Your browser is old and dusty. Try Google Chrome!

Details for sll0481

ORF sll0481
Accession NP_442512.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -171 -185 1.27789 0.192
NP_441061.1_2 Reverse -192 -206 -1.37704 0.258
NP_440815.1_5 Forward -383 -364 6.98095 0.262
NP_440897.1_6 Reverse -374 -393 -2.65624 0.219
NP_441818.1_9 Forward -185 -166 -7.27704 0.271
NP_440226.1_1 Forward -363 -344 5.11266 0.166
NP_440150.1_2 Forward -265 -246 3.83357 0.29
NP_441519.1_4 Forward -200 -183 14.1002 0.261
NP_440637.1_7 Reverse -332 -351 9.24257 0.259
NP_443027.1_4 Forward -113 -103 9.22315 0.172
NP_441812.1_2 Reverse -258 -277 15.5357 0.226
NP_440110.1_8 Forward -179 -160 -0.295539 0.22
NP_442062.1_8 Reverse -26 -36 3.32329 0.275
NP_442062.1_8 Forward -111 -101 2.83163 0.293
NP_441859.1_3 Forward -112 -93 5.40686 0.201
NP_440304.1_4 Forward -160 -150 6.27322 0.167
NP_442762.1_10 Forward -253 -234 -0.39387 0.0966
NP_439918.1_2 Forward -185 -166 -0.885524 0.236
NP_439918.1_2 Forward -191 -172 -5.21209 0.298
NP_441208.1_9 Reverse -371 -385 7.17775 0.226
NP_441925.1_2 Forward -333 -314 2.94938 0.262
NP_441149.1_9 Forward -100 -81 6.39016 0.221
NP_442570.1_3 Reverse -372 -391 7.7676 0.138
NP_442570.1_3 Forward -188 -169 4.22769 0.166
NP_442570.1_3 Reverse -371 -390 3.73603 0.166
NP_442570.1_3 Forward -182 -163 1.0811 0.2
NP_442570.1_3 Reverse -366 -385 -6.49039 0.258
NP_442570.1_3 Forward -181 -162 -6.98204 0.265
NP_442570.1_3 Forward -187 -168 -8.55534 0.288
NP_441025.1_5 Forward -311 -297 17.8958 0.209
NP_441598.1_3 Forward -389 -370 15.5903 0.161
NP_440747.1_7 Forward -185 -167 15.0638 0.28
NP_441486.1_1 Reverse -23 -37 -4.62196 0.204
NP_442634.1_4 Forward -187 -173 6.09611 0.051
NP_440842.1_10 Forward -392 -378 1.27789 0.294
NP_441695.1_8 Reverse -170 -184 14.5526 0.22
NP_441695.1_8 Forward -254 -240 11.701 0.26
NP_441014.1_8 Reverse -163 -182 -7.57203 0.28
NP_442848.1_9 Reverse -156 -175 0.982764 0.265
NP_441012.1_4 Forward -135 -122 9.65572 0.272
NP_441012.1_4 Reverse -161 -174 6.01747 0.286
NP_443018.1_3 Forward -110 -103 11.5438 0.0752
NP_443018.1_3 Forward -253 -246 9.38056 0.128
NP_441634.1_8 Forward -31 -17 -1.8687 0.295
NP_440376.1_1 Reverse -374 -383 1.96635 0.236
NP_441588.1_4 Forward -387 -377 6.07655 0.214
NP_442687.1_7 Reverse -169 -179 8.63316 0.104
NP_442687.1_7 Reverse -148 -158 3.81494 0.286
NP_440066.1_5 Reverse -164 -183 12.6833 0.251
NP_442485.1_3 Forward -265 -246 -4.22878 0.278
NP_441846.1_10 Forward -180 -161 -21.3384 0.256
NP_440642.1_10 Reverse -101 -115 5.40719 0.241
NP_441013.1_2 Forward -190 -172 0.510803 0.254
NP_441013.1_2 Reverse -363 -381 -3.91409 0.295
NP_441013.1_2 Forward -66 -48 -4.70074 0.299
NP_441013.1_3 Forward -197 -178 8.65258 0.243
NP_441422.1_7 Forward -391 -374 -3.5994 0.235
NP_441029.1_4 Reverse -271 -290 2.94938 0.22
NP_440533.1_9 Forward -185 -166 2.94938 0.261
NP_441746.1_2 Reverse -367 -386 16.6174 0.248
NP_440360.1_5 Forward -324 -305 2.3594 0.297
NP_440360.1_10 Reverse -104 -118 3.93283 0.227
NP_442782.1_2 Forward -185 -171 7.47274 0.202
NP_442205.1_9 Forward -117 -101 -3.08806 0.278
NP_441487.1_9 Reverse -305 -324 2.0644 0.19
NP_442937.1_5 Forward -203 -184 8.75091 0.212
NP_442836.1_5 Forward -321 -302 4.22769 0.213
NP_443001.1_7 Reverse -27 -46 5.80098 0.279
NP_440984.1_7 Forward -190 -176 6.29277 0.219
NP_441162.1_3 Reverse -164 -183 12.5858 0.188
NP_440153.1_5 Reverse -355 -369 0.982901 0.282
NP_442571.1_1 Reverse -222 -241 4.32602 0.237
NP_442064.1_4 Forward -189 -170 9.34008 0.208
NP_440809.1_9 Forward -350 -332 -7.749 0.225
NP_442431.1_10 Forward -185 -167 0.117479 0.281
NP_440484.1_1 Forward -390 -371 10.7167 0.214
NP_441674.1_2 Forward -124 -105 7.57094 0.24
NP_440147.1_4 Reverse -352 -365 1.00259 0.242
NP_441550.1_8 Reverse -378 -388 5.48612 0.247
NP_440569.1_6 Reverse -237 -256 4.71934 0.24
NP_439966.1_7 Forward -256 -246 4.30615 0.279
NP_441076.1_7 Forward -224 -205 17.6007 0.22
NP_442281.1_1 Forward -259 -245 4.8172 0.18
NP_441644.1_6 Forward -254 -244 12.6642 0.0302
NP_441644.1_6 Forward -389 -379 3.32285 0.288
NP_441795.1_5 Forward -306 -287 7.27595 0.245
NP_442215.1_1 Reverse -166 -185 8.45592 0.19
NP_442177.1_5 Forward -290 -276 7.76774 0.293
NP_442029.1_6 Reverse -369 -388 2.45773 0.296
NP_441266.1_2 Reverse -20 -39 12.1925 0.15
NP_442926.1_3 Reverse -234 -253 4.32602 0.265
NP_442926.1_3 Forward -388 -369 1.96607 0.296
NP_442554.1_8 Forward -253 -243 5.28991 0.153
NP_442313.1_4 Forward -179 -160 13.8641 0.286
NP_442142.1_4 Forward -257 -244 7.09854 0.148
NP_441371.1_3 Reverse -308 -326 4.54237 0.295
NP_441088.1_10 Forward -188 -169 17.3057 0.246
NP_440183.1_9 Reverse -157 -176 -6.49039 0.203
NP_440379.1_5 Forward -315 -296 -8.26035 0.25
NP_440379.1_5 Reverse -236 -255 -10.817 0.285
NP_441468.1_1 Forward -110 -103 4.07068 0.263
NP_441015.1_10 Forward -119 -100 -11.5053 0.298
NP_441016.2_9 Forward -181 -162 21.1406 0.0413
NP_441956.1_9 Forward -186 -167 4.42435 0.277
NP_440265.1_7 Forward -185 -171 19.6651 0.0644
NP_442719.1_2 Reverse -217 -235 -11.5846 0.292
NP_441251.1_8 Reverse -5 -18 13.1442 0.254
NP_441612.1_2 Forward -164 -154 7.67797 0.249
NP_442559.1_5 Reverse -363 -382 9.3409 0.148
NP_442227.1_2 Reverse -161 -180 -2.85214 0.283
NP_442808.1_1 Forward -390 -380 8.92768 0.0481
NP_442808.1_1 Forward -255 -245 7.64939 0.0729
NP_442808.1_1 Reverse -169 -179 3.71617 0.227
NP_441906.1_2 Forward -385 -366 5.89851 0.286
NP_441906.1_2 Forward -379 -360 0.686995 0.297
NP_442050.1_1 Forward -127 -108 11.7008 0.233
NP_442342.1_9 Forward -256 -240 5.56507 0.236
NP_440558.1_2 Reverse -182 -201 -7.37537 0.293
NP_442789.1_4 Forward -200 -181 -5.70374 0.276
NP_441878.1_6 Forward -165 -155 -7.78811 0.266
NP_441557.1_8 Reverse -156 -166 14.5325 0.183
NP_441445.1_1 Forward -305 -286 2.16274 0.24
NP_441433.1_8 Reverse -375 -394 -4.03212 0.286
NP_440086.1_4 Forward -355 -341 15.2889 0.268
NP_441549.1_9 Forward -291 -273 -10.2073 0.273
NP_440151.1_5 Forward -191 -172 30.2854 0.0000766
NP_441799.1_1 Reverse -376 -390 4.12889 0.266
NP_440256.1_1 Reverse -242 -261 -4.22878 0.15
NP_440256.1_1 Reverse -371 -390 -4.91709 0.169
NP_440256.1_1 Reverse -377 -396 -7.17871 0.231
NP_441559.1_8 Reverse -112 -126 -7.57189 0.295
NP_440915.1_6 Reverse -241 -255 -1.77037 0.246
NP_440915.1_6 Forward -183 -169 -3.54032 0.298
NP_440717.1_2 Forward -173 -154 -8.55534 0.238
NP_442069.1_7 Reverse -159 -178 10.1267 0.291
NP_442866.1_1 Reverse -362 -381 -9.53865 0.294
NP_440748.1_5 Reverse -72 -91 2.16274 0.223
NP_440748.1_5 Forward -33 -14 -0.295539 0.258
NP_440787.1_2 Forward -176 -157 13.1758 0.128
NP_442957.1_8 Reverse -371 -390 14.8474 0.218
NP_442957.1_8 Reverse -372 -391 12.6841 0.287
NP_442993.1_1 Forward -164 -148 -9.08625 0.179
NP_442386.1_9 Forward -255 -246 10.324 0.132
NP_442386.1_9 Forward -390 -381 9.73406 0.152
NP_442386.1_9 Reverse -19 -28 7.07914 0.219
NP_440570.1_5 Forward -189 -170 13.7658 0.111
NP_442484.1_2 Reverse -234 -253 8.35759 0.144
NP_440586.1_8 Forward -110 -103 10.9535 0.119
NP_440684.1_9 Forward -321 -307 11.5043 0.173
NP_440027.1_3 Reverse -155 -173 5.03327 0.249
NP_440027.1_3 Forward -195 -177 3.26332 0.275
NP_439937.1_9 Reverse -184 -201 -11.1715 0.245
NP_439937.1_9 Reverse -312 -329 -11.4665 0.256
NP_439937.1_9 Forward -400 -383 -14.9081 0.287
NP_440836.1_1 Reverse -298 -317 8.25926 0.222
NP_441138.1_5 Forward -359 -346 8.84703 0.238
NP_440819.1_5 Forward -326 -318 7.98423 0.228
NP_440316.1_10 Reverse -244 -254 16.4013 0.153
NP_440316.1_10 Forward -186 -176 6.96153 0.251
NP_441803.1_2 Forward -253 -234 0.884433 0.243
NP_441803.1_2 Reverse -267 -286 -1.37718 0.298
NP_442384.1_10 Reverse -155 -168 0.215946 0.297
NP_442384.1_10 Forward -389 -376 0.215946 0.297
NP_442339.1_1 Reverse -66 -85 21.6314 0.0537
NP_442035.1_3 Forward -128 -109 11.7992 0.284
NP_442035.1_7 Forward -30 -11 16.2734 0.276
NP_441877.1_7 Forward -394 -375 -0.197979 0.281
NP_441018.1_7 Forward -189 -170 9.53756 0.223
NP_441018.1_7 Forward -183 -164 7.66927 0.268
NP_441018.1_7 Reverse -369 -388 6.68596 0.283
NP_442262.1_10 Forward -110 -103 11.7405 0.0841
NP_442262.1_10 Forward -253 -246 9.47889 0.187
NP_441689.1_5 Reverse -352 -362 5.19112 0.282
NP_442244.1_4 Reverse -251 -270 19.2723 0.233
NP_440282.1_3 Reverse -234 -253 -0.590531 0.291
NP_440282.1_10 Reverse -166 -185 -2.75381 0.232
NP_440531.1_6 Forward -391 -372 -3.63879 0.269
NP_441060.1_3 Forward -177 -158 11.6025 0.189
NP_441060.1_9 Reverse -52 -71 8.84924 0.294
NP_441640.1_8 Reverse -21 -40 -0.4922 0.197
NP_442693.1_6 Reverse -170 -189 0.982764 0.278
NP_440297.1_9 Forward -110 -100 -0.118297 0.282
NP_442280.1_1 Forward -181 -162 3.44104 0.287
NP_442280.1_10 Forward -189 -171 7.01283 0.268
NP_441896.1_3 Forward -174 -155 -1.57384 0.265
NP_440888.1_2 Reverse -155 -169 5.01387 0.298
NP_442225.1_10 Reverse -370 -389 6.39016 0.287
NP_441787.1_7 Forward -263 -244 17.994 0.0572
NP_442512.1_1 Forward -306 -288 25.2902 0.00469
NP_442512.1_2 Forward -381 -362 26.8438 0.00414
NP_442512.1_3 Forward -238 -219 25.3688 0.00765
NP_442512.1_4 Forward -120 -102 21.5536 0.0486
NP_442512.1_5 Forward -77 -58 22.0256 0.0273
NP_442845.1_2 Reverse -374 -388 7.47274 0.195
NP_442845.1_2 Forward -117 -103 7.07942 0.199
NP_442845.1_2 Reverse -239 -253 5.70279 0.225
NP_442845.1_2 Reverse -149 -163 3.53951 0.287
NP_439904.1_3 Forward -83 -64 18.584 0.139
NP_440982.1_1 Reverse -155 -174 3.53858 0.297
NP_442337.1_8 Reverse -363 -382 -2.26216 0.297
NP_442578.1_7 Forward -110 -103 5.15232 0.291
NP_440710.1_1 Reverse -162 -180 -6.96235 0.23
NP_441621.1_7 Reverse -157 -171 -5.70361 0.26
NP_442204.1_1 Reverse -77 -88 3.79525 0.266
NP_442204.1_1 Reverse -241 -252 2.81194 0.266
NP_440516.1_8 Reverse -380 -389 -0.393597 0.255
NP_440516.1_8 Reverse -245 -254 -0.590259 0.283
NP_442846.1_6 Forward -393 -374 20.747 0.196
NP_442428.1_5 Forward -110 -103 4.46401 0.267
NP_441443.1_7 Forward -129 -110 -1.96717 0.268
NP_441443.1_10 Reverse -376 -394 18.9962 0.108
NP_442779.1_2 Reverse -100 -118 23.862 0.0232
NP_442120.1_10 Forward -164 -145 -15.6352 0.294
NP_442120.1_10 Reverse -306 -325 -16.2252 0.297
NP_441867.1_2 Forward -251 -232 -20.0601 0.291
NP_440673.1_3 Reverse -104 -111 13.2155 0.0426
NP_440673.1_3 Forward -361 -354 9.08556 0.202
NP_440673.1_7 Reverse -178 -197 1.17943 0.253
NP_440865.1_9 Forward -117 -98 -7.37537 0.244
NP_441052.1_2 Forward -383 -373 2.43831 0.204
NP_440436.1_4 Forward -280 -271 7.07914 0.142
NP_440041.1_2 Reverse -372 -391 1.17943 0.187
NP_442907.1_9 Reverse -165 -184 -6.88371 0.293
NP_441719.1_2 Forward -38 -24 14.3095 0.278
NP_441719.1_4 Forward -110 -103 3.77569 0.285
NP_441004.1_1 Forward -177 -158 -17.8968 0.295
NP_441004.1_5 Reverse -385 -399 7.47274 0.292
NP_442813.1_2 Reverse -86 -105 0.0977854 0.273
NP_442813.1_4 Reverse -372 -391 1.0811 0.197
NP_440296.1_10 Reverse -371 -390 -11.9969 0.269
NP_441115.1_4 Reverse -331 -349 9.75313 0.202
NP_441851.1_10 Forward -165 -155 13.353 0.0316
NP_441683.1_7 Forward -126 -107 -3.14714 0.241
NP_440593.1_1 Forward -299 -280 13.9625 0.298
NP_441349.1_10 Forward -168 -149 3.34271 0.0676
NP_442843.1_1 Reverse -246 -265 8.16093 0.127
NP_442843.1_1 Forward -110 -91 -3.3438 0.222
NP_442843.1_1 Reverse -381 -400 -10.817 0.281
NP_439960.1_4 Forward -180 -161 11.995 0.295
NP_442168.1_5 Reverse -166 -185 -2.36049 0.264
NP_440588.1_2 Reverse -371 -390 5.40766 0.0672
NP_442006.1_2 Reverse -245 -262 -15.1041 0.215
NP_442006.1_2 Forward -126 -109 -16.1858 0.243
NP_442006.1_2 Reverse -380 -397 -16.8741 0.265
NP_440483.1_1 Reverse -240 -259 3.04771 0.164
NP_440483.1_1 Forward -116 -97 -8.94866 0.297
NP_441570.1_1 Forward -179 -161 -17.1888 0.267
NP_441570.1_1 Forward -281 -263 -17.7788 0.291
NP_441078.1_4 Forward -158 -149 -0.885252 0.209
NP_441078.1_4 Reverse -149 -158 -1.86856 0.272
NP_442729.1_5 Forward -127 -117 8.04317 0.251
NP_442348.1_2 Forward -235 -226 12.2911 0.218
NP_440707.1_9 Forward -122 -103 -0.000545616 0.293
NP_441094.1_3 Forward -128 -111 8.98696 0.259
NP_441432.1_8 Forward -180 -171 10.0295 0.0681
NP_441432.1_8 Reverse -379 -388 3.44131 0.245
NP_441432.1_8 Reverse -244 -253 3.44131 0.245
NP_441432.1_8 Forward -186 -177 3.44131 0.245
NP_440313.1_6 Reverse -306 -325 15.6341 0.285
NP_442157.1_4 Forward -180 -161 17.994 0.124
NP_442157.1_9 Reverse -163 -182 14.7491 0.281
NP_440760.1_1 Reverse -170 -189 -23.305 0.293
NP_442797.1_6 Reverse -104 -123 15.4968 0.171
NP_442797.1_7 Reverse -163 -181 2.0841 0.245
NP_442797.1_7 Reverse -184 -202 0.510803 0.274
NP_440131.1_4 Reverse -238 -257 7.47261 0.243
NP_441945.1_10 Forward -186 -167 8.55425 0.273
NP_442727.1_1 Forward -181 -167 14.6509 0.223
NP_441072.1_2 Reverse -369 -388 8.84924 0.231
NP_442489.1_7 Forward -158 -149 -2.06522 0.288
NP_441452.1_1 Reverse -105 -124 18.0924 0.117
NP_441659.2_8 Reverse -192 -202 -0.314959 0.298
NP_441040.1_5 Reverse -165 -184 3.83436 0.268
NP_442346.1_10 Forward -196 -177 -1.18052 0.286
NP_440545.1_3 Reverse -370 -387 -4.38605 0.224
NP_440545.1_5 Forward -184 -167 4.6604 0.244
NP_440459.1_2 Forward -173 -156 8.7903 0.249
NP_442551.1_4 Reverse -253 -268 -3.46169 0.29
NP_442551.1_4 Reverse -372 -387 -3.56002 0.292
NP_440847.1_5 Reverse -364 -383 12.6841 0.281
NP_441047.1_2 Reverse -171 -190 -2.16383 0.273
NP_442723.1_1 Reverse -151 -170 3.83357 0.278
NP_440875.1_9 Reverse -104 -114 7.20399 0.277
NP_441239.1_9 Forward -256 -244 12.7237 0.0433
NP_441239.1_9 Reverse -18 -30 2.98891 0.3
NP_441892.1_1 Forward -120 -103 -2.41943 0.221
NP_442193.1_1 Forward -180 -162 10.0489 0.233
NP_442052.1_7 Forward -178 -164 14.7492 0.2
NP_440546.1_4 Reverse -245 -255 11.7912 0.0712
NP_440546.1_4 Forward -185 -175 7.33119 0.246
NP_440546.1_6 Forward -331 -312 7.57094 0.268
NP_440462.1_4 Forward -300 -286 5.40779 0.29
NP_440462.1_6 Forward -113 -103 5.78156 0.138
NP_442340.1_3 Forward -400 -381 -9.63698 0.275
NP_440812.1_1 Reverse -233 -252 2.75272 0.267
NP_442402.1_2 Reverse -314 -328 11.7987 0.272
NP_441084.1_6 Reverse -300 -314 9.05325 0.295
NP_440653.1_10 Reverse -27 -46 8.84924 0.19
NP_442882.1_8 Reverse -251 -270 6.29264 0.295
NP_441811.1_1 Reverse -107 -126 7.7676 0.28
NP_440351.1_8 Reverse -16 -34 7.39397 0.254
NP_440914.1_1 Forward -389 -379 8.81029 0.186
NP_442533.1_6 Forward -383 -374 6.5879 0.106
NP_442533.1_6 Forward -254 -245 3.7363 0.204
NP_441089.1_9 Forward -321 -302 16.5191 0.14
NP_442232.1_3 Reverse -372 -391 -5.60541 0.165
NP_442322.1_4 Reverse -168 -185 -1.33848 0.226
NP_442322.1_4 Forward -391 -374 -8.02495 0.286
NP_441749.1_6 Forward -272 -253 23.1072 0.00968
NP_441749.1_8 Forward -173 -154 19.8623 0.0537
NP_440115.1_6 Forward -114 -104 4.99491 0.277
NP_441544.1_1 Forward -140 -128 14.7886 0.273
NP_441106.1_1 Forward -112 -103 4.71961 0.21
NP_442928.1_3 Forward -165 -146 14.6425 0.205
NP_442306.1_10 Forward -163 -144 -20.1584 0.202
NP_440886.1_7 Forward -255 -245 6.46942 0.123
NP_440886.1_7 Reverse -161 -171 4.50281 0.232
NP_440828.1_1 Reverse -161 -180 -0.197979 0.269
NP_442072.1_9 Forward -193 -175 -15.7138 0.187
NP_442794.1_1 Forward -183 -171 2.49725 0.288
NP_440387.1_1 Reverse -149 -165 4.18844 0.0455
NP_441431.1_2 Reverse -303 -317 6.19383 0.279
NP_441993.1_1 Reverse -239 -258 6.52718 0.179
NP_441993.1_1 Forward -185 -166 3.60346 0.231
NP_441993.1_1 Forward -179 -160 2.1416 0.262
NP_441993.1_1 Forward -321 -302 1.06957 0.285
NP_440114.1_10 Reverse -245 -259 8.55439 0.2
NP_442437.1_8 Forward -193 -174 3.14605 0.291
NP_441720.1_2 Forward -162 -143 4.03023 0.236
NP_440293.1_3 Forward -181 -162 -6.68705 0.291
NP_440293.1_3 Forward -187 -168 -6.98204 0.296
NP_440293.1_10 Forward -174 -155 -1.47551 0.271
NP_439988.1_3 Reverse -241 -255 4.52282 0.295
NP_440422.1_10 Forward -234 -215 12.5342 0.16
NP_441237.1_6 Forward -179 -162 9.18362 0.128
NP_442743.1_1 Reverse -161 -180 12.4867 0.241
NP_439910.1_2 Reverse -346 -363 -14.7108 0.183
NP_440457.1_1 Forward -168 -156 6.03717 0.132
NP_441801.1_4 Forward -258 -248 2.53664 0.292
NP_440801.1_8 Forward -390 -371 -2.16383 0.294
NP_441332.1_6 Forward -255 -245 11.5499 0.254
NP_442514.1_5 Reverse -153 -172 -3.14789 0.222
NP_440554.1_4 Reverse -103 -113 4.89658 0.171
NP_440554.1_4 Forward -253 -243 2.33998 0.267
NP_442228.1_10 Reverse -172 -191 11.0125 0.288
NP_441756.1_5 Reverse -162 -181 -2.55715 0.277
NP_441173.1_9 Reverse -340 -348 12.1137 0.21
NP_442395.2_4 Forward -390 -371 0.588665 0.264
NP_440191.1_4 Forward -153 -143 14.5055 0.266
NP_440076.1_2 Reverse -373 -392 17.699 0.184
NP_441122.1_1 Reverse -22 -37 3.22482 0.283
NP_440175.1_7 Reverse -363 -381 16.7801 0.0997
NP_440175.1_7 Forward -189 -171 16.7801 0.0997
NP_442495.1_3 Forward -178 -160 16.1454 0.242
NP_442495.1_4 Reverse -244 -254 15.0247 0.153
NP_442214.1_4 Reverse -116 -135 17.994 0.157
NP_441105.1_3 Forward -190 -171 -3.73712 0.185
NP_441105.1_3 Reverse -234 -253 -4.6221 0.203
NP_441105.1_3 Forward -122 -103 -8.55534 0.274
NP_441105.1_3 Forward -292 -273 -8.94866 0.281
NP_440216.1_1 Reverse -155 -169 -11.4068 0.184
NP_440216.1_1 Forward -179 -165 -12.2918 0.256
NP_440172.1_6 Forward -123 -104 25.7622 0.00354
NP_442290.1_1 Forward -239 -220 17.109 0.0755
NP_442015.1_3 Forward -399 -380 11.8967 0.285
NP_440198.1_10 Forward -187 -168 6.88262 0.296
NP_441766.1_9 Forward -193 -174 -3.14714 0.296
NP_440416.1_9 Reverse -373 -392 -11.8986 0.155
NP_443052.1_9 Forward -400 -381 3.6377 0.162
NP_443052.1_9 Reverse -157 -176 -3.24547 0.247
NP_442116.1_6 Forward -221 -204 7.40502 0.258
NP_441940.1_1 Reverse -166 -185 7.37347 0.28
NP_440261.1_5 Reverse -177 -190 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCGTCTATTCCCCCGAAGGCCAAGCCCAAGTACAGGAACTGATTGCTTTTTATTTGGAAAATGCTCGCATTATTCGGGAGAAATTAGCCGCCGCTGGTTTGCAGGTTTATGGTGGCATTAACGCTCCCTATGTGTGGGTCAAAACCCCCCATGGCCTGAGCAGTTGGGACTTTTTCGATAAGTTATTACACACAGTTAATGTGGTGGGCACTCCAGGCTCTGGCTTTGGCGCGGCGGGGGAAGGCTATTTCCGCATTTCGGCTTTCAATAGTCGGGCCAATGTGGAGGAAGCGATGGAACGAATCACTTCCACCCTCAAATTGGGTTAGAATCCCTCCCAAAGGTAGCTCTAGCTCTACGCCTTTATCAATTGCCATTCCAGTTTGAAAGGTTTGAAAAC

CDS

ATGGTGCAGTCAACCGTCGAACTTTGGCAAAAAAATCTGCACCGGGCCAAGCAGGCCAGGGATTTAGTTTTCGATTACGCCTTGGGCACCAGTTTAATTACTCTGTTGCCGATCGCCGGTTACTATTCCCTGCGCTTGCTGTTGGTGTTATTTCTGCTGGTGAAGATGTGCCGGGACATTGGTAAGATTTGGCAATTTCCCCGGGGCCAAGACCTGTTGGCGATCGCCGGTAACATTTTTGGGGCCATTGGCGCAGTAATTACCGCCGCTGTGGTTTGGGTCACCCTACTGGCGATCGGGATTTGGGTGCCCTATTTCGACAGTTTTAAAGGCTTTGCGGGGCTGTTTACCCTCACTTGGATGTTGGGCCAAAGCACCAACCAGTACTATGCCAATGGCGCTTTGGGGCATCGTTTCCATCAACCAGTCCAGCCCGACCAGGAGAGCATCAACCATGGGCATCTTTAA

Protein

MVQSTVELWQKNLHRAKQARDLVFDYALGTSLITLLPIAGYYSLRLLLVLFLLVKMCRDIGKIWQFPRGQDLLAIAGNIFGAIGAVITAAVVWVTLLAIGIWVPYFDSFKGFAGLFTLTWMLGQSTNQYYANGALGHRFHQPVQPDQESINHGHL