCGGACTCCATGCCCACATCGGCTCCCAAATTTTTGAGCGTCAACCCCACAAAGATTTAGGGGAAGTGTTAGTGCAATGGTTTACCAAAGGCTTGACCTACGGCTTGCCCCTGACGGAATTGAACATCGGCGGTGGCCTAGGGATTTGCTACACCGAAAGTGATGATCCCCCCAGTATCGAAGAATGGGCCCAAGTGGCGGCCATCTCCGTTGCCAAAGCCTGCGATCGCCAGAACATCCCCTACCCCAAACTGATTGCTGAGCCGGGACGTTCCCTGGTGGGGTCTGCCTGTGTAACGGCCTATCGGGTGGGAGGGCGTAAAGTTGTGCCCAATATTCGCACCTATATTTCCGTCGATGGCGGCATGTCCGACAATCCCCGCCCCATCACCTACCAATCGGTGTATCGCGTTGCCCTAGCCAACCGGATGAACGACGAAATTACCGAAACTGTCACCGTGGCCGGGAAACATTGTGAGTCCGGCGATATTCTCGTTAAGGATGTGGCCCTACCCGCCGCCGAACCAGGGGACATTATGGTAGTGGCTGCCACTGGTGCTTATAACCACAGCATGGCTTCCAACTACAACCGTTTAGGTCGCCCCGCCGCTGTACTAGTAAACCAAGGACAAGCAAACCTGATTCTGCAACGGGAAACCTACACCGACCTATTGCGCCAGGATTGTCTACCCAACCGTCTACTGTCCTAA

Protein

MLSTEMPLPTTGSTLLKTPASPSPNQNLLPLTAVINKNGELEIGGCSVPALVEQFGSPLYILDETTLRQAAQQYRQSFQAHYPGSSQVIYASKAWSCLAVVAIAAQEGLGFDVVSGGELFTTVSALKQLGWDEAEIAEKIYFHGNNKSVQELQEAIAINCTIIVDNWLELETLTKLAADSGAPVKIMLRLTPGIECHTHEYIKTGHLDSKFGFDPNQLEAVFTYIAQQPSLHCLGLHAHIGSQIFERQPHKDLGEVLVQWFTKGLTYGLPLTELNIGGGLGICYTESDDPPSIEEWAQVAAISVAKACDRQNIPYPKLIAEPGRSLVGSACVTAYRVGGRKVVPNIRTYISVDGGMSDNPRPITYQSVYRVALANRMNDEITETVTVAGKHCESGDILVKDVALPAAEPGDIMVVAATGAYNHSMASNYNRLGRPAAVLVNQGQANLILQRETYTDLLRQDCLPNRLLS