Your browser is old and dusty. Try Google Chrome!

Details for sll0487

ORF sll0487
Accession NP_442503.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -32 -18 3.24451 0.166
NP_441061.1_2 Forward -355 -341 1.47456 0.188
NP_441061.1_2 Reverse -365 -379 -2.26202 0.287
NP_440795.1_7 Forward -355 -348 14.6904 0.0123
NP_440795.1_7 Reverse -348 -355 14.6904 0.0123
NP_440795.1_7 Forward -32 -25 14.6904 0.0123
NP_440795.1_7 Reverse -25 -32 14.6904 0.0123
NP_440795.1_7 Reverse -237 -244 6.43063 0.265
NP_441418.1_6 Reverse -24 -43 -27.7299 0.203
NP_441418.1_6 Forward -108 -89 -28.8115 0.211
NP_442657.1_5 Forward -327 -313 15.3667 0.293
NP_442291.1_5 Reverse -346 -362 6.45005 0.0694
NP_442291.1_5 Reverse -23 -39 -1.21977 0.192
NP_442291.1_5 Forward -357 -341 -3.38305 0.239
NP_440897.1_6 Reverse -24 -43 9.53674 0.0705
NP_440897.1_6 Reverse -347 -366 -0.886293 0.187
NP_441453.1_4 Reverse -347 -355 16.539 0.00633
NP_441453.1_4 Reverse -24 -32 16.539 0.00633
NP_441453.1_4 Forward -356 -348 16.539 0.00633
NP_441453.1_4 Forward -33 -25 16.539 0.00633
NP_441453.1_4 Reverse -99 -107 4.73931 0.252
NP_442151.1_6 Forward -33 -19 17.5025 0.00997
NP_442151.1_6 Reverse -24 -38 12.9793 0.0628
NP_442151.1_6 Forward -356 -342 8.45605 0.172
NP_442151.1_6 Reverse -347 -361 6.98109 0.214
NP_441818.1_1 Reverse -25 -36 15.4961 0.0264
NP_441818.1_1 Forward -355 -344 10.1862 0.232
NP_441818.1_1 Reverse -348 -359 8.80962 0.277
NP_440226.1_1 Reverse -24 -43 5.30933 0.161
NP_440226.1_1 Forward -356 -337 4.22769 0.199
NP_442623.1_3 Reverse -25 -44 -18.0934 0.263
NP_441098.1_3 Forward -304 -285 0.101718 0.25
NP_442173.1_1 Forward -355 -347 15.4574 0.00633
NP_442173.1_1 Forward -32 -24 15.4574 0.00633
NP_442173.1_1 Reverse -348 -356 15.4574 0.00633
NP_442173.1_1 Reverse -25 -33 15.4574 0.00633
NP_442173.1_5 Forward -226 -216 15.824 0.287
NP_442752.1_4 Forward -356 -349 13.8055 0.0199
NP_442752.1_4 Reverse -347 -354 13.8055 0.0199
NP_442752.1_4 Forward -33 -26 13.8055 0.0199
NP_442752.1_4 Reverse -24 -31 13.8055 0.0199
NP_442752.1_4 Reverse -208 -215 9.47889 0.109
NP_442752.1_4 Forward -316 -309 5.54565 0.194
NP_442752.1_4 Reverse -99 -106 5.54565 0.194
NP_443027.1_4 Forward -358 -348 13.2547 0.0521
NP_443027.1_4 Forward -35 -25 11.0914 0.107
NP_441812.1_3 Reverse -346 -360 10.4227 0.222
NP_442975.1_10 Forward -360 -346 11.7987 0.0482
NP_442975.1_10 Forward -112 -98 10.9137 0.0516
NP_442975.1_10 Reverse -20 -34 10.2254 0.056
NP_442975.1_10 Forward -37 -23 3.63724 0.252
NP_442975.1_10 Reverse -343 -357 2.35894 0.276
NP_442975.1_10 Forward -226 -212 1.67063 0.293
NP_441675.1_4 Forward -68 -49 5.80098 0.236
NP_440784.1_7 Forward -355 -348 15.9687 0.0123
NP_440784.1_7 Reverse -348 -355 15.9687 0.0123
NP_440784.1_7 Forward -32 -25 15.9687 0.0123
NP_440784.1_7 Reverse -25 -32 15.9687 0.0123
NP_442909.1_7 Forward -32 -18 13.6669 0.12
NP_442909.1_7 Forward -355 -341 9.83206 0.14
NP_441250.1_3 Reverse -287 -306 5.60432 0.24
NP_440061.1_9 Reverse -22 -36 18.3868 0.00917
NP_440061.1_9 Reverse -345 -359 13.7653 0.076
NP_440061.1_9 Forward -35 -21 10.422 0.124
NP_441054.1_2 Forward -64 -45 9.53756 0.292
NP_441054.1_4 Forward -43 -25 9.95058 0.0619
NP_440878.1_9 Reverse -14 -33 3.73603 0.174
NP_440878.1_9 Forward -43 -24 -2.75381 0.276
NP_442062.1_8 Forward -356 -346 17.3846 0.00193
NP_442062.1_8 Forward -33 -23 17.3846 0.00193
NP_442062.1_8 Reverse -24 -34 17.3846 0.00193
NP_442062.1_8 Reverse -347 -357 10.3048 0.0493
NP_441859.1_3 Reverse -119 -138 9.93006 0.124
NP_440304.1_4 Forward -358 -348 10.8948 0.051
NP_440304.1_4 Reverse -214 -224 4.0116 0.281
NP_440304.1_4 Reverse -345 -355 1.84832 0.299
NP_440304.1_4 Forward -35 -25 1.84832 0.299
NP_440304.1_4 Reverse -22 -32 1.84832 0.299
NP_442242.1_4 Forward -355 -348 14.3954 0.0124
NP_442242.1_4 Reverse -348 -355 14.3954 0.0124
NP_442242.1_4 Forward -32 -25 14.3954 0.0124
NP_442242.1_4 Reverse -25 -32 14.3954 0.0124
NP_440044.1_8 Reverse -348 -367 12.0942 0.0449
NP_440044.1_8 Forward -355 -336 9.83255 0.0646
NP_441781.1_7 Forward -108 -89 -1.27885 0.272
NP_441619.1_8 Reverse -341 -355 18.0918 0.061
NP_441619.1_8 Reverse -18 -32 7.3738 0.28
NP_441208.1_9 Reverse -344 -358 13.6676 0.103
NP_442742.1_9 Forward -53 -34 -3.04881 0.204
NP_442110.1_7 Reverse -24 -38 2.06454 0.222
NP_442110.1_7 Forward -33 -19 1.76955 0.222
NP_442110.1_7 Reverse -347 -361 1.57289 0.222
NP_441082.1_10 Forward -166 -153 9.85238 0.237
NP_440856.1_4 Forward -40 -21 -1.7705 0.203
NP_441083.1_5 Forward -356 -346 20.3345 0.00053
NP_441083.1_5 Forward -33 -23 20.3345 0.00053
NP_441083.1_5 Reverse -24 -34 20.3345 0.00053
NP_441083.1_5 Reverse -347 -357 11.2881 0.0159
NP_441434.1_7 Forward -31 -17 3.14618 0.259
NP_441738.1_2 Forward -354 -347 15.28 0.0102
NP_441738.1_2 Reverse -349 -356 15.28 0.0102
NP_441738.1_2 Forward -31 -24 15.28 0.0102
NP_441738.1_2 Reverse -26 -33 15.28 0.0102
NP_441738.1_4 Reverse -14 -33 14.6508 0.0855
NP_441558.1_5 Forward -35 -16 13.1758 0.0619
NP_440209.1_1 Reverse -347 -355 18.1123 0.00295
NP_440209.1_1 Reverse -24 -32 18.1123 0.00295
NP_440209.1_1 Forward -356 -348 18.1123 0.00295
NP_440209.1_1 Forward -33 -25 18.1123 0.00295
NP_442889.1_8 Forward -36 -22 13.2736 0.0588
NP_442889.1_8 Forward -359 -345 11.4053 0.0733
NP_441713.1_1 Reverse -341 -360 -14.8485 0.259
NP_440178.1_7 Reverse -346 -365 -21.1417 0.213
NP_440178.1_7 Forward -34 -15 -21.24 0.215
NP_440178.1_7 Forward -357 -338 -22.2233 0.258
NP_441716.1_1 Reverse -24 -38 3.93283 0.259
NP_442111.1_3 Reverse -43 -56 14.0991 0.244
NP_442111.1_3 Forward -60 -47 13.3352 0.261
NP_442111.1_4 Reverse -23 -37 13.3726 0.039
NP_442111.1_4 Forward -34 -20 11.111 0.0515
NP_442111.1_4 Reverse -346 -360 10.9143 0.0518
NP_441624.1_7 Forward -45 -31 12.9793 0.191
NP_441624.1_7 Forward -102 -88 7.37441 0.257
NP_441163.1_1 Forward -34 -17 4.36469 0.289
NP_440906.1_5 Forward -355 -348 15.8704 0.0124
NP_440906.1_5 Reverse -348 -355 15.8704 0.0124
NP_440906.1_5 Forward -32 -25 15.8704 0.0124
NP_440906.1_5 Reverse -25 -32 15.8704 0.0124
NP_440906.1_5 Reverse -100 -107 8.79057 0.149
NP_442442.1_5 Forward -234 -215 10.4225 0.205
NP_440747.1_10 Forward -36 -24 16.7552 0.0019
NP_440747.1_10 Reverse -344 -356 14.9853 0.00221
NP_440747.1_10 Reverse -21 -33 14.887 0.00223
NP_440747.1_10 Forward -359 -347 7.4138 0.00422
NP_441130.1_10 Reverse -345 -359 7.57108 0.155
NP_441486.1_1 Forward -36 -22 6.3911 0.0344
NP_441486.1_1 Reverse -344 -358 6.29277 0.0344
NP_441486.1_1 Forward -359 -345 6.09611 0.0344
NP_441486.1_1 Reverse -21 -35 5.89945 0.0344
NP_441880.2_10 Forward -224 -206 12.5072 0.128
NP_442634.1_2 Forward -124 -105 3.53937 0.278
NP_442634.1_4 Forward -358 -344 -1.96703 0.149
NP_441639.1_3 Reverse -346 -365 3.24438 0.264
NP_440403.1_4 Reverse -338 -357 -7.27704 0.241
NP_441014.1_8 Reverse -88 -107 -7.96535 0.282
NP_441014.1_10 Forward -34 -15 -2.26292 0.274
NP_442848.1_1 Reverse -18 -32 7.86607 0.0791
NP_442848.1_1 Reverse -341 -355 7.07942 0.0791
NP_443018.1_3 Forward -355 -348 14.8871 0.0123
NP_443018.1_3 Reverse -348 -355 14.8871 0.0123
NP_443018.1_3 Forward -32 -25 14.8871 0.0123
NP_443018.1_3 Reverse -25 -32 14.8871 0.0123
NP_441316.1_7 Reverse -358 -373 -3.75668 0.291
NP_441634.1_8 Forward -35 -21 -3.147 0.295
NP_441634.1_8 Reverse -345 -359 -3.93365 0.295
NP_441634.1_8 Forward -358 -344 -4.32697 0.295
NP_440376.1_1 Forward -356 -347 19.4693 0.000692
NP_440376.1_1 Reverse -347 -356 19.4693 0.000692
NP_440376.1_1 Forward -33 -24 19.4693 0.000692
NP_440376.1_1 Reverse -24 -33 19.4693 0.000692
NP_440376.1_1 Reverse -99 -108 5.3096 0.137
NP_440376.1_1 Forward -96 -87 3.34298 0.206
NP_441588.1_4 Forward -354 -344 18.1713 0.0143
NP_441588.1_4 Forward -31 -21 15.9097 0.0369
NP_441588.1_4 Reverse -26 -36 6.46988 0.193
NP_442687.1_7 Forward -357 -347 9.02648 0.0994
NP_442687.1_7 Reverse -346 -356 8.92815 0.0994
NP_442687.1_7 Forward -34 -24 8.92815 0.0994
NP_442687.1_7 Reverse -23 -33 8.92815 0.0994
NP_442687.1_7 Reverse -215 -225 6.46988 0.165
NP_442687.1_7 Reverse -86 -96 4.89658 0.23
NP_440642.1_10 Reverse -252 -266 11.4053 0.145
NP_440042.1_2 Reverse -174 -193 -1.47551 0.244
NP_441422.1_7 Forward -35 -18 -0.551145 0.168
NP_440667.1_2 Forward -96 -77 -7.4737 0.275
NP_440887.1_6 Reverse -219 -238 12.4875 0.295
NP_440360.1_10 Forward -223 -209 2.94952 0.259
NP_442658.1_1 Forward -358 -348 14.2375 0.0237
NP_442658.1_1 Forward -35 -25 7.94438 0.199
NP_442658.1_1 Reverse -345 -355 6.76441 0.214
NP_442658.1_1 Reverse -22 -32 6.76441 0.214
NP_442161.1_7 Forward -50 -31 2.75272 0.292
NP_440141.1_3 Forward -281 -262 3.04771 0.274
NP_442782.1_2 Forward -59 -45 10.521 0.173
NP_442782.1_2 Reverse -45 -59 1.37622 0.281
NP_442782.1_2 Reverse -216 -230 0.88457 0.282
NP_442782.1_2 Forward -176 -162 0.786239 0.284
NP_442205.1_9 Forward -362 -346 -1.61309 0.264
NP_440656.1_8 Forward -367 -348 2.3594 0.113
NP_441414.1_9 Forward -356 -337 7.7676 0.0323
NP_441414.1_9 Reverse -24 -43 4.52268 0.0536
NP_441414.1_9 Forward -316 -297 -5.60541 0.178
NP_440800.1_7 Forward -230 -216 10.3243 0.294
NP_442653.1_8 Reverse -14 -31 17.2468 0.204
NP_442937.1_5 Reverse -19 -38 16.4207 0.0429
NP_442937.1_5 Forward -38 -19 10.1275 0.17
NP_441958.1_5 Forward -357 -347 21.2195 0.000805
NP_441958.1_5 Reverse -346 -356 12.2714 0.00183
NP_441958.1_5 Forward -34 -24 12.2714 0.00183
NP_441958.1_5 Reverse -23 -33 12.2714 0.00183
NP_441958.1_5 Forward -97 -87 -0.216628 0.186
NP_441958.1_5 Forward -317 -307 -1.78992 0.252
NP_441127.1_1 Reverse -328 -342 12.1926 0.215
NP_442836.1_5 Forward -362 -343 2.85105 0.248
NP_442836.1_5 Reverse -341 -360 1.17943 0.287
NP_440203.1_5 Reverse -310 -320 8.92768 0.281
NP_439905.1_1 Reverse -348 -361 11.0324 0.204
NP_439905.1_1 Reverse -25 -38 8.9674 0.227
NP_440984.1_7 Forward -361 -347 18.2892 0.0155
NP_440984.1_7 Forward -38 -24 11.6026 0.122
NP_440984.1_7 Reverse -342 -356 8.75105 0.137
NP_439990.1_5 Forward -38 -25 13.4906 0.0942
NP_439990.1_5 Reverse -19 -32 11.0324 0.128
NP_439990.1_5 Reverse -342 -355 6.70579 0.223
NP_442690.1_1 Forward -174 -155 -10.3253 0.212
NP_442911.1_2 Forward -43 -24 5.40766 0.0341
NP_442911.1_2 Reverse -337 -356 -3.3438 0.111
NP_442911.1_2 Reverse -350 -369 -4.03212 0.124
NP_441580.1_6 Forward -44 -25 1.27776 0.119
NP_441580.1_6 Reverse -88 -107 -9.34199 0.296
NP_440153.1_5 Reverse -348 -362 14.7492 0.0551
NP_440153.1_5 Reverse -25 -39 2.75286 0.219
NP_442064.1_1 Reverse -342 -361 -9.93197 0.259
NP_443055.1_6 Forward -225 -207 9.45814 0.133
NP_443055.1_6 Forward -110 -92 0.706727 0.24
NP_443055.1_6 Reverse -16 -34 -1.75153 0.284
NP_442236.1_9 Reverse -237 -256 17.7974 0.218
NP_440993.1_3 Forward -43 -24 11.7 0.0882
NP_440934.1_1 Forward -47 -28 7.27595 0.233
NP_441099.1_5 Forward -43 -24 9.3409 0.0328
NP_441099.1_5 Reverse -14 -33 -0.197208 0.0896
NP_441099.1_5 Reverse -89 -108 -11.8986 0.291
NP_442002.1_9 Reverse -215 -222 11.3472 0.185
NP_440475.1_3 Forward -35 -16 17.109 0.216
NP_441294.1_7 Forward -360 -346 17.0257 0.0103
NP_441294.1_7 Reverse -20 -34 9.15464 0.256
NP_441646.1_1 Reverse -17 -36 14.2574 0.0811
NP_441646.1_1 Reverse -340 -359 -1.86883 0.296
NP_442438.1_10 Reverse -19 -33 1.08123 0.206
NP_442438.1_10 Forward -38 -24 0.0979218 0.239
NP_441000.1_6 Reverse -346 -360 4.32615 0.0957
NP_440484.1_3 Forward -35 -21 11.2093 0.242
NP_440147.1_4 Reverse -22 -35 18.9972 0.00328
NP_440147.1_4 Reverse -345 -358 18.4072 0.00407
NP_440147.1_4 Forward -358 -345 10.344 0.0355
NP_440147.1_4 Forward -35 -22 8.77074 0.0465
NP_440147.1_4 Forward -318 -305 5.72248 0.115
NP_440147.1_4 Forward -195 -182 5.72248 0.115
NP_440147.1_4 Forward -98 -85 -0.0790467 0.271
NP_441175.1_7 Forward -33 -14 5.89931 0.267
NP_441550.1_8 Forward -358 -348 15.8108 0.0132
NP_441550.1_8 Forward -35 -25 15.1225 0.0132
NP_441550.1_8 Reverse -345 -355 14.6309 0.0132
NP_441550.1_8 Reverse -22 -32 14.6309 0.0132
NP_441916.1_7 Reverse -347 -357 18.9579 0.00144
NP_441916.1_7 Forward -356 -346 10.3048 0.0261
NP_441916.1_7 Forward -33 -23 10.3048 0.0261
NP_441916.1_7 Reverse -24 -34 10.3048 0.0261
NP_440465.1_4 Reverse -346 -365 10.1275 0.273
NP_441041.1_4 Forward -33 -14 -4.42544 0.136
NP_441041.1_4 Reverse -24 -43 -9.24366 0.214
NP_441041.1_4 Forward -108 -89 -10.1286 0.228
NP_441041.1_7 Reverse -344 -356 11.8878 0.0689
NP_441041.1_7 Forward -359 -347 7.32042 0.169
NP_442396.1_5 Reverse -20 -33 12.114 0.0913
NP_442396.1_5 Reverse -343 -356 11.7207 0.0913
NP_442004.1_6 Forward -33 -19 8.94771 0.14
NP_442004.1_6 Forward -108 -94 5.01447 0.199
NP_441725.1_4 Forward -38 -24 3.14559 0.279
NP_441725.1_5 Forward -355 -345 2.04498 0.115
NP_441725.1_5 Forward -32 -22 2.04498 0.115
NP_441725.1_5 Reverse -25 -35 2.04498 0.115
NP_441725.1_5 Reverse -348 -358 1.94665 0.115
NP_439966.1_7 Forward -35 -25 15.3192 0.0152
NP_439966.1_7 Forward -358 -348 14.3359 0.0203
NP_439966.1_7 Reverse -345 -355 7.25606 0.15
NP_439966.1_7 Reverse -22 -32 7.25606 0.15
NP_439966.1_7 Forward -110 -100 6.96107 0.16
NP_439966.1_9 Forward -164 -155 3.83464 0.253
NP_442941.1_3 Reverse -348 -358 19.2529 0.00262
NP_442941.1_3 Reverse -25 -35 19.2529 0.00262
NP_442941.1_3 Forward -355 -345 11.0914 0.0116
NP_442941.1_3 Forward -32 -22 11.0914 0.0116
NP_440289.1_2 Forward -359 -346 3.26421 0.0811
NP_440289.1_2 Forward -36 -23 3.06754 0.0811
NP_440289.1_2 Reverse -344 -357 -2.24233 0.253
NP_440289.1_2 Reverse -21 -34 -4.9956 0.294
NP_440260.1_8 Reverse -15 -33 9.45892 0.151
NP_440260.1_8 Forward -48 -30 -2.43913 0.243
NP_441678.1_9 Reverse -5 -24 -2.45882 0.26
NP_441678.1_9 Reverse -44 -63 -3.14714 0.279
NP_442281.1_1 Reverse -342 -356 17.6002 0.00542
NP_442281.1_1 Forward -361 -347 8.25877 0.0832
NP_442281.1_1 Forward -38 -24 7.76712 0.0927
NP_442281.1_1 Reverse -19 -33 7.57046 0.0969
NP_440177.1_9 Reverse -16 -35 15.5357 0.19
NP_442256.1_2 Forward -358 -340 -8.24065 0.218
NP_442256.1_2 Reverse -345 -363 -8.53565 0.227
NP_441087.1_6 Reverse -241 -259 1.00172 0.258
NP_441556.1_4 Reverse -27 -46 12.9937 0.201
NP_441556.1_4 Reverse -90 -109 10.9692 0.261
NP_441644.1_6 Reverse -347 -357 19.0557 0.000803
NP_441644.1_6 Forward -356 -346 17.3841 0.00127
NP_441644.1_6 Forward -33 -23 17.3841 0.00127
NP_441644.1_6 Reverse -24 -34 17.3841 0.00127
NP_441644.1_6 Reverse -87 -97 7.45273 0.124
NP_442215.1_2 Reverse -22 -38 8.41667 0.0657
NP_442215.1_2 Forward -35 -19 -1.71142 0.187
NP_442215.1_2 Forward -358 -342 -4.46469 0.233
NP_442215.1_2 Reverse -84 -100 -5.93965 0.262
NP_442029.1_6 Reverse -19 -38 15.6341 0.0999
NP_440253.1_2 Forward -33 -15 3.65739 0.114
NP_440253.1_2 Reverse -24 -42 1.49411 0.159
NP_440253.1_2 Reverse -99 -117 0.21581 0.192
NP_440929.1_8 Forward -356 -347 19.2726 0.000701
NP_440929.1_8 Reverse -347 -356 19.2726 0.000701
NP_440929.1_8 Forward -33 -24 19.2726 0.000701
NP_440929.1_8 Reverse -24 -33 19.2726 0.000701
NP_440929.1_8 Reverse -360 -369 3.04799 0.238
NP_442933.1_10 Forward -356 -347 17.601 0.00325
NP_442933.1_10 Reverse -347 -356 17.601 0.00325
NP_442933.1_10 Forward -33 -24 17.601 0.00325
NP_442933.1_10 Reverse -24 -33 17.601 0.00325
NP_441751.2_8 Forward -355 -341 4.03116 0.0563
NP_442554.1_8 Reverse -348 -358 17.2863 0.00543
NP_442554.1_8 Reverse -25 -35 16.2046 0.0065
NP_442554.1_8 Forward -355 -345 15.3197 0.00882
NP_442554.1_8 Forward -32 -22 15.3197 0.00882
NP_442554.1_8 Forward -95 -85 2.24165 0.276
NP_442075.1_9 Reverse -250 -269 18.9765 0.0528
NP_441762.1_7 Forward -357 -345 0.530633 0.0747
NP_441762.1_7 Forward -34 -22 0.432302 0.0747
NP_441762.1_7 Reverse -23 -35 -6.74586 0.284
NP_441762.1_7 Reverse -346 -358 -6.84419 0.284
NP_442142.1_4 Reverse -344 -357 11.5234 0.0552
NP_442142.1_4 Forward -36 -23 4.24695 0.227
NP_442142.1_4 Forward -359 -346 3.7553 0.246
NP_442142.1_4 Reverse -21 -34 2.96866 0.269
NP_442292.1_1 Forward -355 -346 18.486 0.00229
NP_442292.1_1 Forward -32 -23 18.486 0.00229
NP_442292.1_1 Reverse -25 -34 18.486 0.00229
NP_442292.1_1 Reverse -348 -357 17.5026 0.00435
NP_440919.1_7 Reverse -50 -68 4.77609 0.287
NP_440045.1_3 Forward -230 -213 17.9343 0.113
NP_442476.1_6 Reverse -25 -39 11.996 0.0525
NP_442476.1_6 Reverse -348 -362 5.89945 0.131
NP_442476.1_6 Forward -355 -341 0.589577 0.252
NP_442476.1_6 Forward -32 -18 0.196253 0.269
NP_443009.1_5 Reverse -346 -357 14.5128 0.02
NP_443009.1_5 Forward -357 -346 10.1862 0.0792
NP_443009.1_5 Reverse -23 -34 8.90795 0.0965
NP_443009.1_5 Forward -34 -23 8.90795 0.0965
NP_443009.1_5 Forward -226 -215 5.07306 0.218
NP_442408.2_1 Reverse -347 -366 -5.11376 0.267
NP_441715.1_4 Reverse -25 -35 17.3846 0.0106
NP_441715.1_4 Reverse -348 -358 16.7946 0.0106
NP_441715.1_4 Forward -355 -345 7.94484 0.107
NP_441715.1_4 Forward -32 -22 7.94484 0.107
NP_440279.1_7 Forward -281 -262 20.8456 0.0934
NP_440183.1_1 Forward -107 -88 10.5209 0.244
NP_440379.1_5 Forward -48 -29 -3.73712 0.205
NP_440379.1_5 Reverse -90 -109 -10.4236 0.28
NP_440464.1_10 Forward -355 -345 13.0082 0.169
NP_440464.1_10 Forward -32 -22 13.0082 0.169
NP_441468.1_1 Forward -355 -348 15.8704 0.0124
NP_441468.1_1 Reverse -348 -355 15.8704 0.0124
NP_441468.1_1 Forward -32 -25 15.8704 0.0124
NP_441468.1_1 Reverse -25 -32 15.8704 0.0124
NP_441015.1_10 Reverse -19 -38 5.50599 0.114
NP_441015.1_10 Reverse -25 -44 -11.0136 0.29
NP_441673.1_1 Forward -356 -347 20.8459 0.000698
NP_441673.1_1 Reverse -347 -356 20.8459 0.000698
NP_441673.1_1 Forward -33 -24 20.8459 0.000698
NP_441673.1_1 Reverse -24 -33 20.8459 0.000698
NP_441673.1_1 Forward -96 -87 -8.06341 0.254
NP_441876.1_9 Forward -49 -39 10.9926 0.28
NP_441826.1_2 Reverse -341 -355 2.16287 0.134
NP_441826.1_2 Forward -39 -25 -1.47537 0.248
NP_441826.1_2 Reverse -18 -32 -3.44199 0.285
NP_441826.1_5 Reverse -25 -44 1.37609 0.291
NP_441330.1_1 Forward -38 -19 7.47261 0.0252
NP_441330.1_1 Forward -361 -342 -11.1119 0.183
NP_442490.1_9 Forward -245 -226 -7.08038 0.275
NP_442868.1_6 Forward -35 -25 19.2529 0.00563
NP_442868.1_6 Forward -358 -348 10.4031 0.038
NP_442868.1_6 Reverse -345 -355 9.81313 0.038
NP_442868.1_6 Reverse -22 -32 9.81313 0.038
NP_442868.1_6 Reverse -85 -95 -0.314959 0.284
NP_442719.1_2 Forward -117 -99 6.01657 0.137
NP_442719.1_2 Forward -346 -328 -1.75153 0.178
NP_442719.1_2 Forward -53 -35 -3.32482 0.2
NP_441056.1_1 Forward -33 -14 -1.57384 0.186
NP_441612.1_2 Reverse -24 -34 8.54929 0.21
NP_441612.1_2 Forward -356 -346 8.54929 0.21
NP_441612.1_2 Forward -33 -23 8.54929 0.21
NP_442227.1_2 Forward -223 -204 9.24257 0.171
NP_442427.1_8 Forward -42 -23 8.75091 0.194
NP_441911.1_7 Reverse -47 -66 -19.0774 0.275
NP_441911.1_10 Forward -71 -52 8.84822 0.25
NP_442808.1_1 Forward -357 -347 8.73102 0.0481
NP_442808.1_1 Reverse -346 -356 8.63269 0.0481
NP_442808.1_1 Reverse -23 -33 8.63269 0.0481
NP_442808.1_1 Forward -34 -24 8.63269 0.0481
NP_442808.1_1 Forward -109 -99 6.66608 0.102
NP_440145.1_3 Reverse -14 -33 9.63589 0.0442
NP_440145.1_3 Reverse -337 -356 -0.000545616 0.138
NP_442542.1_9 Forward -363 -349 13.2736 0.108
NP_442050.1_5 Forward -358 -348 15.9091 0.0091
NP_442050.1_5 Forward -35 -25 14.3359 0.0206
NP_442050.1_5 Reverse -345 -355 7.64939 0.243
NP_442050.1_5 Reverse -22 -32 7.64939 0.243
NP_440558.1_2 Reverse -15 -34 0.196116 0.194
NP_440558.1_2 Forward -42 -23 -6.88371 0.283
NP_440111.2_4 Reverse -82 -101 9.24257 0.239
NP_441878.1_6 Forward -357 -347 10.5014 0.0176
NP_441878.1_6 Reverse -346 -356 10.4031 0.0176
NP_441878.1_6 Forward -34 -24 10.4031 0.0176
NP_441878.1_6 Reverse -23 -33 10.4031 0.0176
NP_441878.1_6 Reverse -86 -96 -0.118297 0.167
NP_441878.1_6 Forward -97 -87 -7.0998 0.204
NP_441036.1_8 Forward -357 -347 15.713 0.00724
NP_441036.1_8 Reverse -346 -356 8.33817 0.174
NP_441036.1_8 Forward -34 -24 8.33817 0.174
NP_441036.1_8 Reverse -23 -33 8.33817 0.174
NP_442650.1_2 Forward -33 -19 8.55439 0.13
NP_442503.1_9 Forward -338 -319 24.5822 0.0152
NP_442721.1_3 Forward -219 -200 12.9791 0.269
NP_440614.1_8 Reverse -219 -238 12.4875 0.237
NP_441557.1_5 Forward -356 -347 19.9609 0.000699
NP_441557.1_5 Reverse -347 -356 19.9609 0.000699
NP_441557.1_5 Forward -33 -24 19.9609 0.000699
NP_441557.1_5 Reverse -24 -33 19.9609 0.000699
NP_441445.1_1 Reverse -319 -338 0.786102 0.269
NP_442066.2_9 Forward -37 -24 10.5407 0.154
NP_442066.2_9 Reverse -343 -356 8.9674 0.183
NP_442962.1_10 Forward -139 -120 19.2723 0.266
NP_442419.1_2 Forward -38 -19 -5.21209 0.295
NP_441458.1_10 Reverse -15 -34 7.66927 0.192
NP_442830.1_5 Forward -46 -32 5.50552 0.233
NP_442183.1_1 Forward -356 -342 11.0127 0.0775
NP_442183.1_1 Forward -33 -19 7.76774 0.131
NP_442166.1_7 Forward -107 -93 7.9644 0.26
NP_442397.1_9 Reverse -340 -359 4.52268 0.254
NP_441574.1_1 Reverse -12 -31 -5.21209 0.26
NP_441549.1_9 Reverse -343 -361 -6.27403 0.198
NP_442347.1_2 Forward -355 -346 12.4878 0.056
NP_442347.1_2 Forward -32 -23 12.4878 0.056
NP_442347.1_2 Reverse -25 -34 12.4878 0.056
NP_442347.1_2 Reverse -308 -317 6.68623 0.156
NP_442347.1_2 Reverse -348 -357 3.34298 0.284
NP_442645.1_2 Reverse -16 -35 -2.75381 0.0487
NP_442645.1_2 Reverse -339 -358 -12.9802 0.144
NP_442645.1_2 Forward -41 -22 -22.0267 0.29
NP_440547.1_1 Forward -50 -31 8.75009 0.256
NP_441037.1_4 Reverse -358 -368 9.94904 0.21
NP_441037.1_4 Reverse -345 -355 7.9999 0.237
NP_441037.1_4 Reverse -22 -32 7.9999 0.237
NP_441037.1_4 Forward -358 -348 7.22024 0.237
NP_442594.1_7 Reverse -336 -355 8.4551 0.187
NP_440690.1_1 Forward -260 -241 11.7992 0.249
NP_442317.1_6 Reverse -342 -361 1.96607 0.293
NP_441633.1_3 Forward -35 -22 3.46087 0.0699
NP_441633.1_3 Reverse -22 -35 1.19926 0.109
NP_441633.1_3 Reverse -345 -358 1.10092 0.109
NP_441633.1_3 Forward -358 -345 -3.71729 0.177
NP_441633.1_3 Reverse -118 -131 -4.89726 0.216
NP_441633.1_5 Forward -329 -310 16.091 0.28
NP_440136.1_2 Forward -355 -348 15.9687 0.0123
NP_440136.1_2 Reverse -348 -355 15.9687 0.0123
NP_440136.1_2 Forward -32 -25 15.9687 0.0123
NP_440136.1_2 Reverse -25 -32 15.9687 0.0123
NP_440136.1_2 Reverse -100 -107 4.26735 0.218
NP_442998.1_5 Reverse -43 -53 14.3364 0.149
NP_442998.1_5 Reverse -5 -15 11.8781 0.176
NP_442998.1_5 Reverse -44 -54 11.3864 0.187
NP_442998.1_5 Forward -258 -248 7.94484 0.278
NP_442998.1_10 Forward -354 -347 15.5754 0.0102
NP_442998.1_10 Reverse -349 -356 15.5754 0.0102
NP_442998.1_10 Forward -31 -24 15.5754 0.0102
NP_442998.1_10 Reverse -26 -33 15.5754 0.0102
NP_442998.1_10 Reverse -186 -193 10.2655 0.0946
NP_440299.1_1 Reverse -20 -33 22.7331 0.000547
NP_440299.1_1 Forward -37 -24 20.6681 0.00128
NP_440299.1_1 Reverse -343 -356 4.34528 0.209
NP_441799.1_1 Reverse -343 -357 16.8135 0.0129
NP_441799.1_1 Forward -360 -346 16.2235 0.0153
NP_441799.1_1 Reverse -20 -34 6.98048 0.155
NP_441799.1_1 Forward -37 -23 4.71887 0.238
NP_441007.1_5 Reverse -25 -44 9.83255 0.225
NP_441007.1_10 Reverse -342 -355 9.85238 0.083
NP_441007.1_10 Forward -361 -348 1.39592 0.203
NP_441007.1_10 Reverse -205 -218 1.39592 0.203
NP_441007.1_10 Reverse -19 -32 1.00259 0.209
NP_441007.1_10 Forward -38 -25 -0.964025 0.296
NP_440256.1_1 Reverse -344 -363 22.9106 0.00264
NP_440256.1_1 Reverse -21 -40 6.09597 0.0316
NP_440256.1_1 Forward -36 -17 -7.37537 0.234
NP_441229.1_10 Reverse -14 -33 -0.0988766 0.288
NP_441559.1_8 Reverse -189 -203 3.34284 0.143
NP_441559.1_8 Forward -361 -347 1.47456 0.155
NP_441559.1_8 Forward -38 -24 -5.90027 0.271
NP_441559.1_8 Forward -351 -337 -5.9986 0.271
NP_440915.1_6 Forward -37 -23 10.3243 0.0322
NP_440915.1_6 Reverse -343 -357 3.8345 0.1
NP_440915.1_6 Reverse -20 -34 3.44117 0.101
NP_440915.1_6 Forward -100 -86 1.37622 0.141
NP_441296.1_9 Forward -44 -31 9.75346 0.277
NP_440717.1_1 Forward -109 -90 6.78429 0.265
NP_442785.1_7 Forward -358 -344 10.6193 0.228
NP_441704.1_8 Reverse -13 -32 12.4867 0.122
NP_440748.1_2 Reverse -262 -281 22.2956 0.0404
NP_441464.1_8 Forward -356 -342 3.63784 0.291
NP_442150.1_2 Forward -259 -240 16.7341 0.215
NP_442993.1_1 Reverse -99 -115 -7.90627 0.148
NP_442386.1_9 Reverse -346 -355 13.8639 0.0289
NP_442386.1_9 Reverse -23 -32 13.8639 0.0289
NP_442386.1_9 Forward -34 -25 13.8639 0.0289
NP_442386.1_9 Forward -357 -348 6.39082 0.219
NP_442386.1_9 Forward -109 -100 5.60418 0.245
NP_440570.1_5 Reverse -14 -33 3.93269 0.231
NP_440570.1_5 Reverse -89 -108 1.37609 0.239
NP_441340.1_5 Forward -355 -348 15.6737 0.0124
NP_441340.1_5 Reverse -348 -355 15.6737 0.0124
NP_441340.1_5 Forward -32 -25 15.6737 0.0124
NP_441340.1_5 Reverse -25 -32 15.6737 0.0124
NP_442484.1_2 Forward -44 -25 27.2371 0.00215
NP_442484.1_2 Reverse -88 -107 4.22769 0.19
NP_440194.1_3 Reverse -337 -356 1.27776 0.277
NP_442240.1_1 Reverse -262 -281 3.53858 0.288
NP_442950.1_1 Forward -262 -243 4.52268 0.178
NP_442950.1_2 Forward -292 -273 8.75091 0.291
NP_442950.1_3 Forward -199 -180 25.0739 0.00406
NP_440586.1_8 Forward -355 -348 13.2151 0.026
NP_440586.1_8 Forward -32 -25 13.2151 0.026
NP_440586.1_8 Reverse -348 -355 13.2151 0.026
NP_440586.1_8 Reverse -25 -32 13.2151 0.026
NP_442251.1_6 Forward -355 -348 15.2804 0.0124
NP_442251.1_6 Reverse -348 -355 15.2804 0.0124
NP_442251.1_6 Forward -32 -25 15.2804 0.0124
NP_442251.1_6 Reverse -25 -32 15.2804 0.0124
NP_440684.1_9 Reverse -341 -355 12.9793 0.168
NP_440684.1_9 Reverse -18 -32 8.25939 0.233
NP_441262.1_3 Reverse -347 -354 14.7888 0.0223
NP_441262.1_3 Reverse -24 -31 14.7888 0.0223
NP_441262.1_3 Forward -356 -349 14.7888 0.0223
NP_441262.1_3 Forward -33 -26 14.7888 0.0223
NP_440027.1_8 Reverse -344 -363 5.60352 0.279
NP_440027.1_8 Reverse -21 -40 4.32522 0.291
NP_443051.1_1 Forward -357 -348 19.5676 0.00335
NP_443051.1_1 Reverse -346 -355 10.4228 0.00754
NP_443051.1_1 Reverse -23 -32 10.4228 0.00754
NP_443051.1_1 Forward -34 -25 10.4228 0.00754
NP_443051.1_1 Reverse -98 -107 0.0980582 0.226
NP_439937.1_9 Reverse -23 -40 -16.2847 0.287
NP_442294.1_3 Forward -58 -44 12.487 0.283
NP_442294.1_3 Reverse -13 -27 12.192 0.29
NP_440408.1_7 Reverse -24 -43 8.65258 0.272
NP_440439.1_1 Forward -359 -346 13.1956 0.0211
NP_439943.1_7 Reverse -19 -38 8.35759 0.183
NP_440372.1_2 Forward -355 -348 16.3621 0.0124
NP_440372.1_2 Reverse -348 -355 16.3621 0.0124
NP_440372.1_2 Forward -32 -25 16.3621 0.0124
NP_440372.1_2 Reverse -25 -32 16.3621 0.0124
NP_441789.1_7 Forward -218 -199 -3.63955 0.277
NP_440819.1_5 Reverse -4 -12 7.59091 0.272
NP_441803.1_2 Reverse -94 -113 0.884433 0.243
NP_439977.1_5 Forward -39 -20 3.44104 0.159
NP_439977.1_5 Reverse -18 -37 2.85105 0.166
NP_439977.1_7 Reverse -13 -32 12.88 0.262
NP_440139.1_1 Forward -362 -343 5.01354 0.168
NP_440267.1_2 Forward -361 -347 11.9953 0.125
NP_442384.1_10 Reverse -24 -37 21.1604 0.00194
NP_442384.1_10 Forward -33 -20 17.7189 0.00567
NP_442384.1_10 Reverse -347 -360 11.524 0.0348
NP_442384.1_10 Forward -356 -343 8.18076 0.0685
NP_442384.1_10 Reverse -307 -320 6.90245 0.092
NP_441877.1_5 Forward -175 -156 5.50599 0.195
NP_441877.1_7 Forward -38 -19 5.30853 0.218
NP_441018.1_6 Reverse -354 -373 17.109 0.129
NP_441018.1_7 Reverse -20 -39 8.65258 0.241
NP_441018.1_7 Forward -37 -18 7.07928 0.277
NP_442790.1_4 Reverse -338 -357 -7.67036 0.156
NP_442262.1_10 Forward -355 -348 14.1988 0.0123
NP_442262.1_10 Reverse -348 -355 14.1988 0.0123
NP_442262.1_10 Forward -32 -25 14.1988 0.0123
NP_442262.1_10 Reverse -25 -32 14.1988 0.0123
NP_441689.1_5 Forward -358 -348 8.3377 0.132
NP_441689.1_5 Forward -35 -25 5.78111 0.197
NP_441689.1_5 Reverse -345 -355 5.78111 0.197
NP_441689.1_5 Reverse -22 -32 5.78111 0.197
NP_440344.1_10 Forward -40 -23 -4.97604 0.102
NP_440344.1_10 Reverse -17 -34 -7.43431 0.117
NP_440344.1_10 Forward -136 -119 -11.4659 0.215
NP_440282.1_10 Reverse -89 -108 -8.752 0.263
NP_440531.1_6 Forward -364 -345 7.37428 0.0998
NP_440531.1_8 Forward -371 -352 3.04771 0.279
NP_442910.1_1 Reverse -340 -359 -6.29373 0.254
NP_440562.1_10 Forward -365 -347 7.09898 0.284
NP_441965.1_3 Forward -43 -24 1.57275 0.22
NP_441965.1_3 Forward -366 -347 0.294447 0.238
NP_441965.1_10 Forward -359 -343 10.8749 0.107
NP_441965.1_10 Reverse -304 -320 8.80999 0.123
NP_441965.1_10 Forward -36 -20 2.61514 0.285
NP_441640.1_8 Reverse -25 -44 -6.09707 0.296
NP_440297.1_8 Forward -96 -78 12.3105 0.241
NP_440297.1_8 Reverse -16 -34 11.7205 0.241
NP_440297.1_9 Forward -355 -345 -0.118297 0.282
NP_440297.1_9 Forward -32 -22 -0.118297 0.282
NP_440297.1_9 Reverse -25 -35 -0.118297 0.282
NP_440297.1_9 Reverse -348 -358 -0.216628 0.282
NP_441592.1_4 Forward -33 -14 4.916 0.144
NP_441896.1_3 Reverse -15 -34 3.04771 0.179
NP_440894.1_10 Forward -113 -94 2.45773 0.29
NP_440834.1_9 Forward -134 -115 18.6823 0.114
NP_440999.1_9 Forward -37 -23 2.2612 0.152
NP_440999.1_9 Forward -360 -346 -0.295402 0.203
NP_440999.1_9 Reverse -343 -357 -1.37704 0.236
NP_440888.1_2 Reverse -24 -38 20.4518 0.000632
NP_440888.1_2 Reverse -347 -361 15.2402 0.0118
NP_440888.1_2 Forward -33 -19 11.602 0.0635
NP_440888.1_2 Forward -245 -231 8.94708 0.142
NP_440888.1_2 Forward -356 -342 6.68548 0.223
NP_440888.1_2 Forward -216 -202 5.99717 0.254
NP_440600.1_4 Forward -41 -23 -1.16082 0.163
NP_440600.1_4 Forward -364 -346 -1.35749 0.163
NP_440600.1_4 Reverse -16 -34 -7.749 0.294
NP_440179.1_6 Forward -32 -13 8.45592 0.204
NP_442147.1_6 Reverse -85 -99 16.9119 0.205
NP_440052.1_5 Reverse -13 -32 5.50599 0.109
NP_440052.1_5 Forward -44 -25 -1.86883 0.205
NP_442948.1_2 Reverse -346 -365 9.3409 0.173
NP_442277.1_4 Forward -365 -346 1.27698 0.285
NP_442033.1_10 Forward -35 -16 -7.67036 0.186
NP_440575.1_1 Forward -22 -3 -1.18128 0.29
NP_441538.1_2 Forward -328 -309 13.3647 0.299
NP_441543.1_2 Forward -355 -346 16.9127 0.00359
NP_441543.1_2 Forward -32 -23 16.9127 0.00359
NP_441543.1_2 Reverse -25 -34 16.9127 0.00359
NP_441543.1_2 Reverse -348 -357 15.9293 0.00518
NP_441543.1_2 Forward -107 -98 4.71961 0.222
NP_442845.1_2 Reverse -18 -32 7.9644 0.195
NP_442845.1_2 Reverse -202 -216 6.3911 0.21
NP_442845.1_2 Forward -39 -25 6.19444 0.215
NP_442845.1_2 Reverse -341 -355 4.71948 0.254
NP_442845.1_2 Forward -322 -308 4.03116 0.271
NP_442845.1_2 Forward -362 -348 3.63784 0.282
NP_441834.1_10 Reverse -19 -38 0.884433 0.287
NP_441178.1_6 Forward -220 -201 2.75194 0.27
NP_441469.1_8 Forward -357 -348 6.5879 0.227
NP_441469.1_8 Reverse -346 -355 6.48957 0.227
NP_441469.1_8 Forward -34 -25 6.48957 0.227
NP_441469.1_8 Reverse -23 -32 6.48957 0.227
NP_441469.1_8 Forward -109 -100 6.09625 0.236
NP_441469.1_8 Reverse -359 -368 5.21127 0.283
NP_443064.1_6 Forward -356 -346 12.5669 0.0796
NP_443064.1_6 Forward -33 -23 12.5669 0.0796
NP_443064.1_6 Reverse -24 -34 12.5669 0.0796
NP_443064.1_6 Forward -316 -306 11.5004 0.13
NP_443064.1_6 Reverse -347 -357 10.8217 0.13
NP_442578.1_7 Forward -355 -348 14.5921 0.026
NP_442578.1_7 Forward -32 -25 14.5921 0.026
NP_442578.1_7 Reverse -348 -355 14.5921 0.026
NP_442578.1_7 Reverse -25 -32 14.5921 0.026
NP_442578.1_7 Reverse -335 -342 6.72562 0.18
NP_440710.1_1 Forward -364 -346 -8.83064 0.282
NP_441462.1_2 Reverse -347 -357 20.2362 0.000805
NP_441462.1_2 Forward -356 -346 11.5831 0.00406
NP_441462.1_2 Forward -33 -23 11.5831 0.00406
NP_441462.1_2 Reverse -24 -34 11.5831 0.00406
NP_441462.1_2 Forward -96 -86 -0.806614 0.254
NP_441462.1_2 Reverse -87 -97 -0.904945 0.265
NP_441929.1_1 Forward -193 -174 12.5858 0.266
NP_441929.1_3 Forward -256 -237 19.2723 0.0451
NP_441929.1_4 Forward -229 -210 16.3215 0.0272
NP_441929.1_5 Forward -337 -318 14.3558 0.0988
NP_441929.1_7 Forward -169 -150 16.1257 0.166
NP_443062.1_1 Reverse -24 -42 11.1786 0.103
NP_443062.1_1 Forward -356 -338 10.9836 0.106
NP_443062.1_1 Reverse -307 -325 7.76586 0.168
NP_443062.1_6 Reverse -339 -358 9.83255 0.12
NP_442204.1_1 Forward -100 -89 9.79344 0.0736
NP_442204.1_1 Forward -360 -349 9.59678 0.0736
NP_442204.1_1 Forward -37 -26 2.12362 0.266
NP_442204.1_1 Reverse -95 -106 0.94365 0.281
NP_441351.1_8 Forward -35 -16 5.11266 0.204
NP_440516.1_2 Reverse -341 -359 12.0155 0.0708
NP_440516.1_8 Forward -356 -347 16.9127 0.00442
NP_440516.1_8 Reverse -347 -356 16.9127 0.00442
NP_440516.1_8 Forward -33 -24 16.9127 0.00442
NP_440516.1_8 Reverse -24 -33 16.9127 0.00442
NP_440516.1_8 Reverse -99 -108 -0.491928 0.262
NP_442428.1_5 Forward -355 -348 15.8704 0.0124
NP_442428.1_5 Reverse -348 -355 15.8704 0.0124
NP_442428.1_5 Forward -32 -25 15.8704 0.0124
NP_442428.1_5 Reverse -25 -32 15.8704 0.0124
NP_441867.1_2 Reverse -230 -249 -11.5053 0.231
NP_440673.1_2 Reverse -14 -33 12.4382 0.149
NP_440673.1_2 Reverse -337 -356 10.6822 0.198
NP_440673.1_3 Forward -354 -347 12.4288 0.0426
NP_440673.1_3 Forward -31 -24 12.4288 0.0426
NP_440673.1_3 Reverse -349 -356 12.4288 0.0426
NP_440673.1_3 Reverse -26 -33 12.4288 0.0426
NP_441052.1_2 Forward -356 -346 19.9412 0.00106
NP_441052.1_2 Forward -33 -23 19.9412 0.00106
NP_441052.1_2 Reverse -24 -34 19.9412 0.00106
NP_441052.1_2 Reverse -347 -357 10.4031 0.0285
NP_441052.1_2 Forward -108 -98 5.87989 0.0998
NP_441052.1_2 Forward -245 -235 3.22496 0.182
NP_442219.1_8 Reverse -14 -33 13.6752 0.152
NP_442219.1_9 Forward -355 -346 17.7976 0.00718
NP_442219.1_9 Forward -32 -23 17.7976 0.00718
NP_442219.1_9 Reverse -25 -34 17.7976 0.00718
NP_442219.1_9 Reverse -348 -357 8.25953 0.0681
NP_440436.1_4 Forward -355 -346 17.2072 0.00233
NP_440436.1_4 Forward -32 -23 17.2072 0.00233
NP_440436.1_4 Reverse -25 -34 17.2072 0.00233
NP_440436.1_4 Reverse -348 -357 9.24241 0.0871
NP_441884.1_9 Reverse -344 -363 -22.125 0.275
NP_440314.1_9 Forward -355 -336 -2.36049 0.155
NP_440314.1_9 Forward -32 -13 -7.17871 0.237
NP_440314.1_9 Reverse -25 -44 -8.752 0.253
NP_440041.1_6 Reverse -40 -59 8.75009 0.285
NP_441719.1_4 Forward -355 -348 16.3621 0.0124
NP_441719.1_4 Reverse -348 -355 16.3621 0.0124
NP_441719.1_4 Forward -32 -25 16.3621 0.0124
NP_441719.1_4 Reverse -25 -32 16.3621 0.0124
NP_441719.1_6 Forward -29 -10 10.9134 0.269
NP_441004.1_1 Reverse -19 -38 -11.3086 0.237
NP_441004.1_1 Reverse -18 -37 -16.5201 0.286
NP_441004.1_2 Reverse -205 -224 0.687771 0.23
NP_442813.1_4 Forward -137 -118 -5.70374 0.299
NP_442366.1_3 Forward -357 -339 -2.83245 0.234
NP_442366.1_5 Reverse -21 -31 15.4175 0.0374
NP_442366.1_5 Reverse -344 -354 14.8275 0.0375
NP_442366.1_5 Forward -319 -309 10.501 0.261
NP_442873.1_9 Reverse -14 -33 7.66846 0.236
NP_441729.1_1 Reverse -31 -50 14.8474 0.281
NP_441115.1_4 Reverse -23 -41 8.76983 0.237
NP_442206.1_10 Forward -356 -341 3.22482 0.188
NP_440328.1_4 Reverse -341 -360 6.4893 0.129
NP_440094.1_9 Reverse -23 -42 1.57275 0.199
NP_443054.1_2 Forward -358 -344 9.04604 0.102
NP_443054.1_2 Forward -97 -83 8.16106 0.127
NP_443054.1_2 Forward -35 -21 -0.393733 0.294
NP_441851.1_10 Reverse -346 -356 15.8113 0.00552
NP_441851.1_10 Forward -34 -24 15.8113 0.00552
NP_441851.1_10 Reverse -23 -33 15.8113 0.00552
NP_441851.1_10 Forward -357 -347 8.53483 0.114
NP_442622.1_8 Reverse -347 -365 -18.6637 0.243
NP_441668.1_4 Reverse -337 -356 16.9124 0.0435
NP_442515.1_1 Reverse -23 -37 11.406 0.0412
NP_442515.1_1 Reverse -346 -360 10.0294 0.0568
NP_442515.1_1 Forward -34 -20 4.42448 0.107
NP_442515.1_1 Forward -357 -343 -4.62196 0.298
NP_440593.1_3 Forward -38 -19 16.8141 0.0714
NP_440593.1_3 Reverse -19 -38 1.67108 0.187
NP_440593.1_3 Reverse -256 -275 -6.49039 0.277
NP_441982.1_6 Reverse -3 -12 11.6259 0.288
NP_441982.1_6 Forward -179 -170 10.7665 0.292
NP_442709.1_3 Reverse -340 -359 8.55425 0.121
NP_442709.1_6 Forward -170 -151 15.4374 0.219
NP_441046.1_2 Reverse -336 -355 2.16274 0.242
NP_442689.1_8 Forward -170 -153 -7.92597 0.292
NP_441349.1_10 Forward -366 -347 17.3057 0.00906
NP_441349.1_10 Reverse -337 -356 7.66927 0.0298
NP_441349.1_10 Forward -43 -24 -5.40875 0.201
NP_440432.1_9 Reverse -348 -363 13.2546 0.0201
NP_440432.1_9 Forward -355 -340 -3.26502 0.179
NP_440432.1_9 Reverse -25 -40 -4.64166 0.216
NP_442944.1_9 Forward -42 -23 15.1424 0.276
NP_440396.1_1 Forward -151 -132 -1.86883 0.214
NP_441596.1_7 Forward -65 -46 7.86593 0.258
NP_440431.1_3 Reverse -23 -42 -3.63879 0.178
NP_442450.1_5 Reverse -345 -355 7.55152 0.13
NP_442450.1_5 Reverse -22 -32 7.55152 0.13
NP_442168.1_5 Forward -32 -13 3.14605 0.232
NP_440588.1_2 Forward -365 -346 -0.590531 0.151
NP_440588.1_2 Forward -42 -23 -5.40875 0.25
NP_440195.1_4 Forward -45 -26 8.06259 0.227
NP_440943.1_6 Reverse -334 -353 19.6656 0.202
NP_442006.1_2 Reverse -93 -110 -16.3824 0.25
NP_441003.1_9 Reverse -84 -103 9.3409 0.214
NP_441003.1_9 Forward -105 -86 5.01433 0.271
NP_440483.1_1 Forward -101 -82 -2.0655 0.208
NP_440483.1_1 Reverse -202 -221 -8.752 0.295
NP_442243.1_1 Forward -39 -21 15.2596 0.106
NP_442243.1_1 Forward -362 -344 10.3431 0.126
NP_442243.1_1 Forward -102 -84 -1.75153 0.279
NP_441570.1_1 Reverse -347 -365 -7.65067 0.0925
NP_441570.1_1 Forward -356 -338 -8.73231 0.12
NP_441570.1_1 Reverse -24 -42 -16.5988 0.249
NP_441570.1_1 Forward -33 -15 -16.9921 0.26
NP_441078.1_4 Forward -356 -347 19.6659 0.0007
NP_441078.1_4 Reverse -347 -356 19.6659 0.0007
NP_441078.1_4 Forward -33 -24 19.6659 0.0007
NP_441078.1_4 Reverse -24 -33 19.6659 0.0007
NP_441078.1_4 Forward -108 -99 5.70292 0.111
NP_441078.1_4 Forward -96 -87 -1.77023 0.266
NP_442729.1_8 Forward -37 -24 9.36073 0.125
NP_442729.1_8 Reverse -20 -33 9.36073 0.125
NP_441539.1_1 Forward -175 -161 14.5519 0.284
NP_440707.1_6 Forward -364 -345 14.5516 0.172
NP_442443.1_1 Reverse -200 -219 -3.93378 0.267
NP_440526.1_3 Forward -355 -344 10.2846 0.0646
NP_440526.1_3 Forward -32 -21 1.04151 0.267
NP_440526.1_3 Reverse -25 -36 1.04151 0.267
NP_441432.1_8 Reverse -346 -355 16.8143 0.00595
NP_441432.1_8 Reverse -23 -32 16.8143 0.00595
NP_441432.1_8 Forward -357 -348 16.8143 0.00595
NP_441432.1_8 Forward -34 -25 16.8143 0.00595
NP_441432.1_9 Forward -82 -69 8.01662 0.295
NP_442320.1_8 Forward -39 -25 13.7659 0.0144
NP_442320.1_8 Reverse -18 -32 6.29277 0.029
NP_442320.1_8 Forward -362 -348 -2.85201 0.1
NP_442320.1_8 Reverse -341 -355 -4.81863 0.188
NP_441732.1_2 Forward -360 -344 -6.82463 0.0533
NP_441732.1_2 Reverse -20 -36 -6.82463 0.0533
NP_441732.1_2 Forward -37 -21 -15.3794 0.145
NP_441732.1_2 Reverse -343 -359 -16.3627 0.165
NP_441732.1_2 Reverse -95 -111 -16.8544 0.207
NP_442003.1_4 Reverse -25 -44 10.6192 0.288
NP_440760.1_1 Forward -33 -14 5.70265 0.0118
NP_440760.1_1 Forward -356 -337 -6.58872 0.0608
NP_440760.1_1 Reverse -24 -43 -12.1936 0.0915
NP_440760.1_1 Forward -96 -77 -22.2233 0.252
NP_440199.1_10 Reverse -344 -354 7.25653 0.231
NP_442353.1_4 Reverse -18 -37 2.45694 0.229
NP_442353.1_4 Forward -39 -20 0.490334 0.268
NP_440913.1_1 Forward -358 -340 5.82068 0.234
NP_440713.1_4 Forward -43 -24 1.27776 0.289
NP_442489.1_2 Forward -38 -19 6.98095 0.172
NP_442489.1_7 Forward -356 -347 20.1576 0.000695
NP_442489.1_7 Reverse -347 -356 20.1576 0.000695
NP_442489.1_7 Forward -33 -24 20.1576 0.000695
NP_442489.1_7 Reverse -24 -33 20.1576 0.000695
NP_442489.1_7 Forward -96 -87 -1.27858 0.185
NP_442079.1_7 Reverse -25 -44 0.786102 0.27
NP_440559.1_1 Forward -355 -346 17.4043 0.00658
NP_440559.1_1 Forward -32 -23 17.4043 0.00658
NP_440559.1_1 Reverse -25 -34 17.4043 0.00658
NP_440559.1_1 Reverse -348 -357 8.65285 0.0586
NP_441659.2_8 Reverse -347 -357 20.9245 0.000805
NP_441659.2_8 Forward -356 -346 18.1713 0.00133
NP_441659.2_8 Forward -33 -23 18.1713 0.00133
NP_441659.2_8 Reverse -24 -34 18.1713 0.00133
NP_441659.2_8 Reverse -87 -97 12.7631 0.0147
NP_441022.1_1 Reverse -164 -173 15.0954 0.183
NP_441022.1_1 Forward -174 -165 12.4095 0.232
NP_440363.1_8 Reverse -208 -227 11.0125 0.288
NP_442913.1_10 Reverse -338 -357 10.1275 0.0423
NP_442913.1_10 Reverse -15 -34 1.47442 0.142
NP_442913.1_10 Forward -42 -23 0.392778 0.154
NP_442913.1_10 Forward -365 -346 -0.787193 0.165
NP_441040.1_2 Forward -105 -86 -7.86702 0.227
NP_442008.1_2 Reverse -200 -219 5.01433 0.231
NP_442346.1_5 Reverse -346 -356 16.6963 0.00248
NP_442346.1_5 Forward -34 -24 16.6963 0.00248
NP_442346.1_5 Reverse -23 -33 16.6963 0.00248
NP_442346.1_5 Forward -357 -347 16.303 0.00248
NP_442346.1_5 Reverse -215 -225 4.20827 0.296
NP_442346.1_10 Forward -50 -31 3.83436 0.193
NP_440352.1_5 Reverse -34 -53 18.0092 0.0576
NP_440352.1_5 Forward -70 -51 9.73562 0.289
NP_440545.1_3 Reverse -343 -360 -4.38605 0.224
NP_440545.1_3 Reverse -20 -37 -4.58271 0.229
NP_440555.1_1 Reverse -13 -32 10.7175 0.112
NP_440459.1_2 Reverse -22 -39 12.3302 0.151
NP_440459.1_2 Reverse -111 -128 8.88863 0.246
NP_441653.1_2 Reverse -25 -44 6.23536 0.235
NP_441653.1_2 Forward -44 -25 5.07576 0.248
NP_440010.1_4 Reverse -232 -251 -3.04956 0.294
NP_442311.1_8 Reverse -200 -219 12.6841 0.209
NP_440847.1_8 Reverse -50 -69 12.0942 0.277
NP_442603.1_7 Reverse -24 -38 20.7467 0.00695
NP_441888.1_7 Forward -38 -24 3.04785 0.225
NP_441050.1_5 Reverse -212 -230 -0.570838 0.256
NP_441833.1_4 Forward -355 -348 15.9687 0.0124
NP_441833.1_4 Reverse -348 -355 15.9687 0.0124
NP_441833.1_4 Forward -32 -25 15.9687 0.0124
NP_441833.1_4 Reverse -25 -32 15.9687 0.0124
NP_442799.1_4 Reverse -332 -351 8.35759 0.268
NP_441895.1_10 Reverse -1 -20 -18.7818 0.282
NP_441112.1_6 Forward -366 -347 -0.0988766 0.283
NP_441112.1_7 Reverse -46 -65 12.9791 0.177
NP_442162.1_9 Forward -355 -348 16.2637 0.0124
NP_442162.1_9 Reverse -348 -355 16.2637 0.0124
NP_442162.1_9 Forward -32 -25 16.2637 0.0124
NP_442162.1_9 Reverse -25 -32 16.2637 0.0124
NP_442796.1_10 Reverse -201 -220 7.86593 0.27
NP_440224.1_1 Forward -367 -348 2.94938 0.132
NP_440772.1_6 Forward -199 -180 7.57094 0.292
NP_442199.1_5 Forward -41 -22 -2.0655 0.185
NP_442199.1_5 Forward -364 -345 -3.73712 0.211
NP_442199.1_7 Reverse -128 -147 3.53858 0.245
NP_442140.1_3 Forward -355 -345 12.2714 0.0632
NP_442140.1_3 Forward -32 -22 12.2714 0.0632
NP_442140.1_3 Reverse -25 -35 10.3048 0.0902
NP_442140.1_3 Reverse -348 -358 4.69992 0.238
NP_440875.1_9 Reverse -349 -359 13.5309 0.0677
NP_441813.1_5 Forward -358 -348 18.1713 0.00743
NP_441813.1_5 Forward -35 -25 18.1713 0.00743
NP_441813.1_5 Reverse -345 -355 8.63316 0.0367
NP_441813.1_5 Reverse -22 -32 8.63316 0.0367
NP_440590.1_4 Reverse -25 -38 19.4888 0.00651
NP_440590.1_4 Forward -32 -19 17.6205 0.00882
NP_440590.1_4 Reverse -348 -361 3.16588 0.0756
NP_440590.1_4 Forward -355 -342 2.37923 0.0913
NP_440567.1_1 Reverse -25 -39 7.17775 0.0764
NP_440567.1_1 Forward -32 -18 5.40779 0.103
NP_440567.1_1 Forward -355 -341 3.34284 0.145
NP_440567.1_1 Reverse -348 -362 3.24451 0.148
NP_442497.1_10 Reverse -348 -357 17.601 0.00813
NP_442497.1_10 Forward -355 -346 10.4228 0.0087
NP_442497.1_10 Forward -32 -23 10.4228 0.0087
NP_442497.1_10 Reverse -25 -34 10.4228 0.0087
NP_442497.1_10 Reverse -361 -370 -1.18024 0.256
NP_440821.1_4 Reverse -345 -355 9.41981 0.0286
NP_440821.1_4 Reverse -22 -32 9.41981 0.0286
NP_440821.1_4 Forward -35 -25 9.41981 0.0286
NP_440821.1_4 Forward -358 -348 2.24165 0.131
NP_440821.1_4 Forward -371 -361 -0.41329 0.257
NP_440821.1_4 Reverse -358 -368 -0.806614 0.296
NP_441239.1_9 Forward -358 -346 13.0187 0.0389
NP_441239.1_9 Forward -35 -23 5.25052 0.223
NP_441239.1_9 Reverse -345 -357 3.38223 0.285
NP_441239.1_9 Reverse -22 -34 3.38223 0.285
NP_440156.1_4 Forward -55 -45 13.9425 0.176
NP_440624.1_5 Forward -64 -46 11.4272 0.192
NP_440665.1_1 Forward -108 -89 -16.8151 0.293
NP_442044.1_1 Reverse -94 -113 -13.3736 0.277
NP_442270.1_9 Reverse -13 -32 0.982764 0.14
NP_442270.1_9 Reverse -336 -355 -9.047 0.226
NP_441017.1_6 Forward -37 -23 13.6669 0.179
NP_441617.1_6 Reverse -49 -68 1.57275 0.203
NP_442809.1_6 Reverse -108 -127 0.196116 0.295
NP_440546.1_4 Reverse -347 -357 13.5365 0.0459
NP_440546.1_4 Forward -356 -346 10.046 0.109
NP_440546.1_4 Forward -33 -23 10.046 0.109
NP_440546.1_4 Reverse -24 -34 10.046 0.109
NP_440546.1_4 Forward -193 -183 9.07643 0.156
NP_440546.1_4 Reverse -99 -109 6.94336 0.269
NP_443033.1_3 Forward -26 -7 11.6025 0.268
NP_441230.1_5 Forward -38 -19 1.47442 0.24
NP_441230.1_5 Forward -361 -342 1.27776 0.246
NP_440462.1_6 Forward -358 -348 18.7612 0.00454
NP_440462.1_6 Forward -35 -25 9.61647 0.0429
NP_440462.1_6 Reverse -345 -355 1.35667 0.294
NP_440462.1_6 Reverse -22 -32 1.35667 0.294
NP_440868.1_4 Forward -360 -348 17.3452 0.0124
NP_440868.1_4 Reverse -343 -355 8.20045 0.0602
NP_440868.1_4 Forward -37 -25 0.923956 0.196
NP_440868.1_4 Reverse -20 -32 -0.944332 0.284
NP_440868.1_7 Forward -354 -335 14.9449 0.241
NP_441204.1_1 Reverse -227 -246 6.39097 0.263
NP_442499.1_3 Forward -34 -16 3.65739 0.289
NP_442479.1_9 Forward -173 -154 -1.86883 0.21
NP_442479.1_9 Forward -56 -37 -6.09707 0.266
NP_440812.1_1 Forward -45 -26 0.884433 0.267
NP_442402.1_4 Forward -22 -3 -2.8529 0.208
NP_442402.1_4 Reverse -54 -73 -3.44288 0.216
NP_442402.1_4 Forward -352 -333 -8.85106 0.284
NP_441848.1_4 Reverse -155 -171 14.2351 0.172
NP_441848.1_4 Reverse -38 -54 7.45517 0.288
NP_441848.1_7 Forward -227 -208 3.34192 0.217
NP_441848.1_7 Reverse -46 -65 -3.14789 0.277
NP_441084.1_6 Forward -358 -344 15.0646 0.0931
NP_441084.1_6 Forward -67 -53 14.7737 0.0972
NP_441084.1_6 Forward -253 -239 9.63499 0.273
NP_442460.1_7 Reverse -335 -354 -0.787193 0.292
NP_440696.1_3 Reverse -347 -365 -1.06249 0.251
NP_441843.2_9 Reverse -349 -367 11.5619 0.205
NP_442039.1_4 Forward -355 -348 15.1821 0.0124
NP_442039.1_4 Reverse -348 -355 15.1821 0.0124
NP_442039.1_4 Forward -32 -25 15.1821 0.0124
NP_442039.1_4 Reverse -25 -32 15.1821 0.0124
NP_442039.1_7 Reverse -1 -11 8.33817 0.263
NP_441811.1_8 Reverse -18 -32 13.0776 0.194
NP_440825.1_7 Forward -355 -345 12.9096 0.152
NP_440825.1_7 Forward -32 -22 12.9096 0.152
NP_442837.1_3 Forward -355 -348 15.7721 0.0124
NP_442837.1_3 Reverse -348 -355 15.7721 0.0124
NP_442837.1_3 Forward -32 -25 15.7721 0.0124
NP_442837.1_3 Reverse -25 -32 15.7721 0.0124
NP_442053.1_1 Forward -356 -347 18.3876 0.0007
NP_442053.1_1 Reverse -347 -356 18.3876 0.0007
NP_442053.1_1 Forward -33 -24 18.3876 0.0007
NP_442053.1_1 Reverse -24 -33 18.3876 0.0007
NP_442053.1_1 Reverse -99 -108 4.52295 0.242
NP_440505.1_3 Forward -35 -25 18.3679 0.00213
NP_440505.1_3 Forward -358 -348 17.188 0.00332
NP_440505.1_3 Reverse -345 -355 9.22315 0.122
NP_440505.1_3 Reverse -22 -32 9.22315 0.122
NP_440505.1_3 Reverse -97 -107 5.78156 0.211
NP_440013.1_2 Reverse -17 -31 13.1759 0.294
NP_442532.1_4 Forward -66 -48 7.28623 0.3
NP_441408.2_7 Forward -35 -16 9.93088 0.0989
NP_440914.1_1 Forward -356 -346 17.5935 0.000537
NP_440914.1_1 Forward -33 -23 17.5935 0.000537
NP_440914.1_1 Reverse -24 -34 17.5935 0.000537
NP_440914.1_1 Reverse -347 -357 16.3248 0.00196
NP_441011.1_8 Reverse -348 -357 16.6177 0.00602
NP_441011.1_8 Forward -107 -98 10.3245 0.108
NP_441011.1_8 Forward -355 -346 8.25953 0.144
NP_441011.1_8 Forward -32 -23 8.25953 0.144
NP_441011.1_8 Reverse -25 -34 8.25953 0.144
NP_442533.1_1 Reverse -221 -240 0.0977854 0.14
NP_442533.1_6 Forward -356 -347 17.2076 0.00137
NP_442533.1_6 Reverse -347 -356 17.2076 0.00137
NP_442533.1_6 Forward -33 -24 17.2076 0.00137
NP_442533.1_6 Reverse -24 -33 17.2076 0.00137
NP_442533.1_6 Reverse -87 -96 5.21127 0.15
NP_442533.1_6 Forward -96 -87 3.83464 0.202
NP_442232.1_3 Forward -137 -118 -15.0452 0.288
NP_440854.1_2 Forward -316 -297 8.84924 0.26
NP_441482.1_7 Reverse -18 -32 8.55439 0.0162
NP_441482.1_7 Forward -39 -25 -2.55701 0.0968
NP_441482.1_7 Reverse -341 -355 -10.6202 0.211
NP_441482.1_7 Reverse -93 -107 -11.0135 0.229
NP_441482.1_7 Forward -65 -51 -11.6035 0.275
NP_441482.1_7 Forward -362 -348 -12.1934 0.29
NP_441235.1_5 Reverse -202 -221 9.3409 0.297
NP_439944.1_9 Forward -355 -345 10.5014 0.0887
NP_439944.1_9 Forward -32 -22 10.5014 0.0887
NP_439944.1_9 Reverse -25 -35 10.5014 0.0887
NP_439944.1_9 Reverse -348 -358 9.12481 0.1
NP_441028.1_6 Forward -50 -40 10.3043 0.203
NP_441028.1_6 Forward -12 -2 7.15773 0.23
NP_441028.1_6 Reverse -170 -180 4.30615 0.278
NP_441028.1_6 Reverse -259 -269 3.8145 0.281
NP_441028.1_6 Forward -106 -96 3.51951 0.292
NP_440116.1_3 Reverse -119 -138 16.5182 0.189
NP_440116.1_8 Reverse -25 -44 23.1072 0.00583
NP_440116.1_8 Forward -32 -13 1.67108 0.0915
NP_440116.1_8 Forward -355 -336 -6.78538 0.216
NP_441527.1_4 Forward -270 -251 -5.39572 0.201
NP_440115.1_6 Forward -359 -349 13.0581 0.0818
NP_440115.1_6 Forward -36 -26 6.76487 0.167
NP_440115.1_6 Reverse -213 -223 6.37155 0.186
NP_441602.1_3 Reverse -19 -38 -0.983855 0.226
NP_441602.1_3 Forward -38 -19 -3.3438 0.245
NP_441170.1_4 Forward -42 -24 2.67408 0.283
NP_441972.1_5 Reverse -25 -44 9.43923 0.065
NP_441106.1_1 Forward -357 -348 18.486 0.0028
NP_441106.1_1 Reverse -346 -355 9.63616 0.0311
NP_441106.1_1 Forward -34 -25 9.63616 0.0311
NP_441106.1_1 Reverse -23 -32 9.63616 0.0311
NP_439903.1_6 Forward -36 -17 7.57013 0.151
NP_439903.1_6 Reverse -47 -66 7.17681 0.163
NP_439903.1_6 Forward -359 -340 3.04693 0.213
NP_442588.1_6 Reverse -310 -329 0.392778 0.252
NP_441286.1_1 Forward -34 -22 12.9203 0.00815
NP_441286.1_1 Reverse -23 -35 12.9203 0.00815
NP_441286.1_1 Reverse -346 -358 5.93884 0.0258
NP_441286.1_1 Forward -357 -345 3.48056 0.0467
NP_441809.1_7 Reverse -311 -330 5.30933 0.245
NP_440670.1_8 Forward -356 -347 18.3876 0.000699
NP_440670.1_8 Reverse -347 -356 18.3876 0.000699
NP_440670.1_8 Forward -33 -24 18.3876 0.000699
NP_440670.1_8 Reverse -24 -33 18.3876 0.000699
NP_440886.1_7 Forward -109 -99 14.5325 0.0475
NP_440886.1_7 Forward -240 -230 8.14104 0.0805
NP_440886.1_7 Forward -357 -347 8.04271 0.0805
NP_440886.1_7 Reverse -346 -356 7.94438 0.0805
NP_440886.1_7 Forward -34 -24 7.94438 0.0805
NP_440886.1_7 Reverse -23 -33 7.94438 0.0805
NP_440886.1_7 Reverse -86 -96 5.48612 0.181
NP_440886.1_7 Forward -211 -201 3.91283 0.26
NP_442614.1_2 Forward -356 -342 5.70279 0.298
NP_442072.1_9 Reverse -23 -41 -21.417 0.208
NP_442072.1_9 Forward -357 -339 -22.007 0.216
NP_440513.1_6 Forward -366 -347 12.1917 0.222
NP_442401.1_2 Forward -34 -15 14.1583 0.126
NP_440907.2_8 Forward -107 -97 11.6809 0.0789
NP_440907.2_8 Reverse -348 -358 9.616 0.103
NP_440907.2_8 Forward -355 -345 7.64939 0.117
NP_440907.2_8 Forward -32 -22 7.64939 0.117
NP_440907.2_9 Forward -58 -39 12.88 0.0837
NP_441021.1_1 Forward -32 -13 -6.39206 0.18
NP_441021.1_1 Reverse -25 -44 -6.78538 0.18
NP_440841.1_4 Reverse -22 -41 -5.80207 0.208
NP_440193.1_1 Reverse -314 -333 17.1001 0.135
NP_441463.1_3 Forward -43 -24 0.884433 0.129
NP_441463.1_3 Reverse -226 -245 -10.522 0.296
NP_441626.1_2 Forward -355 -348 15.7721 0.0124
NP_441626.1_2 Reverse -348 -355 15.7721 0.0124
NP_441626.1_2 Forward -32 -25 15.7721 0.0124
NP_441626.1_2 Reverse -25 -32 15.7721 0.0124
NP_442211.1_3 Reverse -25 -44 7.76379 0.275
NP_442365.1_7 Forward -37 -18 -2.16383 0.199
NP_442794.1_1 Reverse -20 -32 19.1152 0.00716
NP_442794.1_1 Forward -37 -25 17.1486 0.0232
NP_442794.1_1 Reverse -343 -355 2.59558 0.287
NP_442615.1_1 Reverse -338 -356 5.91901 0.0371
NP_442615.1_1 Reverse -15 -33 5.23069 0.0398
NP_442615.1_1 Forward -42 -24 -2.53746 0.145
NP_442615.1_1 Forward -365 -347 -4.11075 0.177
NP_442615.1_1 Reverse -319 -337 -4.99573 0.201
NP_441962.1_4 Reverse -19 -38 -2.85214 0.138
NP_441962.1_4 Forward -38 -19 -12.7836 0.265
NP_441962.1_4 Forward -122 -103 -13.6686 0.277
NP_440387.1_1 Forward -33 -17 21.6913 0.00219
NP_440387.1_1 Forward -356 -340 11.3666 0.017
NP_440855.1_5 Forward -41 -22 3.73524 0.287
NP_441431.1_2 Forward -359 -345 15.6336 0.045
NP_441488.1_8 Reverse -19 -33 10.2254 0.146
NP_441488.1_8 Forward -38 -24 7.86545 0.221
NP_441836.1_2 Reverse -18 -37 -5.60541 0.284
NP_441836.1_2 Forward -39 -20 -6.1954 0.292
NP_441993.1_1 Reverse -18 -37 8.67125 0.141
NP_441993.1_1 Reverse -210 -229 3.79838 0.228
NP_441993.1_1 Forward -102 -83 0.484826 0.298
NP_440814.1_4 Reverse -338 -357 -13.5702 0.293
NP_440467.1_3 Forward -44 -25 14.6744 0.157
NP_440114.1_10 Reverse -347 -361 17.5025 0.0104
NP_440114.1_10 Forward -225 -211 9.34103 0.177
NP_440114.1_10 Forward -356 -342 8.94771 0.19
NP_441510.2_6 Reverse -14 -33 12.7816 0.268
NP_440287.1_6 Reverse -338 -357 6.98095 0.16
NP_440766.1_5 Reverse -41 -53 9.08817 0.277
NP_441237.1_9 Forward -355 -345 14.828 0.0242
NP_441237.1_9 Forward -32 -22 14.828 0.0242
NP_442743.1_4 Reverse -348 -367 -5.01543 0.257
NP_440643.1_6 Forward -38 -19 1.37609 0.274
NP_440457.1_1 Forward -37 -25 6.33216 0.123
NP_440457.1_1 Forward -360 -348 1.31728 0.241
NP_440213.1_4 Reverse -324 -343 18.3655 0.216
NP_440987.1_4 Reverse -182 -201 5.60432 0.201
NP_440987.1_4 Forward -56 -37 4.916 0.231
NP_440798.1_1 Forward -155 -137 13.6341 0.294
NP_440798.1_6 Reverse -348 -361 12.8023 0.0468
NP_441436.1_8 Reverse -23 -42 6.88262 0.296
NP_440473.1_9 Reverse -90 -109 -12.5869 0.3
NP_442509.1_9 Forward -356 -346 8.14104 0.192
NP_442509.1_9 Forward -33 -23 8.14104 0.192
NP_442509.1_9 Reverse -24 -34 8.14104 0.192
NP_442509.1_9 Reverse -347 -357 8.04271 0.192
NP_442509.1_9 Reverse -360 -370 6.37109 0.274
NP_441489.1_3 Reverse -1 -15 6.98253 0.287
NP_442936.1_10 Reverse -163 -177 9.55098 0.268
NP_442514.1_5 Forward -41 -22 -4.1312 0.238
NP_442514.1_5 Forward -225 -206 -9.63771 0.297
NP_440554.1_4 Reverse -348 -358 17.9746 0.0131
NP_440554.1_4 Reverse -25 -35 8.92815 0.0646
NP_441845.1_6 Forward -120 -102 -1.06249 0.28
NP_442737.1_5 Reverse -23 -42 12.0064 0.268
NP_441885.1_5 Forward -356 -346 20.9245 0.000538
NP_441885.1_5 Forward -33 -23 20.9245 0.000538
NP_441885.1_5 Reverse -24 -34 20.9245 0.000538
NP_441885.1_5 Reverse -347 -357 11.3864 0.00668
NP_441885.1_5 Forward -316 -306 -1.78992 0.284
NP_440478.1_4 Reverse -20 -39 22.3206 0.00936
NP_440478.1_10 Reverse -22 -36 8.65272 0.257
NP_440478.1_10 Reverse -345 -359 7.76774 0.257
NP_442341.1_7 Forward -34 -20 17.4042 0.012
NP_442341.1_7 Reverse -23 -37 10.521 0.0625
NP_442341.1_7 Forward -357 -343 5.89945 0.142
NP_442341.1_9 Forward -358 -344 20.0584 0.00907
NP_441756.1_5 Reverse -262 -281 0.982764 0.222
NP_441173.1_9 Forward -11 -3 14.3753 0.161
NP_442395.2_4 Reverse -23 -42 4.71854 0.178
NP_442395.2_4 Reverse -315 -334 4.62021 0.18
NP_440409.1_1 Reverse -352 -371 -1.57384 0.235
NP_443000.1_7 Forward -358 -348 20.3345 0.00223
NP_443000.1_7 Forward -35 -25 19.9412 0.00223
NP_443000.1_7 Reverse -345 -355 10.3048 0.0345
NP_443000.1_7 Reverse -22 -32 10.3048 0.0345
NP_440507.2_3 Reverse -15 -34 12.0933 0.166
NP_440507.2_3 Reverse -227 -246 7.17681 0.286
NP_441842.1_10 Forward -40 -26 6.19444 0.297
NP_440275.1_3 Forward -358 -348 16.1063 0.0155
NP_440275.1_3 Forward -35 -25 15.123 0.0182
NP_440275.1_3 Reverse -345 -355 8.04317 0.0602
NP_440275.1_3 Reverse -22 -32 8.04317 0.0602
NP_440091.1_1 Reverse -343 -355 1.31728 0.198
NP_443060.1_5 Reverse -16 -35 4.81688 0.279
NP_441902.1_3 Reverse -3 -13 13.9535 0.226
NP_443010.1_10 Forward -359 -342 4.5102 0.229
NP_442451.1_2 Reverse -352 -371 -2.26216 0.181
NP_439962.1_4 Reverse -199 -218 -3.3438 0.251
NP_440149.1_8 Forward -33 -14 8.25926 0.0613
NP_440149.1_8 Reverse -24 -43 -2.16383 0.166
NP_440149.1_8 Reverse -347 -366 -4.32711 0.206
NP_441105.1_3 Forward -44 -25 7.07928 0.0565
NP_441105.1_3 Forward -140 -121 -5.99873 0.227
NP_441105.1_3 Forward -236 -217 -7.08038 0.245
NP_441105.1_3 Forward -367 -348 -7.57203 0.255
NP_440216.1_1 Reverse -347 -361 25.959 0.000481
NP_440216.1_1 Reverse -24 -38 8.94771 0.00589
NP_440216.1_1 Reverse -191 -205 -5.31028 0.126
NP_440216.1_1 Forward -356 -342 -9.63684 0.145
NP_440216.1_1 Forward -33 -19 -10.6202 0.145
NP_440172.1_1 Reverse -347 -357 17.5813 0.00421
NP_440172.1_1 Forward -356 -346 15.0247 0.00945
NP_440172.1_1 Forward -33 -23 15.0247 0.00945
NP_440172.1_1 Reverse -24 -34 15.0247 0.00945
NP_440172.1_1 Reverse -216 -226 3.71661 0.219
NP_442015.1_10 Forward -37 -24 12.5073 0.0368
NP_442015.1_10 Reverse -20 -33 11.229 0.0372
NP_442015.1_10 Forward -360 -347 4.14919 0.178
NP_442015.1_10 Reverse -343 -356 1.49425 0.204
NP_441226.1_7 Forward -355 -348 14.4934 0.0123
NP_441226.1_7 Reverse -348 -355 14.4934 0.0123
NP_441226.1_7 Forward -32 -25 14.4934 0.0123
NP_441226.1_7 Reverse -25 -32 14.4934 0.0123
NP_441111.1_7 Forward -355 -347 18.7023 0.00294
NP_441111.1_7 Forward -32 -24 18.7023 0.00294
NP_441111.1_7 Reverse -348 -356 18.7023 0.00294
NP_441111.1_7 Reverse -25 -33 18.7023 0.00294
NP_442379.1_10 Reverse -340 -357 -3.50107 0.263
NP_441766.1_2 Forward -356 -347 17.5026 0.00297
NP_441766.1_2 Reverse -347 -356 17.5026 0.00297
NP_441766.1_2 Forward -33 -24 17.5026 0.00297
NP_441766.1_2 Reverse -24 -33 17.5026 0.00297
NP_442417.1_5 Reverse -87 -101 9.83269 0.126
NP_442417.1_5 Reverse -24 -38 8.45605 0.158
NP_442252.1_2 Forward -291 -273 15.7521 0.27
NP_440416.1_9 Forward -103 -84 -6.78538 0.0943
NP_440416.1_9 Reverse -17 -36 -15.3402 0.189
NP_440416.1_9 Forward -40 -21 -17.0118 0.229
NP_443052.1_8 Reverse -337 -356 -10.4236 0.208
NP_443052.1_8 Reverse -226 -245 -10.522 0.21
NP_443052.1_8 Forward -366 -347 -11.2103 0.224
NP_443052.1_9 Forward -218 -199 -4.91709 0.262
NP_443052.1_9 Reverse -256 -275 -6.39206 0.282
NP_440072.1_5 Reverse -201 -219 6.60732 0.236
NP_441974.1_1 Forward -59 -42 14.2968 0.274
NP_440261.1_5 Reverse -348 -361 5.03416 0.0478
NP_440261.1_5 Reverse -25 -38 -2.53732 0.0924
NP_440261.1_5 Reverse -361 -374 -3.22564 0.12
NP_440261.1_5 Forward -355 -342 -10.4038 0.201
NP_440988.1_10 Forward -247 -233 12.9343 0.178
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTGTTAAGACTTTATATCACGGGTAATTCGGTGCGTTCTCAGCAGGCGATCGCCAATATTTACCGCATTTGCCAAGAAGATCTAGGGGATCAGTACAATGTTGAAATCATTGACGTGTTGGAACAGCCTCAACGGGCGGAAGAGGAAAAAATCATGGTCACCCCCACCTTGATCAAACAATTGCCCCCTCCCCTACAGCGGATTATCGGCGATATGTCCAATACGGAAAAAGTTTTGCTGGGATTAGATATTGTGCCCGAAGGTTTGCAGGTTCGTTTGCCGGAGGATTAACCGCTATCCCCTAGGCGGTGGGCCGATATTAGGTGATTATTAAAAACCAGGGCGAAAATTTTGCCCCCATTCCTCTGGCGATCGCCAAAGCTCCAGTTTTTTCCCAATT

CDS

ATGTTGTCCAACTCCGACCAGCACCGCGCAGTTCAGGCCCTCTACAACACCTATCCCTTCCCCCCCGAACCCCTGCTACAGGAACCACCTCCGGGTTACAACTGGCGCTGGCAATGGACTGCGGCCCATAATTTTTGTTTAGGACGGCGGCCGGCTAATCAAAAGGTTCGCATTTTGGATGCGGGTTGTGGCACTGGAGTCGGCACGGAATATTTAGTCCACCTCAACCCGGAAGCGGAAGTTCATGCCGTGGACATCAGTGAAGGGGCTTTAGCCGTTGCCCAAACAAGGTTGCAAAAGTCCGGTGTGGTTTGTGATCGGGTGCATTTCCACCATTTATCCCTGGAAAATCTGGCCCATCTTCCCGGACAATTTGATTACATCAATTCCGTCGGTGTACTGCATCATTTGCCCGATCCAGTGGCTGGAATTCAGGCCGTAGCGGAAAAATTGGCCCCCGGTGGTTTATTCCACATTTTTGTTTACGCTGAAATCGGCCGCTGGGAAATTCAACTCATGCAAAAGGCGATCGCCATCCTACAGGGGAAAAAACGGGGCGATTACCAGGATGGGGTTGCGGTGGGTCGAGAAATTTTTGCGAGTTTGCCGGAATATAACCGTTTAGTGAAAAGGGAAAAAGAGCGTTGGTCCCTGGAAAATCATCGGGATGAATCCTTTGCGGATATGTATGTCCATCCCCAAGAAACGGACTATAACATTGATACGTTATTTGAATTAATCGACTCGGCTGGACTGGAATTTTTGGGCTTTTCCAACCCTGATTATTGGCAACTAGATCGCCTGTTAGGCAAAGCACCGGATTTAATGGAACGGGCTAAAGATTTAAGCGAAAAGGAACGATATCGTCTAATTGAATTATTAGACCCCGAAATTACCCACTACGAATTTTTCTTGGCTAAACCCCCCATACAAATTAGTGATTGGACGGACGATCAAACCTTACTCAAAGCCCTGCCCAATCTTCATCCTTGCCTGACTGGTTGGCCGAGCCGCAGTTTATTTGACTATAACTATCAGCCCTTAGAGTTAACCGAAGAGGAATTTAAGTTTCTCCAGGCAGTAGAAGCTCAGACAGAAATTCAAGCAAACGTGGAAAAAGTTCTAACCGACCTAGGCGATCGATCCATCGACTTGGCATTGGTGCGGAGCCTGCAAACTCGGCAACTACTGACCCTCGGCAACTCATAG

Protein

MLSNSDQHRAVQALYNTYPFPPEPLLQEPPPGYNWRWQWTAAHNFCLGRRPANQKVRILDAGCGTGVGTEYLVHLNPEAEVHAVDISEGALAVAQTRLQKSGVVCDRVHFHHLSLENLAHLPGQFDYINSVGVLHHLPDPVAGIQAVAEKLAPGGLFHIFVYAEIGRWEIQLMQKAIAILQGKKRGDYQDGVAVGREIFASLPEYNRLVKREKERWSLENHRDESFADMYVHPQETDYNIDTLFELIDSAGLEFLGFSNPDYWQLDRLLGKAPDLMERAKDLSEKERYRLIELLDPEITHYEFFLAKPPIQISDWTDDQTLLKALPNLHPCLTGWPSRSLFDYNYQPLELTEEEFKFLQAVEAQTEIQANVEKVLTDLGDRSIDLALVRSLQTRQLLTLGNS