Your browser is old and dusty. Try Google Chrome!

Details for sll0501

ORF sll0501
Accession NP_442763.1
Symbol
Category Other
Definition probable glycosyltransferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -117 -103 13.7659 0.0392
NP_441418.1_6 Forward -118 -99 -19.5684 0.0906
NP_441418.1_6 Reverse -333 -352 -23.6 0.196
NP_442291.1_5 Reverse -108 -124 2.51681 0.123
NP_441453.1_4 Reverse -109 -117 14.7691 0.0119
NP_441453.1_4 Forward -118 -110 6.80426 0.121
NP_441453.1_7 Reverse -393 -400 11.9372 0.298
NP_442151.1_6 Reverse -41 -55 7.37441 0.2
NP_442151.1_6 Forward -118 -104 6.3911 0.236
NP_441818.1_1 Reverse -110 -121 14.8078 0.0426
NP_440226.1_1 Reverse -109 -128 2.26107 0.271
NP_440150.1_2 Forward -399 -380 5.11187 0.276
NP_442744.1_8 Forward -155 -136 5.89931 0.152
NP_442744.1_8 Reverse -345 -364 -6.09707 0.297
NP_442173.1_1 Forward -117 -109 12.0158 0.0316
NP_442173.1_1 Reverse -110 -118 12.0158 0.0316
NP_442752.1_4 Forward -118 -111 13.8055 0.0199
NP_440784.1_7 Forward -117 -110 6.23397 0.241
NP_440784.1_7 Reverse -110 -117 6.13563 0.241
NP_440061.1_9 Reverse -107 -121 11.1104 0.117
NP_440061.1_9 Forward -368 -354 8.55376 0.17
NP_440878.1_9 Reverse -323 -342 -3.44213 0.293
NP_442062.1_8 Forward -118 -108 7.94484 0.0848
NP_442062.1_8 Reverse -109 -119 7.55152 0.0946
NP_440761.1_4 Reverse -67 -86 -3.93378 0.132
NP_441900.1_1 Forward -63 -44 11.8225 0.222
NP_440304.1_4 Forward -344 -334 5.19158 0.223
NP_440304.1_4 Forward -52 -42 3.02829 0.299
NP_441594.1_6 Forward -363 -344 6.09597 0.196
NP_441594.1_6 Reverse -100 -119 -0.000545616 0.294
NP_440370.1_10 Forward -323 -304 6.58763 0.287
NP_440518.1_9 Forward -199 -180 8.35759 0.293
NP_442110.1_7 Forward -118 -104 7.76774 0.108
NP_442110.1_7 Reverse -109 -123 0.0979218 0.267
NP_440330.1_2 Reverse -139 -158 12.0942 0.282
NP_441083.1_5 Reverse -109 -119 19.0562 0.00147
NP_441083.1_5 Forward -118 -108 17.7779 0.00336
NP_441434.1_7 Reverse -111 -125 4.32615 0.225
NP_440109.1_6 Reverse -153 -172 8.75091 0.268
NP_441738.1_2 Reverse -111 -118 15.28 0.0102
NP_441558.1_5 Reverse -107 -126 15.1424 0.0438
NP_440209.1_1 Forward -118 -110 8.57422 0.0425
NP_440209.1_1 Reverse -109 -117 8.47588 0.0457
NP_442889.1_8 Forward -121 -107 3.53891 0.275
NP_440056.1_1 Forward -160 -141 14.0608 0.146
NP_441783.1_1 Forward -31 -13 17.3254 0.126
NP_442570.1_3 Reverse -343 -362 -6.49039 0.258
NP_441716.1_1 Forward -118 -104 10.1277 0.0971
NP_442111.1_4 Reverse -108 -122 4.42448 0.207
NP_442111.1_4 Forward -119 -105 2.94952 0.259
NP_440906.1_5 Forward -117 -110 6.23397 0.234
NP_440906.1_5 Reverse -110 -117 6.13563 0.241
NP_440747.1_10 Reverse -106 -118 7.4138 0.00422
NP_440747.1_10 Forward -121 -109 7.11881 0.00789
NP_441130.1_10 Reverse -107 -121 13.7659 0.0599
NP_441486.1_1 Forward -121 -107 2.85119 0.074
NP_441486.1_1 Reverse -106 -120 -4.32697 0.194
NP_442634.1_4 Forward -120 -106 -1.96703 0.149
NP_440403.1_4 Forward -127 -108 -2.26216 0.177
NP_441014.1_2 Forward -283 -264 11.9958 0.258
NP_442848.1_1 Reverse -103 -117 -1.8687 0.263
NP_442848.1_1 Forward -124 -110 -2.16369 0.263
NP_442848.1_4 Reverse -258 -272 5.60446 0.288
NP_442848.1_5 Forward -162 -144 -0.472507 0.276
NP_443018.1_3 Reverse -110 -117 11.7405 0.0655
NP_443018.1_3 Reverse -334 -341 8.49558 0.141
NP_443018.1_3 Reverse -247 -254 8.49558 0.141
NP_443018.1_3 Forward -117 -110 5.44732 0.193
NP_440376.1_1 Forward -118 -109 15.7327 0.00625
NP_440376.1_1 Reverse -109 -118 9.63616 0.0385
NP_441588.1_4 Reverse -111 -121 8.73149 0.14
NP_442687.1_7 Forward -119 -109 6.66654 0.155
NP_442658.1_1 Reverse -144 -154 11.1893 0.0915
NP_442782.1_7 Reverse -101 -120 -0.39387 0.266
NP_441958.1_5 Forward -119 -109 10.0098 0.0167
NP_441958.1_5 Reverse -108 -118 2.43831 0.0422
NP_440984.1_9 Reverse -145 -158 16.1456 0.12
NP_442911.1_2 Reverse -99 -118 -4.6221 0.138
NP_440153.1_5 Reverse -110 -124 1.47456 0.253
NP_440325.1_4 Reverse -50 -69 19.5673 0.141
NP_440993.1_4 Forward -160 -143 3.97208 0.277
NP_441099.1_5 Reverse -99 -118 9.0459 0.0328
NP_441294.1_7 Forward -122 -108 13.6661 0.0583
NP_442438.1_10 Reverse -104 -118 -0.983719 0.287
NP_441000.1_6 Reverse -108 -122 -5.60527 0.285
NP_440147.1_4 Forward -120 -107 6.90245 0.0803
NP_440147.1_4 Reverse -107 -120 -0.0790467 0.271
NP_441550.1_8 Forward -120 -110 13.8442 0.0207
NP_441550.1_8 Reverse -107 -117 11.3859 0.0503
NP_441331.1_1 Forward -172 -153 -3.24547 0.255
NP_441041.1_1 Forward -323 -304 11.4058 0.198
NP_441041.1_4 Forward -118 -99 -11.0136 0.239
NP_441041.1_4 Reverse -42 -61 -11.8003 0.252
NP_441041.1_4 Forward -288 -269 -13.2752 0.285
NP_441041.1_7 Forward -121 -109 7.22324 0.171
NP_440703.1_9 Forward -269 -256 7.59019 0.254
NP_441725.1_5 Reverse -334 -344 7.15819 0.103
NP_441725.1_5 Forward -117 -107 1.55333 0.133
NP_439966.1_7 Reverse -107 -117 14.8275 0.0177
NP_439966.1_7 Forward -120 -110 5.58445 0.216
NP_442941.1_3 Forward -117 -107 10.2065 0.0213
NP_442941.1_3 Reverse -110 -120 9.41981 0.0319
NP_440289.1_2 Forward -121 -108 2.87088 0.086
NP_440289.1_2 Reverse -383 -396 1.00259 0.141
NP_442281.1_1 Reverse -104 -118 15.9285 0.00992
NP_442281.1_1 Forward -123 -109 6.78381 0.115
NP_441079.1_3 Forward -55 -36 12.1925 0.215
NP_440177.1_9 Forward -375 -356 14.3558 0.213
NP_441644.1_6 Reverse -109 -119 17.0891 0.00219
NP_441644.1_6 Forward -118 -108 7.74772 0.117
NP_441644.1_6 Reverse -41 -51 4.69947 0.228
NP_442215.1_2 Reverse -107 -123 -1.80975 0.189
NP_442215.1_2 Forward -120 -104 -5.448 0.25
NP_442215.1_2 Reverse -343 -359 -5.93965 0.262
NP_442215.1_2 Reverse -137 -153 -6.03799 0.263
NP_440253.1_2 Reverse -109 -127 9.36059 0.0491
NP_440253.1_2 Forward -118 -100 4.44404 0.104
NP_440929.1_8 Reverse -109 -118 16.5193 0.00413
NP_440929.1_8 Forward -118 -109 9.53783 0.0296
NP_440566.1_6 Reverse -107 -126 11.2092 0.224
NP_442933.1_10 Reverse -109 -118 8.06287 0.0885
NP_442933.1_10 Forward -118 -109 7.96454 0.0937
NP_441751.2_8 Forward -117 -103 -1.77037 0.13
NP_442554.1_8 Forward -117 -107 13.5497 0.018
NP_442554.1_8 Reverse -110 -120 6.37155 0.12
NP_442142.1_4 Reverse -106 -119 6.90188 0.153
NP_442142.1_4 Forward -158 -145 3.65697 0.248
NP_442142.1_4 Forward -121 -108 2.57534 0.286
NP_442292.1_1 Forward -117 -108 8.75118 0.0306
NP_442292.1_1 Reverse -110 -119 8.65285 0.0335
NP_440775.1_4 Forward -316 -297 11.1342 0.216
NP_441715.1_4 Reverse -110 -120 7.55152 0.108
NP_441715.1_4 Forward -117 -107 5.09324 0.233
NP_440777.1_9 Forward -243 -224 6.98095 0.255
NP_441468.1_1 Forward -117 -110 6.13563 0.209
NP_441468.1_1 Reverse -110 -117 6.0373 0.223
NP_441020.2_6 Forward -299 -282 8.59364 0.195
NP_441020.2_6 Reverse -331 -348 7.11867 0.241
NP_441673.1_1 Forward -118 -109 11.1111 0.0121
NP_441673.1_1 Reverse -109 -118 11.0128 0.018
NP_440265.1_7 Reverse -146 -160 15.0436 0.258
NP_441826.1_2 Forward -124 -110 4.91614 0.0979
NP_441826.1_2 Reverse -103 -117 2.65453 0.123
NP_441826.1_2 Reverse -109 -123 -0.393733 0.212
NP_441330.1_1 Forward -160 -141 -8.06369 0.183
NP_442063.1_9 Reverse -230 -249 6.19431 0.226
NP_441764.1_4 Reverse -88 -105 9.50423 0.284
NP_442868.1_6 Forward -120 -110 9.51814 0.0447
NP_442868.1_6 Reverse -107 -117 0.0783647 0.248
NP_442719.1_2 Reverse -212 -230 -6.96305 0.232
NP_441056.1_1 Forward -118 -99 3.34271 0.131
NP_442227.1_4 Forward -162 -143 14.5516 0.179
NP_442808.1_1 Reverse -108 -118 9.22267 0.0481
NP_440145.1_3 Forward -128 -109 5.60432 0.063
NP_440145.1_3 Forward -324 -305 -2.45882 0.17
NP_442542.1_2 Forward -120 -107 8.77074 0.149
NP_442542.1_2 Reverse -384 -397 5.91914 0.244
NP_442050.1_5 Reverse -107 -117 14.3359 0.0206
NP_441114.1_3 Reverse -43 -52 15.1427 0.193
NP_440558.1_2 Reverse -100 -119 9.3409 0.102
NP_440558.1_2 Forward -364 -345 -6.1954 0.272
NP_441878.1_6 Forward -119 -109 0.668351 0.139
NP_441878.1_6 Reverse -108 -118 0.57002 0.14
NP_441878.1_6 Forward -51 -41 -7.19813 0.21
NP_441878.1_6 Forward -343 -333 -7.49312 0.231
NP_441036.1_8 Forward -119 -109 7.05986 0.21
NP_442650.1_2 Forward -118 -104 4.52282 0.169
NP_441557.1_5 Forward -118 -109 10.2261 0.0144
NP_441557.1_5 Reverse -109 -118 10.1278 0.0188
NP_441590.1_4 Reverse -275 -294 5.99684 0.26
NP_442267.1_4 Reverse -350 -369 -0.39387 0.29
NP_442183.1_1 Forward -118 -104 12.6843 0.0541
NP_439980.1_1 Forward -49 -30 16.6003 0.263
NP_442347.1_2 Reverse -110 -119 10.3245 0.058
NP_442645.1_2 Forward -322 -303 -14.2585 0.172
NP_442645.1_2 Reverse -271 -290 -16.9135 0.245
NP_442965.1_2 Forward -323 -304 -6.88371 0.262
NP_441633.1_3 Forward -120 -107 -6.37223 0.248
NP_442764.1_1 Reverse -46 -64 18.6029 0.243
NP_440136.1_2 Forward -117 -110 6.23397 0.171
NP_440136.1_2 Reverse -110 -117 6.13563 0.193
NP_442590.1_10 Forward -124 -105 4.71934 0.272
NP_442590.1_10 Forward -288 -269 3.34271 0.294
NP_442998.1_10 Reverse -111 -118 15.5754 0.0102
NP_442998.1_10 Forward -116 -109 5.84064 0.235
NP_440299.1_1 Reverse -105 -118 12.7034 0.0356
NP_440299.1_1 Forward -122 -109 2.47701 0.288
NP_440299.1_6 Forward -221 -202 7.86593 0.237
NP_442333.2_5 Forward -365 -346 -4.6221 0.214
NP_440256.1_1 Forward -121 -102 3.6377 0.0514
NP_440256.1_1 Reverse -106 -125 0.491109 0.0829
NP_440256.1_1 Forward -346 -327 -9.63698 0.284
NP_441559.1_8 Reverse -141 -155 -6.78525 0.279
NP_441559.1_8 Reverse -329 -343 -7.17857 0.287
NP_440915.1_6 Forward -122 -108 11.3077 0.0263
NP_442158.1_4 Reverse -349 -359 11.9764 0.26
NP_442967.1_2 Forward -371 -352 9.53756 0.29
NP_442866.1_1 Reverse -328 -347 1.0811 0.165
NP_440748.1_5 Forward -164 -145 -2.95047 0.286
NP_440702.1_2 Reverse -343 -362 -0.295539 0.257
NP_440306.1_8 Reverse -288 -307 3.44025 0.204
NP_442386.1_9 Reverse -108 -117 10.029 0.142
NP_441340.1_5 Forward -117 -110 13.5105 0.0314
NP_441340.1_5 Reverse -110 -117 5.84064 0.208
NP_442240.1_2 Reverse -110 -129 -19.8634 0.295
NP_440161.1_3 Reverse -331 -350 8.94757 0.262
NP_440586.1_8 Reverse -110 -117 9.47853 0.146
NP_440586.1_8 Forward -262 -255 5.93863 0.283
NP_440586.1_8 Forward -117 -110 5.74197 0.283
NP_442251.1_6 Forward -65 -58 8.20058 0.23
NP_442959.1_5 Forward -198 -179 12.3892 0.222
NP_441262.1_3 Forward -118 -111 14.7888 0.0223
NP_440027.1_8 Reverse -142 -161 9.63507 0.243
NP_440027.1_8 Forward -121 -102 7.07848 0.27
NP_443051.1_1 Forward -119 -110 7.47288 0.0571
NP_443051.1_1 Reverse -108 -117 0.589713 0.143
NP_441595.1_2 Reverse -183 -196 8.36957 0.292
NP_440408.1_6 Reverse -141 -159 18.5054 0.14
NP_440439.1_1 Reverse -106 -119 -2.144 0.298
NP_440372.1_2 Forward -117 -110 13.8055 0.0214
NP_440372.1_2 Reverse -110 -117 6.52896 0.188
NP_441789.1_7 Reverse -278 -297 0.195343 0.248
NP_440819.1_5 Forward -222 -214 7.98423 0.228
NP_440316.1_10 Forward -51 -41 7.15819 0.251
NP_440316.1_10 Forward -343 -333 6.96153 0.251
NP_441803.1_2 Reverse -104 -123 5.30933 0.17
NP_441803.1_2 Reverse -364 -383 0.491109 0.251
NP_439977.1_5 Forward -124 -105 -2.95047 0.293
NP_442384.1_10 Reverse -109 -122 10.344 0.0461
NP_442384.1_10 Forward -118 -105 7.6891 0.0764
NP_441018.1_7 Forward -122 -103 11.4058 0.185
NP_441018.1_7 Reverse -148 -167 6.78429 0.282
NP_442262.1_10 Reverse -110 -117 13.2155 0.0213
NP_442262.1_10 Reverse -334 -341 8.59391 0.22
NP_442262.1_10 Reverse -247 -254 8.59391 0.22
NP_441689.1_5 Reverse -107 -117 13.0576 0.0844
NP_442244.1_6 Reverse -339 -358 0.196116 0.291
NP_440344.1_10 Reverse -102 -119 1.31714 0.0311
NP_442910.1_1 Reverse -102 -121 -7.27704 0.254
NP_440189.1_10 Forward -61 -42 3.44104 0.279
NP_440562.1_3 Reverse -110 -127 7.217 0.15
NP_440562.1_10 Reverse -100 -118 6.70565 0.284
NP_442693.1_7 Reverse -350 -369 12.9791 0.202
NP_440297.1_9 Reverse -334 -344 7.05986 0.15
NP_440297.1_9 Forward -41 -31 1.55333 0.278
NP_440297.1_9 Forward -117 -107 -0.41329 0.283
NP_440350.1_5 Reverse -308 -327 -5.9004 0.295
NP_441896.1_3 Forward -127 -108 -2.65548 0.287
NP_441896.1_5 Reverse -151 -158 12.2322 0.273
NP_440894.1_10 Reverse -37 -56 6.09597 0.224
NP_440999.1_9 Forward -122 -108 1.37622 0.166
NP_440888.1_2 Reverse -109 -123 18.0918 0.00261
NP_440888.1_2 Forward -118 -104 6.0955 0.249
NP_442948.1_2 Forward -119 -100 11.7992 0.128
NP_440575.1_1 Reverse -290 -309 -1.37794 0.29
NP_440575.1_8 Reverse -130 -149 11.1109 0.0794
NP_441543.1_2 Forward -117 -108 7.57121 0.113
NP_441543.1_2 Reverse -110 -119 7.07956 0.131
NP_442845.1_2 Forward -118 -104 7.37441 0.195
NP_443064.1_6 Forward -118 -108 11.4034 0.13
NP_443064.1_6 Reverse -109 -119 10.4338 0.153
NP_442578.1_7 Forward -117 -110 6.0373 0.18
NP_441462.1_2 Forward -118 -108 9.81313 0.0143
NP_441462.1_2 Reverse -109 -119 1.74999 0.0811
NP_443062.1_1 Forward -118 -100 5.13317 0.238
NP_442204.1_1 Forward -122 -111 2.22195 0.266
NP_442204.1_1 Reverse -105 -116 0.255333 0.282
NP_441560.1_10 Reverse -101 -120 11.9958 0.159
NP_440516.1_8 Forward -118 -109 16.9127 0.00442
NP_440516.1_8 Reverse -109 -118 14.8477 0.00685
NP_442428.1_5 Forward -117 -110 6.13563 0.209
NP_442428.1_5 Reverse -110 -117 6.0373 0.212
NP_440673.1_3 Reverse -111 -118 12.4288 0.0426
NP_440673.1_3 Reverse -43 -50 6.23397 0.283
NP_441714.1_2 Reverse -230 -248 14.7688 0.227
NP_441670.1_2 Reverse -340 -359 12.0942 0.286
NP_441052.1_2 Forward -118 -108 10.4031 0.0285
NP_441052.1_2 Reverse -109 -119 10.1081 0.0295
NP_442219.1_9 Forward -117 -108 8.06287 0.0696
NP_442219.1_9 Reverse -110 -119 7.96454 0.0696
NP_440436.1_4 Forward -117 -108 7.66912 0.124
NP_440436.1_4 Reverse -110 -119 7.57079 0.124
NP_441719.1_4 Forward -117 -110 6.82395 0.0855
NP_441719.1_4 Reverse -110 -117 6.52896 0.188
NP_441004.1_1 Reverse -152 -171 -10.817 0.226
NP_441004.1_1 Forward -56 -37 -17.9951 0.296
NP_441004.1_2 Reverse -147 -166 3.44104 0.204
NP_441004.1_4 Forward -53 -43 14.828 0.175
NP_441004.1_4 Reverse -46 -56 13.2547 0.216
NP_442366.1_3 Forward -119 -101 -3.6191 0.253
NP_442176.1_1 Reverse -152 -171 1.0811 0.294
NP_441115.1_4 Forward -156 -138 10.9331 0.158
NP_442206.1_10 Forward -118 -103 11.0913 0.113
NP_443054.1_2 Reverse -107 -121 2.16287 0.245
NP_442430.1_9 Forward -98 -79 11.1109 0.272
NP_441851.1_10 Forward -119 -109 6.17489 0.182
NP_441851.1_10 Reverse -108 -118 5.97822 0.19
NP_440593.1_1 Forward -345 -326 20.5506 0.126
NP_440593.1_3 Forward -275 -256 -6.68705 0.28
NP_441982.1_6 Forward -224 -215 11.6259 0.288
NP_441046.1_2 Forward -231 -212 -2.36049 0.299
NP_441349.1_10 Reverse -99 -118 -6.29373 0.226
NP_441409.1_6 Reverse -103 -122 -0.295539 0.0682
NP_441409.1_6 Reverse -217 -236 -6.58872 0.13
NP_440432.1_9 Forward -65 -50 -3.26502 0.179
NP_439960.1_6 Forward -161 -142 12.6841 0.186
NP_439960.1_10 Reverse -102 -120 -3.32411 0.27
NP_441124.1_5 Reverse -232 -242 13.3901 0.215
NP_440431.1_4 Forward -329 -310 -6.8281 0.262
NP_440588.1_2 Reverse -100 -119 -7.08038 0.299
NP_440195.1_4 Forward -160 -141 5.40766 0.284
NP_440943.1_4 Forward -58 -46 14.1986 0.297
NP_442006.1_2 Forward -50 -33 -17.8574 0.283
NP_442243.1_1 Forward -124 -106 4.14829 0.2
NP_442038.1_1 Forward -196 -177 -0.295539 0.278
NP_441570.1_1 Forward -118 -100 -17.7788 0.291
NP_441078.1_4 Forward -118 -109 9.93116 0.0203
NP_441078.1_4 Reverse -109 -118 9.83282 0.0226
NP_442443.1_4 Forward -322 -312 14.1392 0.229
NP_440526.1_3 Reverse -110 -121 0.64819 0.273
NP_441432.1_8 Forward -119 -110 14.0611 0.0258
NP_441432.1_8 Reverse -108 -117 6.98123 0.112
NP_441432.1_9 Reverse -302 -315 12.3797 0.212
NP_442320.1_8 Reverse -103 -117 3.04785 0.0691
NP_442320.1_8 Forward -124 -110 -5.40861 0.225
NP_442344.1_7 Reverse -247 -266 -10.4236 0.3
NP_441732.1_2 Reverse -105 -121 -7.90627 0.0983
NP_440760.1_1 Reverse -109 -128 -23.2067 0.288
NP_440199.1_10 Forward -121 -111 7.25653 0.231
NP_441057.1_3 Reverse -301 -320 -12.0953 0.255
NP_440281.1_6 Reverse -235 -254 10.5209 0.268
NP_442400.1_10 Forward -27 -14 7.79662 0.282
NP_442489.1_7 Reverse -109 -118 10.5211 0.0102
NP_442489.1_7 Forward -118 -109 10.4228 0.0151
NP_440559.1_1 Forward -117 -108 14.651 0.0144
NP_440559.1_1 Reverse -110 -119 7.76787 0.0918
NP_442763.1_1 Forward -224 -205 21.5339 0.0355
NP_442763.1_4 Forward -296 -277 20.649 0.0536
NP_441659.2_8 Reverse -109 -119 15.0247 0.00732
NP_441659.2_8 Forward -118 -108 8.63316 0.0405
NP_442913.1_10 Forward -127 -108 -0.000545616 0.156
NP_441040.1_2 Reverse -107 -126 -15.2418 0.286
NP_439956.1_7 Reverse -140 -159 2.55606 0.273
NP_442346.1_5 Forward -119 -109 7.55152 0.165
NP_442346.1_5 Reverse -108 -118 6.8632 0.188
NP_440545.1_5 Reverse -348 -365 9.97027 0.21
NP_440459.1_2 Reverse -107 -124 8.69197 0.253
NP_441653.1_2 Forward -129 -110 6.332 0.234
NP_440010.1_10 Reverse -45 -64 2.16274 0.287
NP_442603.1_7 Forward -118 -104 17.1085 0.0262
NP_442603.1_7 Reverse -109 -123 9.04542 0.158
NP_441888.1_7 Forward -160 -146 1.86788 0.235
NP_441047.1_2 Forward -154 -135 -1.7705 0.27
NP_441833.1_4 Reverse -110 -117 6.52896 0.0924
NP_441833.1_4 Forward -117 -110 6.23397 0.163
NP_442162.1_9 Forward -117 -110 12.9205 0.0282
NP_442162.1_9 Reverse -110 -117 12.9205 0.0282
NP_440671.1_4 Reverse -103 -117 17.6008 0.0197
NP_440671.1_4 Forward -124 -110 6.48943 0.245
NP_440224.1_1 Forward -129 -110 -0.197208 0.14
NP_442140.1_3 Reverse -110 -120 8.23984 0.122
NP_440875.1_9 Reverse -111 -121 7.69067 0.255
NP_441813.1_5 Reverse -107 -117 12.7631 0.0192
NP_441813.1_5 Forward -120 -110 8.4365 0.0432
NP_440590.1_4 Reverse -110 -123 11.4257 0.0202
NP_440590.1_4 Forward -117 -104 -3.32397 0.255
NP_440567.1_1 Forward -117 -103 3.04785 0.154
NP_442497.1_10 Forward -117 -108 0.688044 0.141
NP_442497.1_10 Reverse -110 -119 0.589713 0.153
NP_440821.1_4 Reverse -107 -117 8.4365 0.0503
NP_440821.1_4 Forward -120 -110 -0.314959 0.251
NP_441239.1_9 Reverse -144 -156 4.8572 0.239
NP_441239.1_9 Reverse -107 -119 3.08724 0.296
NP_442897.1_3 Reverse -344 -363 17.3057 0.106
NP_440624.1_5 Reverse -169 -187 7.57099 0.294
NP_442270.1_9 Forward -386 -367 -6.88371 0.209
NP_441769.1_3 Forward -253 -234 0.883656 0.22
NP_440833.1_6 Reverse -187 -201 7.76712 0.278
NP_440354.1_7 Forward -64 -46 9.85225 0.224
NP_442052.1_8 Forward -52 -42 16.1063 0.207
NP_442809.1_6 Forward -366 -347 7.17762 0.256
NP_440546.1_4 Forward -118 -108 11.0156 0.0991
NP_440546.1_4 Reverse -305 -315 8.6886 0.176
NP_440546.1_4 Reverse -109 -119 7.42815 0.241
NP_441230.1_5 Forward -123 -104 3.24438 0.204
NP_440462.1_6 Reverse -107 -117 4.79825 0.183
NP_442402.1_4 Reverse -290 -309 -8.6544 0.284
NP_441084.1_6 Forward -327 -313 9.15021 0.292
NP_442358.1_9 Reverse -139 -158 15.0441 0.253
NP_442039.1_4 Forward -117 -110 11.6422 0.0747
NP_442039.1_4 Forward -211 -204 8.39725 0.202
NP_441811.1_8 Forward -294 -280 7.37441 0.25
NP_441811.1_8 Reverse -152 -166 6.88276 0.259
NP_442679.1_2 Forward -192 -173 6.4893 0.279
NP_440825.1_6 Reverse -331 -350 19.469 0.128
NP_442837.1_3 Forward -117 -110 6.0373 0.25
NP_442837.1_3 Reverse -110 -117 6.0373 0.25
NP_440160.1_2 Forward -161 -142 1.17943 0.217
NP_440160.1_9 Reverse -267 -286 7.96426 0.27
NP_442053.1_1 Reverse -109 -118 16.6177 0.00257
NP_442053.1_1 Forward -118 -109 8.65285 0.0741
NP_440505.1_3 Forward -120 -110 16.7946 0.00614
NP_440505.1_3 Reverse -107 -117 6.46988 0.18
NP_441252.1_6 Forward -53 -46 14.3954 0.168
NP_441203.1_1 Reverse -346 -365 -15.1435 0.214
NP_442532.1_4 Forward -186 -168 17.7576 0.0987
NP_440914.1_1 Reverse -109 -119 15.6417 0.00456
NP_440914.1_1 Forward -118 -108 13.3971 0.0303
NP_442533.1_6 Reverse -109 -118 14.2577 0.0132
NP_442533.1_6 Forward -118 -109 7.47288 0.0898
NP_442533.1_6 Reverse -42 -51 3.24465 0.219
NP_442533.1_6 Reverse -357 -366 1.76968 0.289
NP_440263.1_3 Forward -124 -105 5.50599 0.243
NP_440263.1_5 Reverse -183 -197 7.57108 0.294
NP_441482.1_7 Reverse -103 -117 6.58777 0.0271
NP_441482.1_7 Forward -124 -110 -10.2268 0.209
NP_439944.1_9 Forward -117 -107 9.7148 0.1
NP_440816.1_7 Reverse -329 -348 12.8808 0.201
NP_442202.1_1 Reverse -231 -247 15.627 0.212
NP_440116.1_8 Forward -117 -98 -5.11376 0.187
NP_440116.1_8 Reverse -110 -129 -9.63698 0.286
NP_441527.1_4 Forward -315 -296 -4.63178 0.188
NP_441527.1_4 Forward -339 -320 -12.4621 0.288
NP_440115.1_6 Forward -121 -111 6.8632 0.167
NP_440007.1_9 Reverse -105 -119 8.75105 0.171
NP_440007.1_9 Forward -122 -108 6.48943 0.223
NP_440007.1_9 Forward -158 -144 0.982901 0.29
NP_442673.1_5 Reverse -326 -344 16.4404 0.162
NP_440480.1_8 Forward -253 -240 15.4572 0.29
NP_440797.1_2 Reverse -98 -117 15.8814 0.163
NP_441286.1_1 Forward -119 -107 11.937 0.0108
NP_441286.1_1 Reverse -108 -120 3.08724 0.05
NP_440670.1_8 Forward -118 -109 18.0926 0.00136
NP_440670.1_8 Reverse -109 -118 15.831 0.00494
NP_440886.1_7 Reverse -108 -118 6.66608 0.115
NP_441001.1_10 Reverse -341 -360 4.52268 0.293
NP_440205.1_4 Reverse -226 -245 14.9458 0.238
NP_442072.1_9 Reverse -108 -126 -14.0422 0.129
NP_441463.1_3 Reverse -335 -354 -7.08038 0.254
NP_441463.1_3 Reverse -99 -118 -10.4236 0.294
NP_441626.1_2 Forward -117 -110 12.2322 0.0511
NP_441626.1_2 Reverse -110 -117 5.93897 0.231
NP_442365.1_7 Reverse -105 -124 -1.47551 0.191
NP_441589.1_5 Reverse -145 -164 15.8846 0.262
NP_442794.1_1 Reverse -105 -117 17.7386 0.0176
NP_441962.1_4 Forward -117 -98 -4.42544 0.158
NP_441962.1_4 Forward -123 -104 -14.0619 0.282
NP_440387.1_1 Forward -118 -102 -3.8747 0.169
NP_441431.1_2 Forward -158 -144 5.89884 0.284
NP_441488.1_8 Forward -123 -109 8.55376 0.184
NP_439938.1_2 Reverse -66 -85 21.3373 0.0279
NP_441174.1_2 Forward -158 -144 11.7993 0.28
NP_440293.1_10 Forward -53 -34 7.57094 0.183
NP_440293.1_10 Forward -127 -108 -2.16383 0.271
NP_440766.1_4 Forward -122 -108 2.06454 0.2
NP_440643.1_6 Forward -160 -141 9.63589 0.123
NP_440457.1_1 Forward -122 -110 8.59377 0.101
NP_440942.1_6 Forward -59 -40 5.70185 0.259
NP_441436.1_8 Forward -119 -100 15.4374 0.215
NP_441496.1_1 Reverse -174 -188 14.0489 0.271
NP_442514.1_5 Reverse -101 -120 -9.14605 0.294
NP_440554.1_4 Reverse -110 -120 5.97822 0.128
NP_441885.1_5 Forward -118 -108 18.6629 0.00274
NP_441885.1_5 Reverse -109 -119 11.0914 0.00874
NP_442341.1_7 Forward -119 -105 12.6843 0.0423
NP_442341.1_7 Reverse -108 -122 11.2093 0.0567
NP_442341.1_7 Forward -52 -38 1.27789 0.295
NP_442341.1_9 Forward -120 -106 12.192 0.109
NP_442341.1_9 Forward -369 -355 8.75042 0.166
NP_441756.1_5 Reverse -105 -124 -4.42544 0.294
NP_440750.1_5 Forward -312 -298 5.70279 0.244
NP_443000.1_7 Forward -120 -110 10.2065 0.0355
NP_443000.1_7 Reverse -107 -117 7.25653 0.0927
NP_440507.2_3 Reverse -100 -119 8.06178 0.261
NP_440275.1_3 Forward -120 -110 12.5664 0.0316
NP_440679.1_10 Forward -379 -360 -11.1119 0.182
NP_441105.1_3 Forward -166 -147 -5.99873 0.227
NP_440216.1_1 Reverse -109 -123 7.66941 0.00931
NP_440172.1_1 Reverse -109 -119 12.0747 0.0322
NP_440172.1_1 Forward -118 -108 5.28991 0.146
NP_440172.1_1 Reverse -146 -156 4.3066 0.194
NP_440172.1_1 Forward -50 -40 3.02829 0.251
NP_440172.1_1 Forward -342 -332 2.92996 0.258
NP_442371.1_1 Forward -190 -180 12.5659 0.246
NP_442015.1_10 Reverse -105 -118 16.3422 0.016
NP_442015.1_10 Forward -122 -109 3.06754 0.185
NP_441226.1_7 Forward -117 -110 12.7234 0.0312
NP_441226.1_7 Reverse -110 -117 11.5435 0.0757
NP_440117.1_1 Forward -26 -7 -10.7186 0.292
NP_441111.1_7 Forward -117 -109 8.96754 0.0463
NP_441111.1_7 Reverse -110 -118 8.86921 0.0589
NP_441766.1_2 Reverse -109 -118 13.9627 0.0114
NP_441766.1_2 Forward -118 -109 7.76787 0.0714
NP_442417.1_5 Reverse -358 -372 9.93102 0.124
NP_440416.1_9 Reverse -102 -121 -14.4552 0.176
NP_440416.1_9 Forward -125 -106 -20.1584 0.282
NP_442116.1_6 Forward -195 -178 13.612 0.172
NP_442116.1_6 Forward -196 -179 6.83207 0.271
NP_440845.1_1 Reverse -245 -264 -4.81876 0.233
NP_440261.1_5 Reverse -110 -123 -12.4687 0.297
NP_440988.1_10 Reverse -107 -121 6.2542 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACCAGGGATATTGCGCCTCATCGTTGACACTCATGGGGCCGCCCAGGACAATCAACAGGTCAATGGCGTCCAAAGAAGGAAGGCTAAAAGATGGCTGAAAAAAAGCGGTTTGACTGATGGCGTAACCTTTAGCCCTGAGCCAACGTTCAATGGCACCAAGATTTTCAAAGGGAACGTGCTGGAAAAAGTGAGCTTGCATATGGTAATTTTCTGGAAATATTCTGGAAATGCTACGGAATTACCCAAGCCAGTGCCGAGGAACGAAATTATTTATAGACCACTGGCGATCGGCATGGTAACAGTAGGTTCCATTAACCAACTGCATTGATTCTAACTAGATCACTCCATTGGGCAACGGCGTTAATGCACTGACTAAATTGACAGGAAATAAGTTACATCT

CDS

ATGACCATTGAACTGTCTATTGTGATTCCAATGTACAACGAGGAAGATAACCTTGAGCATTTATTTGCCCGTTTGCTGGAGGTGCTGACTCCCCTCAAAATTACCTACGAAATTATTTGTGTTAACGACGGTAGTAAGGATAAAACCCTCAAACAATTAATTGATTGCTATCAAAGTAATCGCCAAATTAAGATTGTTAATCTGTCTCGTAACTTTGGCAAAGAAATTGCCCTTTCCGCTGGCATTGATTACGCCCAAGGCAACGCTGTTATTCCCATCGACGCCGACCTGCAAGATCCACCGGAATTGATCCATGAGTTAGTTGATAAATGGCGGGAAGGTTATGATATTGTCTATGCCACCCGTCGTTCACGGCAGGGGGAAACGTGGGTAAAACAATTCACCGCCAAAATGTTTTACAAAGTGATTGGGCGCATGACGGAAATTAAAATTCCTCCCAATACTGGCGATTTTCGTTTAATGGACCGCAAGGTGGTTAATGCGATTAAGCAGCTACCGGAAAGAACTCGCTTTATGAAAGGTTTATTTGCCTGGGTGGGTTACCGCCAAACTTTCGTTTTATTTGATCGGGAACCCCGCTTCCAAGGACAAACAAAATGGAACTATTGGAAACTCTGGAATTTTGCTTTGGACGGCATTTTTTCTTTTAGTTTACTTCCCCTCAAAGTCTGGACTTACCTTGGATCAATCATTTCACTGTTATCCTTAGCCTACGCTAGCTTTTTGATTTTGAAAACCATAACCCTTGGTGTTGATGTGCCAGGCTACGCCTCCCTAATGGTGGCTATCTTATTTCTTGGGGGAGTGCAGTTAATTAGTTTAGGCGTGATTGGGGAATATTTAGGTCGGGTTTATGAAGAAGTAAAAGCTAGACCTTTATATTTAGTTAGTGATCTTTGGGGACTAGAATATTTGCCATTGGAAAAACTTAATTAG

Protein

MTIELSIVIPMYNEEDNLEHLFARLLEVLTPLKITYEIICVNDGSKDKTLKQLIDCYQSNRQIKIVNLSRNFGKEIALSAGIDYAQGNAVIPIDADLQDPPELIHELVDKWREGYDIVYATRRSRQGETWVKQFTAKMFYKVIGRMTEIKIPPNTGDFRLMDRKVVNAIKQLPERTRFMKGLFAWVGYRQTFVLFDREPRFQGQTKWNYWKLWNFALDGIFSFSLLPLKVWTYLGSIISLLSLAYASFLILKTITLGVDVPGYASLMVAILFLGGVQLISLGVIGEYLGRVYEEVKARPLYLVSDLWGLEYLPLEKLN