Your browser is old and dusty. Try Google Chrome!

Details for sll0497

ORF sll0497
Accession NP_442770.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442100.1_4 Reverse -59 -78 20.8447 0.0412
NP_441453.1_7 Reverse -219 -226 12.9205 0.23
NP_441453.1_7 Reverse -315 -322 11.9372 0.298
NP_441623.1_1 Reverse -381 -399 -1.55415 0.241
NP_441623.1_1 Forward -247 -229 -2.63579 0.241
NP_440561.1_8 Forward -85 -66 13.2741 0.24
NP_442287.1_9 Reverse -199 -218 14.8466 0.244
NP_441250.1_3 Forward -135 -116 2.94938 0.267
NP_440061.1_9 Reverse -163 -177 6.29216 0.251
NP_441054.1_2 Reverse -265 -284 9.14423 0.299
NP_441476.1_5 Forward -22 -3 -4.81876 0.257
NP_440304.1_4 Forward -383 -373 4.0116 0.281
NP_442110.1_7 Forward -381 -367 5.60446 0.168
NP_441082.1_10 Reverse -219 -232 19.1938 0.118
NP_441925.1_4 Reverse -190 -209 2.26028 0.155
NP_441558.1_5 Forward -200 -181 9.43923 0.122
NP_441713.1_1 Forward -290 -271 -8.94866 0.162
NP_441792.1_5 Forward -17 -1 7.63002 0.299
NP_440343.1_3 Reverse -62 -80 8.17984 0.197
NP_441486.1_1 Reverse -24 -38 -6.19526 0.283
NP_440842.1_10 Forward -201 -187 10.816 0.251
NP_443018.1_3 Reverse -174 -181 7.11894 0.16
NP_442687.1_7 Forward -286 -276 9.81313 0.0994
NP_442485.1_3 Forward -209 -190 -0.787193 0.253
NP_441846.1_10 Forward -81 -62 -1.96717 0.115
NP_441846.1_10 Forward -88 -69 -23.305 0.282
NP_441846.1_10 Forward -218 -199 -23.6 0.294
NP_442770.1_2 Forward -144 -125 16.9115 0.212
NP_442770.1_8 Forward -211 -192 23.2056 0.0106
NP_440667.1_8 Forward -368 -349 12.1917 0.273
NP_440360.1_10 Reverse -191 -205 2.06454 0.275
NP_440141.1_8 Forward -78 -59 8.25926 0.23
NP_442782.1_2 Reverse -270 -284 0.491246 0.289
NP_442496.1_5 Forward -76 -58 12.2122 0.204
NP_442205.1_9 Reverse -366 -382 -3.57971 0.287
NP_442544.1_2 Reverse -80 -94 -2.06536 0.297
NP_442321.1_1 Reverse -125 -144 -8.65367 0.292
NP_441127.1_1 Forward -207 -193 15.8309 0.11
NP_441127.1_1 Forward -399 -385 8.16106 0.3
NP_440203.1_5 Reverse -167 -177 8.92768 0.281
NP_441097.1_2 Forward -86 -69 2.98877 0.293
NP_443055.1_6 Forward -206 -188 12.3097 0.111
NP_441429.1_6 Reverse -188 -207 4.03102 0.281
NP_442002.1_1 Forward -86 -68 -4.79907 0.228
NP_441294.1_7 Forward -373 -359 8.86667 0.274
NP_440106.1_2 Forward -197 -179 12.5072 0.28
NP_442431.1_10 Forward -212 -194 2.0841 0.243
NP_442566.1_9 Reverse -67 -86 15.8299 0.105
NP_440206.1_10 Reverse -194 -213 13.4708 0.293
NP_441041.1_4 Forward -218 -199 -8.35868 0.2
NP_442396.1_5 Reverse -362 -375 8.67241 0.151
NP_440703.1_9 Forward -198 -185 7.78685 0.254
NP_442847.1_3 Reverse -205 -224 5.99684 0.24
NP_441556.1_4 Forward -230 -211 12.8973 0.201
NP_440867.1_10 Forward -207 -188 13.4708 0.212
NP_442933.1_10 Forward -40 -31 7.86621 0.103
NP_441310.1_10 Reverse -119 -129 16.6663 0.0807
NP_442554.1_8 Reverse -190 -200 5.28991 0.153
NP_442075.1_9 Reverse -204 -223 9.7334 0.256
NP_440511.1_1 Forward -75 -57 6.41066 0.228
NP_441024.1_7 Reverse -56 -74 13.6864 0.175
NP_440357.1_3 Forward -209 -190 -0.885524 0.296
NP_441448.1_1 Reverse -116 -135 8.25926 0.208
NP_440379.1_5 Forward -207 -188 4.81767 0.133
NP_441020.2_6 Forward -80 -63 9.28195 0.176
NP_441015.1_10 Forward -82 -63 -9.83364 0.282
NP_441015.1_10 Forward -217 -198 -10.522 0.284
NP_442253.1_7 Reverse -300 -314 13.8643 0.232
NP_441876.1_9 Reverse -193 -203 14.7292 0.267
NP_442719.1_2 Reverse -93 -111 -4.01314 0.206
NP_442719.1_2 Forward -141 -123 -10.4046 0.273
NP_442227.1_2 Reverse -67 -86 0.58944 0.252
NP_442227.1_2 Reverse -206 -225 -1.37718 0.262
NP_442505.1_2 Forward -341 -322 17.3814 0.164
NP_442050.1_1 Forward -82 -63 8.45592 0.25
NP_442050.1_1 Forward -211 -192 7.57094 0.265
NP_440038.1_4 Forward -371 -352 -0.4922 0.288
NP_441114.1_3 Reverse -211 -220 6.29291 0.285
NP_440923.1_1 Reverse -327 -345 10.6381 0.293
NP_441878.1_6 Forward -199 -189 1.06167 0.116
NP_441878.1_6 Reverse -275 -285 -6.70647 0.194
NP_442579.1_6 Forward -398 -379 14.8474 0.0984
NP_441739.1_2 Forward -376 -360 15.2991 0.0768
NP_441739.1_2 Forward -309 -293 1.82783 0.294
NP_441870.1_7 Reverse -187 -206 11.0125 0.291
NP_441574.1_1 Forward -210 -191 -4.22878 0.252
NP_440829.1_2 Forward -34 -16 9.75391 0.27
NP_441549.1_9 Forward -289 -271 -10.4039 0.278
NP_441411.1_1 Forward -58 -40 19.8643 0.0767
NP_441037.1_4 Forward -200 -190 6.92787 0.237
NP_441037.1_4 Reverse -262 -272 6.24566 0.274
NP_441633.1_3 Reverse -163 -176 -5.38892 0.236
NP_442590.1_9 Reverse -380 -399 12.1925 0.223
NP_441007.1_10 Forward -203 -190 0.412608 0.23
NP_442334.1_1 Forward -210 -191 -4.81876 0.259
NP_440256.1_1 Reverse -5 -24 -5.99873 0.198
NP_440256.1_1 Forward -195 -176 -6.29373 0.207
NP_440256.1_1 Forward -225 -206 -9.047 0.273
NP_440087.1_1 Forward -80 -61 -7.96535 0.276
NP_441296.1_5 Forward -303 -284 14.9458 0.244
NP_441296.1_9 Reverse -68 -81 15.7516 0.18
NP_442785.1_7 Reverse -274 -288 12.9793 0.228
NP_442866.1_1 Reverse -177 -196 -5.50708 0.243
NP_442866.1_1 Reverse -213 -232 -7.27704 0.266
NP_440748.1_5 Reverse -200 -219 2.65439 0.214
NP_441464.1_10 Reverse -356 -370 8.06273 0.287
NP_441939.1_3 Forward -135 -116 8.16093 0.18
NP_441939.1_3 Reverse -111 -130 6.09597 0.253
NP_442993.1_1 Reverse -320 -336 -12.1345 0.266
NP_442386.1_5 Forward -244 -225 10.2251 0.164
NP_441750.1_1 Forward -75 -56 -6.58872 0.24
NP_440168.1_9 Reverse -187 -206 2.3594 0.231
NP_442714.1_5 Forward -398 -379 0.196116 0.258
NP_440586.1_4 Forward -221 -203 14.2771 0.25
NP_440408.1_7 Forward -82 -63 14.7491 0.165
NP_440439.1_1 Forward -225 -212 -0.0790467 0.207
NP_440171.1_3 Forward -225 -206 1.96607 0.29
NP_441789.1_7 Reverse -204 -223 -4.32786 0.28
NP_440819.1_5 Reverse -121 -129 7.98423 0.228
NP_440819.1_5 Forward -400 -392 7.59091 0.272
NP_440316.1_10 Forward -199 -189 8.1415 0.24
NP_440316.1_10 Forward -208 -198 7.45319 0.251
NP_440693.1_8 Forward -82 -63 16.9124 0.229
NP_442262.1_10 Reverse -174 -181 8.20058 0.25
NP_440189.1_2 Reverse -364 -383 -0.0988766 0.284
NP_442750.1_3 Forward -64 -45 -10.817 0.236
NP_440297.1_9 Reverse -190 -200 -0.0199663 0.282
NP_440350.1_5 Reverse -149 -168 -6.58872 0.296
NP_442280.1_10 Reverse -214 -232 4.67522 0.296
NP_440894.1_2 Reverse -61 -80 0.58944 0.244
NP_441679.1_1 Forward -75 -56 -5.40875 0.291
NP_442454.1_5 Reverse -100 -119 16.3215 0.125
NP_440982.1_1 Forward -233 -214 3.14526 0.297
NP_442337.1_8 Reverse -250 -269 -0.885524 0.278
NP_440710.1_1 Reverse -267 -285 -2.24246 0.19
NP_440710.1_2 Forward -365 -346 15.9291 0.172
NP_441462.1_5 Forward -201 -182 2.26107 0.291
NP_441462.1_5 Forward -82 -63 2.16274 0.291
NP_441929.1_6 Reverse -111 -130 4.52268 0.294
NP_443062.1_6 Reverse -268 -287 0.491109 0.294
NP_442204.1_1 Reverse -290 -301 1.14031 0.28
NP_442204.1_1 Forward -226 -215 -0.432984 0.299
NP_440128.1_8 Reverse -154 -173 17.109 0.172
NP_441443.1_2 Reverse -52 -71 -1.18052 0.26
NP_441443.1_7 Forward -210 -191 -2.65548 0.272
NP_441867.1_2 Reverse -222 -241 -16.2252 0.291
NP_440673.1_2 Forward -208 -189 18.9742 0.0423
NP_440673.1_3 Reverse -211 -218 10.5605 0.123
NP_440592.1_8 Forward -23 -4 11.9958 0.253
NP_441884.1_9 Forward -210 -191 -21.9284 0.272
NP_442577.1_9 Forward -237 -223 10.6187 0.275
NP_441004.1_1 Forward -75 -56 -16.1268 0.283
NP_441004.1_2 Forward -209 -190 9.43923 0.148
NP_441004.1_2 Forward -80 -61 5.50599 0.193
NP_441004.1_4 Reverse -261 -271 13.943 0.193
NP_441004.1_4 Forward -72 -62 10.5998 0.254
NP_441004.1_5 Forward -222 -208 9.73436 0.248
NP_441231.1_3 Forward -374 -355 12.585 0.259
NP_440296.1_10 Forward -80 -61 -15.3402 0.294
NP_443054.1_2 Reverse -242 -256 0.294584 0.269
NP_442586.1_6 Reverse -253 -272 8.35759 0.296
NP_441851.1_9 Forward -210 -191 8.16093 0.273
NP_440682.1_2 Forward -328 -309 -16.6185 0.25
NP_442814.1_10 Reverse -189 -208 3.14605 0.269
NP_441668.1_5 Forward -200 -181 6.39097 0.288
NP_441396.1_5 Forward -181 -172 15.241 0.205
NP_440593.1_3 Reverse -184 -203 2.45773 0.175
NP_440593.1_3 Forward -22 -3 -5.40875 0.259
NP_440593.1_9 Reverse -192 -206 10.3243 0.24
NP_441982.1_6 Reverse -120 -129 11.3395 0.288
NP_441982.1_6 Forward -105 -96 10.7665 0.292
NP_440463.1_8 Reverse -188 -207 10.1138 0.23
NP_441046.1_2 Forward -209 -190 1.17943 0.26
NP_441349.1_10 Forward -265 -246 -9.73531 0.297
NP_440389.1_5 Forward -105 -86 22.7308 0.0181
NP_440432.1_9 Reverse -373 -388 -1.69173 0.167
NP_442006.1_2 Forward -227 -210 -8.81095 0.197
NP_442006.1_2 Forward -90 -73 -16.9724 0.267
NP_442729.1_5 Forward -199 -189 8.53483 0.248
NP_442729.1_8 Reverse -242 -255 7.19745 0.161
NP_442388.1_3 Forward -194 -175 5.50599 0.282
NP_442348.1_2 Reverse -300 -309 12.0944 0.218
NP_440793.1_1 Reverse -57 -71 9.43874 0.293
NP_441094.1_6 Forward -103 -86 14.1977 0.166
NP_442797.1_7 Reverse -196 -214 -0.669169 0.284
NP_440713.1_4 Forward -87 -68 1.86774 0.277
NP_440713.1_4 Reverse -173 -192 0.982764 0.298
NP_440352.1_7 Reverse -61 -74 16.2433 0.239
NP_440486.1_6 Reverse -231 -250 8.84924 0.235
NP_440010.1_10 Reverse -226 -245 9.3409 0.209
NP_440847.1_3 Reverse -166 -180 17.8952 0.115
NP_440847.1_3 Reverse -210 -224 10.9137 0.279
NP_441585.1_5 Forward -142 -123 -0.29631 0.291
NP_441050.1_5 Reverse -85 -103 1.59244 0.225
NP_441358.1_3 Forward -166 -148 18.4062 0.117
NP_441895.1_2 Reverse -284 -303 -26.6482 0.246
NP_442914.1_8 Forward -284 -265 5.50599 0.3
NP_441671.1_10 Forward -225 -206 0.392778 0.281
NP_440594.1_8 Forward -39 -26 7.88518 0.259
NP_441239.1_9 Reverse -196 -208 6.1355 0.2
NP_441892.1_1 Forward -227 -210 1.31714 0.154
NP_440833.1_6 Reverse -59 -73 6.68548 0.297
NP_442216.1_4 Forward -374 -366 8.37716 0.255
NP_441119.1_7 Forward -256 -237 5.89931 0.233
NP_440412.1_2 Reverse -108 -127 8.84924 0.281
NP_442052.1_8 Forward -200 -190 11.8781 0.297
NP_440546.1_6 Reverse -117 -136 8.06259 0.265
NP_441474.1_1 Reverse -203 -222 7.4718 0.212
NP_442402.1_2 Reverse -91 -105 12.192 0.271
NP_442402.1_6 Reverse -241 -250 13.1761 0.289
NP_442039.1_7 Forward -67 -57 7.05986 0.283
NP_441811.1_1 Reverse -188 -207 13.7658 0.247
NP_442679.1_1 Forward -76 -57 -4.6221 0.283
NP_442679.1_1 Reverse -29 -48 -4.81876 0.286
NP_440160.1_2 Forward -253 -234 -9.14533 0.293
NP_440505.1_7 Reverse -220 -239 -0.39387 0.271
NP_441701.1_3 Forward -207 -190 8.29864 0.247
NP_441252.1_6 Reverse -364 -371 11.6422 0.288
NP_442009.1_9 Reverse -198 -217 11.9958 0.226
NP_440914.1_1 Forward -17 -7 8.32233 0.197
NP_442533.1_1 Forward -216 -197 -9.44032 0.223
NP_442533.1_1 Forward -86 -67 -15.6352 0.257
NP_442541.1_10 Reverse -60 -74 5.01387 0.248
NP_442232.1_3 Forward -226 -207 -14.3569 0.288
NP_442322.1_4 Reverse -65 -82 -9.99156 0.297
NP_441028.1_6 Forward -129 -119 9.71433 0.21
NP_441028.1_6 Reverse -63 -73 5.19112 0.265
NP_441028.1_6 Forward -252 -242 3.51951 0.292
NP_440115.1_6 Forward -221 -211 5.19158 0.265
NP_441602.1_3 Reverse -3 -22 4.03102 0.162
NP_441170.1_2 Reverse -217 -236 1.27776 0.275
NP_441420.1_2 Reverse -189 -208 12.6841 0.268
NP_440646.1_1 Reverse -277 -296 5.40766 0.119
NP_439903.1_6 Reverse -180 -199 2.75194 0.222
NP_440670.1_8 Forward -381 -372 3.24465 0.29
NP_441479.1_1 Reverse -119 -138 8.25926 0.257
NP_441479.1_9 Reverse -284 -302 13.4905 0.277
NP_441705.1_1 Reverse -6 -25 18.1907 0.144
NP_441930.1_2 Forward -70 -60 12.8614 0.248
NP_440886.1_7 Reverse -197 -207 3.22451 0.291
NP_440828.1_4 Reverse -188 -207 -7.96609 0.295
NP_442614.1_2 Forward -198 -184 8.94771 0.242
NP_442614.1_2 Forward -285 -271 6.29277 0.291
NP_442382.1_9 Reverse -253 -272 9.93006 0.281
NP_442382.1_9 Reverse -4 -23 9.63507 0.281
NP_442717.1_2 Reverse -128 -147 -6.1954 0.282
NP_440205.1_1 Forward -166 -147 11.6148 0.121
NP_441753.1_10 Forward -227 -208 3.93269 0.204
NP_441403.1_4 Reverse -362 -380 8.7706 0.282
NP_441463.1_3 Reverse -199 -218 -7.96535 0.262
NP_442893.1_4 Reverse -147 -166 -0.689632 0.252
NP_442352.1_8 Reverse -170 -184 16.5185 0.242
NP_440293.1_3 Reverse -294 -313 -1.67217 0.239
NP_442246.1_10 Reverse -152 -171 17.4032 0.2
NP_440643.1_2 Forward -80 -61 2.26107 0.289
NP_442867.1_8 Reverse -75 -94 6.39097 0.262
NP_441801.1_4 Forward -251 -241 2.92996 0.231
NP_442680.1_5 Forward -172 -153 3.58908 0.229
NP_441332.1_6 Reverse -196 -206 10.8723 0.282
NP_441436.1_2 Forward -225 -206 0.0977854 0.277
NP_441436.1_2 Forward -95 -76 -0.983855 0.277
NP_442439.1_8 Forward -205 -186 6.98095 0.299
NP_440734.1_9 Reverse -194 -213 9.83255 0.282
NP_441845.1_6 Reverse -19 -37 0.707465 0.274
NP_441173.1_9 Forward -129 -121 9.75379 0.284
NP_440091.1_7 Reverse -98 -117 14.7483 0.282
NP_440866.1_3 Reverse -109 -128 15.0441 0.24
NP_439962.1_4 Reverse -190 -209 -6.68705 0.283
NP_440175.1_7 Reverse -214 -232 18.244 0.081
NP_442495.1_5 Forward -209 -190 5.11266 0.293
NP_441875.1_7 Reverse -87 -97 16.2046 0.227
NP_441875.1_10 Reverse -170 -184 13.0776 0.232
NP_440216.1_9 Reverse -174 -183 9.73449 0.286
NP_440216.1_9 Forward -196 -187 7.07956 0.289
NP_440216.1_9 Reverse -175 -184 6.78456 0.289
NP_441226.1_7 Reverse -198 -205 6.52862 0.253
NP_440416.1_9 Reverse -202 -221 -17.3068 0.237
NP_440416.1_9 Reverse -1 -20 -18.2901 0.256
NP_443052.1_9 Forward -303 -284 -0.983855 0.219
NP_443052.1_9 Reverse -207 -226 -5.11376 0.265
NP_442154.1_1 Forward -217 -199 -7.749 0.148
NP_442564.1_10 Reverse -188 -202 8.94771 0.296
NP_440261.1_5 Reverse -277 -290 -8.14219 0.201
NP_440261.1_5 Reverse -190 -203 -12.1738 0.272
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGGCAAAAACGGCCAATGAGGCGCTCTGATTCCCCAAAACCATAAATTTCAGCAGTGTCAATTAAGGTAACTCCGGCCTCCAGGGAAGCATGAAAAGCCCCCTCTACTTCTTGCGGGCCAAAGTCCTTACCGTAGGCCCAAAACAGGGTGTCTCCCCAGGACCAAGTACCCAAACCCAGGGGAGCAATGGAGGGGCCGTTGGGGCCAAGGCGAATAGTTTCCATGGGGGGGTTGAAAGAAATCTAGAACTAGCTCGCAAAACTGAGCCATATTTTCCCCGATGATAAACCAGTATTTCTGGAAAAGCTTGCCCACAGAGGGGAGAGGATGGGGAAATGGGAGAATGATTTTAATTGTTTAATTGATCGTTCGAAAACAGCGGAACCAATCACAAGGGCAA

CDS

ATGACCATGGCTAACTGGGAAAACTTTCTCAAAAATTTAGGGGAATGGCAGGGCAGTTTTACCCGCTTATCTCCCCAAGGAGAAATATTGAGCAATACTCCTTCCATACTCACCCTGGAAGGATTGGATGATGACAAGTTAGTCAAGTTTCGCCTGCGGCGCTACGATAATCCCGATTACCAAGACCCTCCCACTCAGGACTATAGCCAGGATTACCGTTCCCTAGGGCGACAAATCATTTTCTTTGGCACCGGTGCTTTTTCCAAAGGGCCATGGCAGTTGGCTCCCTTCAGTGAGTTTGGGGCGGAATTTGGCTTTGTGGATGGCGATCGCCGTATGAGATTCGTGCAATTGTATGACAAAGGATTAAGCTTAGCTAGCCTGACGTTTATCCGAGAATTTCGCCGGGGGAGTGATGCCCAGGAAAGACCAGCATTAAAGGTGGAGCAACTATTGGGCACTTGGCAATGCCAGGTTTATACTGGCTACCCCGACTGGCGAGAACCGGAACTGAGCACTATGGAAATTAGCCTGAGTCAAACGGGGGATTCCGTGGAACAACGGGTGACTGTGCAAGGACAAACTTCAGTGATGCAAGGGAAAGTGATGGGCGATCAGATTCATTTTCTTGGCCCCAACCCCAGCAAGGTTTTACTACTACCAGACGGCGCTTCTTCTTGCACCCCCGATCGCCTGCAATTGGGACAACCCTTTTCGGGGGAAGTGGGCTGGTTGGTGCGCCCCAACGAACGACAAAGGCTGATCCGTTACTATGACAATAGGGGGGCTTGGACCCATTCCGCTTTTGTTGTTGAGCATCGTCAGTAG

Protein

MTMANWENFLKNLGEWQGSFTRLSPQGEILSNTPSILTLEGLDDDKLVKFRLRRYDNPDYQDPPTQDYSQDYRSLGRQIIFFGTGAFSKGPWQLAPFSEFGAEFGFVDGDRRMRFVQLYDKGLSLASLTFIREFRRGSDAQERPALKVEQLLGTWQCQVYTGYPDWREPELSTMEISLSQTGDSVEQRVTVQGQTSVMQGKVMGDQIHFLGPNPSKVLLLPDGASSCTPDRLQLGQPFSGEVGWLVRPNERQRLIRYYDNRGAWTHSAFVVEHRQ