Your browser is old and dusty. Try Google Chrome!

Details for sll0479

ORF sll0479
Accession NP_442518.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -158 -144 1.96621 0.179
NP_441061.1_2 Reverse -151 -165 -0.197071 0.223
NP_441061.1_2 Forward -136 -122 -1.37704 0.258
NP_440557.1_1 Reverse -151 -170 -2.26216 0.286
NP_440795.1_7 Forward -158 -151 14.6904 0.0123
NP_440795.1_7 Reverse -151 -158 14.6904 0.0123
NP_440795.1_7 Reverse -316 -323 14.1988 0.0267
NP_441418.1_6 Forward -159 -140 -11.9969 0.0586
NP_441418.1_6 Reverse -315 -334 -21.24 0.143
NP_441418.1_6 Forward -300 -281 -30.0898 0.256
NP_442291.1_5 Forward -160 -144 15.9882 0.0222
NP_440897.1_6 Reverse -315 -334 -2.65624 0.219
NP_441453.1_1 Reverse -175 -193 8.3765 0.196
NP_441453.1_1 Forward -331 -313 6.70489 0.227
NP_441453.1_4 Reverse -150 -158 16.539 0.00633
NP_441453.1_4 Forward -159 -151 16.539 0.00633
NP_441453.1_4 Reverse -315 -323 6.80426 0.121
NP_441453.1_4 Forward -44 -36 6.80426 0.121
NP_441453.1_4 Forward -324 -316 6.70593 0.121
NP_441453.1_4 Reverse -35 -43 6.11594 0.121
NP_442151.1_6 Forward -159 -145 8.45605 0.172
NP_442151.1_6 Reverse -150 -164 6.6861 0.224
NP_441818.1_1 Forward -158 -147 15.6928 0.0257
NP_441818.1_1 Reverse -316 -327 12.1529 0.14
NP_441818.1_1 Reverse -151 -162 9.69459 0.232
NP_441818.1_9 Forward -44 -25 -10.4236 0.293
NP_440226.1_1 Reverse -150 -169 14.1591 0.0325
NP_440226.1_1 Forward -159 -140 12.3892 0.0451
NP_440226.1_1 Forward -44 -25 11.7008 0.0509
NP_441630.1_3 Reverse -142 -161 0.786102 0.265
NP_441630.1_3 Forward -52 -33 -0.688862 0.288
NP_442623.1_1 Forward -290 -271 -17.5035 0.271
NP_442173.1_1 Forward -158 -150 15.4574 0.00633
NP_442173.1_1 Reverse -151 -159 15.4574 0.00633
NP_442173.1_1 Reverse -36 -44 12.0158 0.0316
NP_442173.1_1 Forward -323 -315 5.72262 0.203
NP_442173.1_1 Reverse -316 -324 5.72262 0.203
NP_442173.1_1 Forward -43 -35 4.83764 0.241
NP_442752.1_4 Forward -159 -152 13.8055 0.0199
NP_442752.1_4 Reverse -150 -157 13.8055 0.0199
NP_442752.1_4 Forward -44 -37 13.8055 0.0199
NP_442752.1_4 Forward -324 -317 13.5105 0.0314
NP_442752.1_4 Reverse -128 -135 12.1338 0.0546
NP_442752.1_4 Reverse -315 -322 4.26735 0.293
NP_443027.1_4 Forward -161 -151 14.828 0.0437
NP_443027.1_4 Reverse -148 -158 13.1564 0.0521
NP_441812.1_3 Reverse -149 -163 17.3058 0.0613
NP_442975.1_10 Forward -163 -149 13.7653 0.0459
NP_442975.1_10 Reverse -146 -160 3.04726 0.263
NP_442975.1_10 Reverse -31 -45 1.76896 0.291
NP_442975.1_10 Forward -48 -34 1.37564 0.299
NP_440784.1_7 Forward -158 -151 15.9687 0.0123
NP_440784.1_7 Reverse -151 -158 15.9687 0.0123
NP_440784.1_7 Forward -323 -316 13.2155 0.0365
NP_440784.1_7 Reverse -316 -323 12.1338 0.0604
NP_440784.1_7 Forward -43 -36 6.23397 0.241
NP_440784.1_7 Reverse -36 -43 6.13563 0.241
NP_440784.1_7 Forward -299 -292 4.26735 0.272
NP_442909.1_7 Forward -158 -144 18.9768 0.0437
NP_442909.1_7 Forward -43 -29 7.96378 0.194
NP_440061.1_9 Forward -161 -147 20.4518 0.0035
NP_440061.1_9 Reverse -126 -140 6.98048 0.223
NP_440061.1_9 Reverse -313 -327 5.80051 0.272
NP_440110.1_4 Forward -202 -183 2.94938 0.243
NP_442062.1_8 Reverse -150 -160 19.4496 0.000558
NP_442062.1_8 Forward -159 -149 17.3846 0.00193
NP_442062.1_8 Forward -324 -314 9.7148 0.0559
NP_442062.1_8 Reverse -315 -325 7.94484 0.0848
NP_441900.1_3 Forward -156 -139 14.2968 0.242
NP_441859.1_3 Reverse -149 -168 2.6536 0.258
NP_441859.1_3 Reverse -34 -53 1.86696 0.272
NP_440304.1_4 Forward -161 -151 10.8948 0.051
NP_440304.1_4 Reverse -148 -158 9.91146 0.051
NP_440304.1_4 Forward -326 -316 9.12481 0.0626
NP_440304.1_4 Forward -193 -183 5.38824 0.211
NP_442242.1_4 Forward -158 -151 14.3954 0.0124
NP_442242.1_4 Reverse -151 -158 14.3954 0.0124
NP_442242.1_4 Reverse -316 -323 12.0355 0.0521
NP_442242.1_4 Forward -323 -316 11.5438 0.089
NP_442242.1_4 Forward -299 -292 9.38056 0.26
NP_440044.1_8 Forward -158 -139 14.9458 0.0286
NP_440044.1_8 Forward -323 -304 3.83436 0.125
NP_441781.1_7 Forward -324 -305 -2.36049 0.289
NP_441352.1_2 Forward -58 -39 13.0775 0.085
NP_441208.1_9 Reverse -147 -161 13.7659 0.103
NP_441208.1_9 Reverse -32 -46 8.16106 0.219
NP_440370.1_10 Reverse -26 -45 16.8141 0.0713
NP_440370.1_10 Reverse -141 -160 15.2408 0.0889
NP_441083.1_5 Forward -159 -149 20.3345 0.00053
NP_441083.1_5 Reverse -315 -325 16.7946 0.00546
NP_441083.1_5 Reverse -150 -160 11.3864 0.0159
NP_441083.1_5 Reverse -35 -45 8.82982 0.03
NP_441083.1_5 Forward -324 -314 1.74999 0.198
NP_441083.1_5 Forward -44 -34 -1.00328 0.289
NP_442827.1_8 Forward -52 -33 11.11 0.0555
NP_442827.1_8 Reverse -142 -161 2.9486 0.153
NP_442827.1_8 Forward -302 -283 -1.47628 0.247
NP_441434.1_7 Reverse -317 -331 4.32615 0.225
NP_441738.1_2 Forward -157 -150 15.28 0.0102
NP_441738.1_2 Reverse -152 -159 15.28 0.0102
NP_441738.1_2 Reverse -37 -44 15.28 0.0102
NP_441558.1_5 Reverse -33 -52 20.7473 0.00412
NP_441558.1_5 Forward -161 -142 7.47261 0.18
NP_440209.1_1 Reverse -150 -158 18.1123 0.00295
NP_440209.1_1 Forward -159 -151 18.1123 0.00295
NP_440209.1_1 Forward -44 -36 8.57422 0.0425
NP_440209.1_1 Reverse -315 -323 8.37755 0.0576
NP_440209.1_1 Forward -324 -316 8.27922 0.0687
NP_440209.1_1 Reverse -35 -43 5.52596 0.0821
NP_442889.1_8 Forward -162 -148 13.4703 0.0588
NP_442889.1_8 Reverse -312 -326 6.98048 0.167
NP_441713.1_1 Reverse -176 -195 -12.8819 0.25
NP_441713.1_1 Forward -330 -311 -16.5201 0.284
NP_441713.1_8 Reverse -300 -318 9.26226 0.268
NP_441770.1_4 Forward -295 -276 -11.5053 0.29
NP_440178.1_7 Forward -160 -141 -2.45882 0.0369
NP_440178.1_7 Forward -45 -26 -2.95047 0.0423
NP_441716.1_1 Forward -159 -145 18.0925 0.0205
NP_441327.1_5 Forward -176 -167 16.2243 0.164
NP_442111.1_4 Reverse -34 -48 7.07942 0.105
NP_442111.1_4 Reverse -314 -328 5.1128 0.176
NP_441163.1_9 Forward -168 -149 12.8808 0.27
NP_440906.1_5 Forward -158 -151 15.8704 0.0124
NP_440906.1_5 Reverse -151 -158 15.8704 0.0124
NP_440906.1_5 Forward -323 -316 13.3138 0.0268
NP_440906.1_5 Forward -43 -36 6.23397 0.234
NP_440906.1_5 Reverse -316 -323 6.13563 0.241
NP_440906.1_5 Reverse -36 -43 6.13563 0.241
NP_440747.1_10 Reverse -147 -159 7.51213 0.00286
NP_440747.1_10 Forward -162 -150 -2.02597 0.0196
NP_440747.1_10 Reverse -312 -324 -4.28759 0.0903
NP_440747.1_10 Forward -327 -315 -11.8591 0.161
NP_440747.1_10 Reverse -125 -137 -12.4491 0.282
NP_441130.1_10 Forward -161 -147 20.0591 0.00928
NP_441130.1_10 Reverse -33 -47 9.14437 0.128
NP_441130.1_10 Reverse -148 -162 8.16106 0.14
NP_441130.1_10 Forward -326 -312 5.80112 0.214
NP_441130.1_10 Reverse -289 -303 4.62115 0.275
NP_441486.1_1 Forward -162 -148 13.1759 0.00897
NP_441486.1_1 Reverse -147 -161 11.3077 0.0164
NP_441486.1_1 Reverse -312 -326 10.9143 0.018
NP_441486.1_1 Forward -327 -313 -5.31028 0.231
NP_442145.1_3 Reverse -142 -161 5.11266 0.267
NP_442634.1_4 Reverse -148 -162 -3.63866 0.161
NP_442634.1_4 Forward -193 -179 -5.21195 0.241
NP_440470.1_5 Forward -365 -346 7.20922 0.279
NP_441014.1_10 Reverse -149 -168 -1.47628 0.262
NP_442848.1_1 Reverse -144 -158 16.7159 0.0143
NP_442848.1_1 Forward -165 -151 -2.45868 0.263
NP_443018.1_3 Forward -158 -151 14.8871 0.0123
NP_443018.1_3 Reverse -151 -158 14.8871 0.0123
NP_443018.1_3 Reverse -36 -43 11.7405 0.0655
NP_443018.1_3 Forward -43 -36 5.44732 0.193
NP_443018.1_3 Reverse -316 -323 5.15232 0.226
NP_443018.1_3 Forward -323 -316 5.05399 0.238
NP_441316.1_7 Forward -161 -146 -3.36336 0.273
NP_441634.1_8 Reverse -148 -162 5.21113 0.114
NP_441634.1_8 Forward -161 -147 3.14618 0.155
NP_440376.1_1 Forward -159 -150 19.4693 0.000692
NP_440376.1_1 Reverse -150 -159 19.4693 0.000692
NP_440376.1_1 Forward -324 -315 9.83282 0.0339
NP_440376.1_1 Reverse -315 -324 9.73449 0.0365
NP_440376.1_1 Forward -44 -35 5.99792 0.111
NP_440376.1_1 Reverse -128 -137 0.0980582 0.285
NP_440376.1_1 Reverse -35 -44 -0.196935 0.285
NP_441588.1_4 Reverse -152 -162 6.96153 0.178
NP_441588.1_4 Forward -322 -312 6.66654 0.185
NP_442687.1_7 Forward -325 -315 17.5813 0.0089
NP_442687.1_7 Forward -160 -150 15.8113 0.0125
NP_442687.1_7 Reverse -149 -159 8.92815 0.0994
NP_442687.1_7 Reverse -314 -324 6.07655 0.179
NP_442687.1_7 Forward -45 -35 4.50326 0.245
NP_442485.1_3 Reverse -276 -295 -1.47551 0.259
NP_441846.1_10 Forward -54 -35 -12.4886 0.19
NP_442958.1_3 Reverse -139 -158 15.7324 0.0448
NP_440642.1_8 Reverse -37 -56 18.3879 0.0742
NP_440042.1_2 Reverse -271 -290 -3.44213 0.282
NP_441422.1_7 Forward -161 -144 5.54538 0.0992
NP_441422.1_7 Reverse -33 -50 -8.22096 0.266
NP_442658.1_1 Forward -161 -151 15.9091 0.00966
NP_442658.1_1 Reverse -148 -158 9.616 0.147
NP_442658.1_1 Forward -46 -36 9.02601 0.169
NP_442658.1_1 Forward -298 -288 7.64939 0.213
NP_442658.1_1 Reverse -313 -323 6.27276 0.234
NP_442658.1_1 Forward -326 -316 4.99446 0.288
NP_440141.1_8 Forward -168 -149 6.58763 0.256
NP_442205.1_9 Reverse -144 -160 -1.80975 0.264
NP_441414.1_9 Reverse -150 -169 1.0811 0.0762
NP_441414.1_9 Forward -324 -305 -5.40875 0.176
NP_441414.1_9 Forward -44 -25 -6.29373 0.192
NP_441487.1_9 Forward -160 -141 3.83436 0.154
NP_442937.1_5 Reverse -145 -164 14.5524 0.0754
NP_441958.1_5 Forward -160 -150 12.2714 0.00183
NP_441958.1_5 Reverse -149 -159 12.2714 0.00183
NP_441958.1_5 Forward -325 -315 10.6981 0.0112
NP_441958.1_5 Reverse -314 -324 2.53664 0.0409
NP_441958.1_5 Reverse -34 -44 1.55333 0.095
NP_441958.1_5 Forward -45 -35 0.865012 0.12
NP_441127.1_1 Forward -290 -276 15.6342 0.114
NP_442836.1_5 Reverse -144 -163 20.8456 0.0181
NP_440203.1_5 Reverse -74 -84 9.22267 0.268
NP_439905.1_1 Reverse -36 -49 8.18076 0.236
NP_440984.1_7 Reverse -145 -159 9.14437 0.131
NP_439990.1_5 Forward -164 -151 6.70579 0.223
NP_442690.1_1 Forward -366 -347 1.37609 0.11
NP_442911.1_2 Forward -169 -150 11.5042 0.0131
NP_442911.1_2 Reverse -140 -159 -2.85214 0.104
NP_442911.1_2 Reverse -305 -324 -10.3253 0.276
NP_440153.1_5 Forward -158 -144 17.6008 0.0482
NP_440153.1_5 Forward -43 -29 9.63603 0.119
NP_440153.1_5 Reverse -36 -50 2.65453 0.219
NP_440153.1_5 Forward -299 -285 1.17956 0.268
NP_443055.1_6 Reverse -142 -160 -2.24319 0.291
NP_442236.1_2 Reverse -303 -322 19.5673 0.0908
NP_440993.1_2 Reverse -30 -46 12.3499 0.0735
NP_440993.1_4 Forward -137 -120 2.00546 0.3
NP_441099.1_5 Reverse -140 -159 0.0977854 0.0846
NP_442002.1_9 Reverse -314 -321 10.7572 0.185
NP_442002.1_9 Forward -160 -153 10.7572 0.185
NP_442002.1_9 Forward -45 -38 10.7572 0.185
NP_440809.1_9 Forward -333 -315 -7.84733 0.225
NP_441294.1_7 Reverse -311 -325 17.0257 0.0103
NP_441294.1_7 Forward -163 -149 9.4426 0.244
NP_442438.1_10 Reverse -145 -159 2.85119 0.168
NP_442438.1_10 Forward -164 -150 1.57289 0.191
NP_442438.1_10 Reverse -310 -324 1.47456 0.194
NP_442431.1_10 Forward -384 -366 1.19912 0.259
NP_441000.1_6 Forward -325 -311 4.81781 0.0933
NP_441000.1_6 Reverse -34 -48 3.73617 0.105
NP_441000.1_6 Forward -160 -146 2.85119 0.126
NP_441000.1_6 Reverse -149 -163 -3.44199 0.221
NP_441000.1_6 Reverse -290 -304 -3.73699 0.225
NP_441000.1_6 Forward -301 -287 -5.50694 0.279
NP_440147.1_4 Forward -161 -148 12.8023 0.0326
NP_440147.1_4 Reverse -313 -326 9.85238 0.0371
NP_440147.1_4 Forward -46 -33 1.10092 0.239
NP_440147.1_4 Reverse -148 -161 0.805932 0.244
NP_441550.1_8 Reverse -148 -158 16.7941 0.00906
NP_441550.1_8 Reverse -33 -43 12.8609 0.0296
NP_441550.1_8 Forward -326 -316 12.8609 0.0296
NP_441550.1_8 Forward -46 -36 9.22267 0.103
NP_441550.1_8 Forward -161 -151 6.0761 0.214
NP_441916.1_7 Reverse -150 -160 18.4663 0.00144
NP_441916.1_7 Forward -159 -149 10.3048 0.0261
NP_441916.1_7 Forward -324 -314 8.63316 0.0437
NP_441916.1_7 Reverse -315 -325 7.15819 0.0745
NP_440465.1_10 Reverse -32 -51 5.40766 0.212
NP_441041.1_7 Forward -162 -150 10.916 0.0864
NP_441041.1_7 Reverse -312 -324 9.74986 0.108
NP_441041.1_7 Forward -47 -35 5.6684 0.245
NP_442396.1_5 Forward -163 -150 6.90245 0.215
NP_442004.1_6 Reverse -315 -329 2.75286 0.257
NP_440703.1_9 Forward -313 -300 5.91857 0.288
NP_441725.1_5 Reverse -316 -326 11.2881 0.0247
NP_441725.1_5 Reverse -151 -161 11.2881 0.0247
NP_441725.1_5 Forward -158 -148 9.02648 0.0553
NP_441725.1_5 Reverse -36 -46 -0.806614 0.271
NP_439966.1_7 Forward -161 -151 18.4657 0.00473
NP_439966.1_7 Reverse -148 -158 14.8275 0.0177
NP_439966.1_7 Reverse -33 -43 13.5492 0.0263
NP_439966.1_7 Forward -46 -36 7.74772 0.15
NP_439966.1_7 Forward -302 -292 4.7978 0.258
NP_439966.1_9 Forward -46 -37 10.7178 0.0863
NP_439966.1_9 Forward -161 -152 0.983037 0.253
NP_439966.1_9 Reverse -148 -157 0.884706 0.253
NP_442941.1_3 Reverse -151 -161 11.4848 0.0116
NP_442941.1_3 Forward -158 -148 10.9931 0.0116
NP_442941.1_3 Reverse -316 -326 8.82982 0.0333
NP_440289.1_2 Forward -162 -149 21.3571 0.00262
NP_440289.1_2 Reverse -312 -325 5.72248 0.0616
NP_440289.1_2 Forward -327 -314 -3.22564 0.267
NP_440289.1_2 Reverse -147 -160 -4.50394 0.288
NP_440260.1_8 Forward -333 -315 -5.88071 0.279
NP_442281.1_1 Forward -164 -150 11.012 0.0511
NP_442281.1_1 Reverse -145 -159 7.3738 0.102
NP_442281.1_1 Reverse -310 -324 3.93223 0.213
NP_440177.1_1 Forward -331 -313 7.88563 0.272
NP_440437.1_1 Forward -165 -146 17.404 0.0176
NP_441457.1_7 Reverse -33 -52 2.85105 0.255
NP_441644.1_6 Forward -159 -149 17.3841 0.00127
NP_441644.1_6 Reverse -315 -325 12.4676 0.0321
NP_441644.1_6 Reverse -150 -160 10.1076 0.0628
NP_441644.1_6 Reverse -35 -45 7.15773 0.133
NP_441644.1_6 Forward -44 -34 5.68278 0.18
NP_441644.1_6 Forward -137 -127 3.32285 0.288
NP_443049.1_6 Forward -45 -35 11.6409 0.24
NP_443049.1_6 Reverse -258 -268 11.3482 0.263
NP_440867.1_10 Forward -297 -278 3.73603 0.283
NP_442215.1_2 Reverse -313 -329 1.92682 0.125
NP_442215.1_2 Reverse -148 -164 1.43517 0.134
NP_442215.1_2 Forward -140 -124 -0.531451 0.168
NP_442215.1_2 Reverse -114 -130 -4.36636 0.232
NP_440253.1_2 Forward -159 -141 13.7855 0.0208
NP_440253.1_2 Reverse -150 -168 3.46073 0.116
NP_440929.1_8 Forward -159 -150 19.2726 0.000701
NP_440929.1_8 Reverse -150 -159 19.2726 0.000701
NP_440929.1_8 Reverse -315 -324 9.53783 0.0296
NP_440929.1_8 Forward -324 -315 9.4395 0.0326
NP_440929.1_8 Reverse -35 -44 7.07956 0.0713
NP_440929.1_8 Reverse -291 -300 6.29291 0.106
NP_442933.1_10 Forward -159 -150 17.601 0.00325
NP_442933.1_10 Reverse -150 -159 17.601 0.00325
NP_442933.1_10 Forward -324 -315 13.9627 0.0192
NP_442933.1_10 Reverse -315 -324 7.86621 0.103
NP_441751.2_8 Reverse -151 -165 3.04785 0.0737
NP_441751.2_8 Forward -158 -144 -3.147 0.134
NP_441751.2_8 Reverse -316 -330 -3.93365 0.157
NP_442554.1_8 Forward -158 -148 18.0729 0.00543
NP_442554.1_8 Reverse -151 -161 13.8447 0.0145
NP_442554.1_8 Forward -43 -33 7.25653 0.0955
NP_442554.1_8 Reverse -36 -46 6.17489 0.125
NP_442554.1_8 Reverse -316 -326 5.09324 0.161
NP_442554.1_8 Forward -323 -313 3.71661 0.215
NP_441762.1_7 Forward -160 -148 11.8387 0.0142
NP_441762.1_7 Forward -325 -313 8.88877 0.0143
NP_441762.1_7 Forward -45 -33 4.07055 0.0572
NP_441762.1_7 Reverse -149 -161 2.89058 0.0676
NP_441762.1_7 Reverse -34 -46 -4.77924 0.182
NP_441762.1_7 Reverse -314 -326 -7.53251 0.293
NP_442142.1_4 Forward -162 -149 15.85 0.0264
NP_442142.1_4 Reverse -147 -160 6.90188 0.153
NP_442292.1_1 Forward -158 -149 18.486 0.00229
NP_442292.1_1 Reverse -151 -160 9.63616 0.0183
NP_442292.1_1 Forward -323 -314 0.196389 0.234
NP_442292.1_1 Reverse -316 -325 -0.196935 0.239
NP_442292.1_1 Reverse -36 -45 -0.196935 0.239
NP_442292.1_5 Forward -58 -39 7.66927 0.15
NP_442292.1_5 Reverse -146 -165 -0.4922 0.257
NP_442476.1_6 Forward -158 -144 9.73436 0.0801
NP_442381.1_8 Forward -162 -143 -15.0452 0.292
NP_442381.1_9 Reverse -346 -365 11.9958 0.202
NP_441711.1_4 Reverse -26 -45 9.24257 0.144
NP_441711.1_4 Reverse -141 -160 4.71934 0.202
NP_443009.1_5 Reverse -149 -160 18.3477 0.00265
NP_443009.1_5 Forward -325 -314 16.971 0.00677
NP_441715.1_4 Reverse -151 -161 16.303 0.0117
NP_441715.1_4 Forward -158 -148 7.84651 0.107
NP_441715.1_4 Reverse -316 -326 7.25653 0.108
NP_441715.1_4 Reverse -292 -302 6.76487 0.129
NP_441715.1_4 Forward -299 -289 6.46988 0.143
NP_441198.1_5 Forward -157 -144 13.49 0.206
NP_441468.1_1 Forward -158 -151 15.8704 0.0124
NP_441468.1_1 Reverse -151 -158 15.8704 0.0124
NP_441468.1_1 Forward -323 -316 6.3323 0.202
NP_441468.1_1 Reverse -316 -323 6.13563 0.209
NP_441468.1_1 Forward -43 -36 6.13563 0.209
NP_441468.1_1 Reverse -36 -43 6.0373 0.223
NP_441020.2_6 Reverse -148 -165 8.98696 0.182
NP_441020.2_6 Forward -298 -281 8.88863 0.185
NP_441015.1_10 Forward -56 -37 -7.96535 0.272
NP_441673.1_1 Forward -159 -150 20.8459 0.000698
NP_441673.1_1 Reverse -150 -159 20.8459 0.000698
NP_441673.1_1 Reverse -315 -324 11.1111 0.0121
NP_441673.1_1 Forward -324 -315 11.0128 0.018
NP_441673.1_1 Forward -44 -35 1.37636 0.114
NP_441673.1_1 Reverse -35 -44 1.1797 0.163
NP_441673.1_1 Forward -300 -291 -8.06341 0.254
NP_441731.1_3 Reverse -120 -139 2.94938 0.166
NP_441956.1_1 Reverse -210 -229 17.7426 0.225
NP_441826.1_2 Reverse -144 -158 9.43936 0.0597
NP_441826.1_2 Forward -165 -151 2.16287 0.134
NP_441826.1_2 Forward -306 -292 -4.22864 0.293
NP_441826.1_5 Forward -299 -280 8.75091 0.202
NP_442868.1_6 Reverse -148 -158 17.4829 0.012
NP_442868.1_6 Forward -161 -151 0.963343 0.205
NP_441612.1_2 Forward -159 -149 8.54929 0.21
NP_442427.1_8 Forward -168 -149 11.9958 0.152
NP_442808.1_1 Forward -160 -150 18.4657 0.00201
NP_442808.1_1 Reverse -34 -44 9.71433 0.0481
NP_442808.1_1 Reverse -314 -324 8.92768 0.0481
NP_442808.1_1 Reverse -149 -159 8.63269 0.0481
NP_440031.1_10 Reverse -117 -136 5.211 0.256
NP_440145.1_3 Reverse -140 -159 0.687771 0.134
NP_442542.1_2 Reverse -148 -161 4.54251 0.3
NP_442113.1_10 Reverse -283 -302 -9.44032 0.295
NP_442050.1_5 Reverse -148 -158 15.6142 0.01
NP_442050.1_5 Reverse -33 -43 14.0409 0.0259
NP_442050.1_5 Forward -161 -151 9.12434 0.193
NP_441518.1_3 Reverse -140 -159 -13.7669 0.264
NP_441518.1_4 Reverse -28 -47 12.1917 0.127
NP_441878.1_6 Forward -325 -315 10.4031 0.0176
NP_441878.1_6 Forward -160 -150 10.4031 0.0176
NP_441878.1_6 Reverse -149 -159 10.4031 0.0176
NP_441878.1_6 Reverse -314 -324 0.668351 0.139
NP_441036.1_8 Forward -160 -150 17.7779 0.000554
NP_441036.1_8 Reverse -149 -159 8.33817 0.174
NP_441036.1_8 Reverse -314 -324 8.04317 0.177
NP_441036.1_8 Forward -45 -35 6.8632 0.213
NP_441557.1_5 Forward -159 -150 19.9609 0.000699
NP_441557.1_5 Reverse -150 -159 19.9609 0.000699
NP_441557.1_5 Reverse -315 -324 10.2261 0.0144
NP_441557.1_5 Forward -324 -315 10.1278 0.0188
NP_441557.1_5 Forward -44 -35 1.08137 0.0794
NP_441557.1_5 Reverse -35 -44 0.589713 0.134
NP_441557.1_8 Forward -136 -126 16.0075 0.18
NP_441445.1_1 Forward -168 -149 13.3725 0.0607
NP_441445.1_1 Forward -333 -314 10.4225 0.0952
NP_441445.1_1 Forward -53 -34 6.58763 0.146
NP_441445.1_1 Reverse -141 -160 2.3594 0.235
NP_441445.1_8 Forward -130 -111 -4.42544 0.277
NP_442066.2_9 Forward -163 -150 9.36073 0.175
NP_442419.1_2 Forward -383 -364 -1.57384 0.246
NP_441308.1_8 Forward -161 -151 10.1081 0.22
NP_440101.1_5 Forward -166 -147 5.40766 0.196
NP_441458.1_10 Forward -168 -149 11.5042 0.108
NP_442183.1_1 Forward -159 -145 13.9626 0.0376
NP_442183.1_1 Reverse -150 -164 13.4709 0.0423
NP_442183.1_1 Forward -44 -30 11.7993 0.0675
NP_442397.1_1 Forward -289 -275 16.7114 0.24
NP_442494.1_7 Reverse -124 -143 -0.39387 0.246
NP_440861.1_3 Forward -41 -23 8.86894 0.296
NP_441238.1_10 Forward -206 -192 12.8809 0.292
NP_442170.1_5 Forward -44 -25 -3.14714 0.267
NP_442347.1_2 Forward -323 -314 13.3727 0.056
NP_442347.1_2 Forward -158 -149 12.4878 0.056
NP_442347.1_2 Reverse -151 -160 11.1111 0.056
NP_442347.1_2 Reverse -36 -45 8.94785 0.0718
NP_442347.1_2 Forward -136 -127 3.7363 0.284
NP_442645.1_2 Reverse -142 -161 -11.0136 0.144
NP_442645.1_2 Forward -332 -313 -13.7669 0.164
NP_441037.1_4 Reverse -148 -158 9.55921 0.21
NP_441037.1_4 Forward -46 -36 7.22024 0.237
NP_441037.1_4 Forward -161 -151 7.02532 0.237
NP_442594.1_8 Forward -123 -104 7.86593 0.211
NP_442317.1_6 Forward -164 -145 5.50599 0.24
NP_442738.1_5 Forward -88 -69 11.3075 0.199
NP_441633.1_3 Reverse -313 -326 10.5407 0.0286
NP_441633.1_3 Forward -161 -148 6.01747 0.0481
NP_441633.1_3 Reverse -148 -161 1.29759 0.109
NP_441633.1_3 Reverse -289 -302 -4.20895 0.185
NP_440136.1_2 Forward -158 -151 15.9687 0.0123
NP_440136.1_2 Reverse -151 -158 15.9687 0.0123
NP_440136.1_2 Forward -323 -316 6.43063 0.154
NP_440136.1_2 Forward -43 -36 6.23397 0.171
NP_440136.1_2 Reverse -316 -323 6.23397 0.171
NP_440136.1_2 Reverse -36 -43 6.13563 0.193
NP_441728.2_4 Reverse -347 -366 13.8937 0.235
NP_442998.1_10 Forward -157 -150 15.5754 0.0102
NP_442998.1_10 Reverse -152 -159 15.5754 0.0102
NP_442998.1_10 Reverse -37 -44 15.5754 0.0102
NP_442998.1_10 Reverse -184 -191 7.21728 0.144
NP_442998.1_10 Forward -322 -315 5.93897 0.206
NP_442998.1_10 Reverse -317 -324 5.84064 0.235
NP_440299.1_1 Reverse -146 -159 9.85179 0.0646
NP_440299.1_1 Forward -328 -315 5.91857 0.158
NP_440299.1_1 Reverse -79 -92 3.26365 0.251
NP_440299.1_1 Forward -163 -150 2.18201 0.294
NP_441799.1_1 Reverse -146 -160 16.6169 0.0138
NP_441799.1_1 Forward -163 -149 11.012 0.0629
NP_441799.1_1 Reverse -31 -45 10.8154 0.0668
NP_441799.1_1 Forward -328 -314 5.30886 0.214
NP_441007.1_10 Reverse -145 -158 8.9674 0.108
NP_441007.1_10 Reverse -30 -43 -0.472371 0.285
NP_442201.1_10 Forward -55 -36 -14.6519 0.285
NP_440256.1_1 Reverse -312 -331 -4.03212 0.145
NP_440256.1_1 Reverse -147 -166 -7.76869 0.245
NP_441559.1_8 Forward -164 -150 -6.29359 0.276
NP_441559.1_8 Reverse -178 -192 -7.08024 0.283
NP_440915.1_6 Reverse -124 -138 5.50613 0.0898
NP_440915.1_6 Forward -48 -34 5.40779 0.0903
NP_440915.1_6 Reverse -311 -325 1.76955 0.131
NP_440915.1_6 Forward -163 -149 -3.24533 0.292
NP_441179.1_1 Forward -47 -28 4.22769 0.247
NP_441179.1_1 Forward -162 -143 3.14605 0.247
NP_440717.1_3 Reverse -119 -133 6.88214 0.291
NP_442452.1_3 Reverse -133 -152 0.687771 0.282
NP_441464.1_8 Forward -159 -145 9.5377 0.189
NP_441464.1_8 Reverse -315 -329 6.3911 0.236
NP_440695.1_5 Reverse -315 -334 -1.96717 0.293
NP_441939.1_3 Forward -158 -139 8.35759 0.175
NP_441199.1_6 Reverse -31 -50 1.86774 0.207
NP_442993.1_1 Reverse -150 -166 9.20332 0.0215
NP_442993.1_1 Reverse -99 -115 -11.4462 0.247
NP_442386.1_9 Forward -160 -151 15.7322 0.0144
NP_442386.1_9 Reverse -149 -158 13.8639 0.0289
NP_442386.1_9 Reverse -314 -323 6.19416 0.23
NP_442386.1_9 Forward -45 -36 5.9975 0.23
NP_442386.1_9 Reverse -34 -43 4.52254 0.297
NP_441340.1_5 Forward -158 -151 15.6737 0.0124
NP_441340.1_5 Reverse -151 -158 15.6737 0.0124
NP_441340.1_5 Forward -43 -36 13.5105 0.0314
NP_441340.1_5 Reverse -316 -323 5.93897 0.198
NP_441340.1_5 Forward -323 -316 5.84064 0.208
NP_441340.1_5 Reverse -36 -43 5.84064 0.208
NP_441271.1_8 Forward -130 -120 14.238 0.266
NP_441947.1_4 Forward -170 -151 16.1257 0.136
NP_440168.1_9 Reverse -24 -43 -2.36049 0.28
NP_440327.1_6 Reverse -117 -136 13.0775 0.162
NP_442240.1_2 Forward -158 -139 -15.2418 0.205
NP_440161.1_3 Reverse -148 -167 15.1424 0.117
NP_440586.1_8 Forward -158 -151 13.2151 0.026
NP_440586.1_8 Reverse -151 -158 13.2151 0.026
NP_440586.1_8 Reverse -316 -323 11.1501 0.0845
NP_440586.1_8 Reverse -36 -43 9.47853 0.146
NP_440586.1_8 Forward -43 -36 5.74197 0.283
NP_442251.1_6 Forward -158 -151 15.2804 0.0124
NP_442251.1_6 Reverse -151 -158 15.2804 0.0124
NP_442251.1_6 Reverse -316 -323 13.7071 0.0268
NP_440684.1_9 Reverse -309 -323 8.25939 0.233
NP_441262.1_3 Reverse -150 -157 14.7888 0.0223
NP_441262.1_3 Forward -159 -152 14.7888 0.0223
NP_441262.1_3 Forward -44 -37 14.7888 0.0223
NP_443051.1_1 Reverse -149 -158 10.4228 0.00754
NP_443051.1_1 Forward -160 -151 10.4228 0.00754
NP_443051.1_1 Forward -325 -316 8.25953 0.0414
NP_443051.1_1 Forward -45 -36 7.47288 0.0571
NP_443051.1_1 Reverse -314 -323 0.688044 0.134
NP_443051.1_1 Reverse -34 -43 0.29472 0.195
NP_441232.1_10 Forward -335 -316 10.8159 0.105
NP_439984.1_3 Reverse -143 -157 12.487 0.272
NP_439937.1_9 Reverse -34 -51 -9.00826 0.179
NP_439937.1_9 Forward -160 -143 -15.9897 0.287
NP_439937.1_9 Reverse -314 -331 -16.4814 0.287
NP_439937.1_9 Forward -325 -308 -16.5797 0.287
NP_439937.1_9 Reverse -149 -166 -16.5797 0.287
NP_440439.1_1 Reverse -147 -160 10.8357 0.0339
NP_440439.1_1 Forward -47 -34 8.37742 0.0537
NP_440439.1_1 Reverse -32 -45 7.6891 0.0624
NP_440439.1_1 Forward -162 -149 1.19926 0.159
NP_440439.1_1 Reverse -125 -138 0.805932 0.175
NP_440372.1_2 Forward -158 -151 16.3621 0.0124
NP_440372.1_2 Reverse -151 -158 16.3621 0.0124
NP_440372.1_2 Forward -43 -36 13.8055 0.0214
NP_440372.1_2 Reverse -316 -323 6.62729 0.151
NP_440372.1_2 Forward -323 -316 6.52896 0.188
NP_440372.1_2 Reverse -36 -43 6.52896 0.188
NP_440171.1_3 Forward -118 -99 2.16274 0.288
NP_440316.1_10 Forward -45 -35 11.1898 0.214
NP_439977.1_5 Forward -165 -146 0.687771 0.205
NP_440139.1_1 Forward -330 -311 12.6833 0.0734
NP_440139.1_1 Reverse -309 -328 6.29183 0.143
NP_441572.1_7 Forward -306 -287 6.39097 0.0804
NP_441572.1_7 Forward -330 -311 -0.787193 0.184
NP_440267.1_2 Forward -345 -331 4.62054 0.3
NP_442384.1_10 Reverse -315 -328 14.0806 0.0169
NP_442384.1_10 Reverse -150 -163 6.50913 0.0995
NP_442384.1_10 Forward -324 -311 6.31247 0.105
NP_442384.1_10 Forward -137 -124 5.42749 0.13
NP_442384.1_10 Forward -159 -146 3.95252 0.172
NP_442114.1_4 Reverse -35 -46 11.3667 0.129
NP_440699.1_1 Reverse -340 -359 1.4797 0.291
NP_442790.1_4 Forward -53 -34 -11.8986 0.237
NP_442262.1_10 Forward -158 -151 14.1988 0.0123
NP_442262.1_10 Reverse -151 -158 14.1988 0.0123
NP_442262.1_10 Reverse -36 -43 13.2155 0.0213
NP_441689.1_5 Forward -161 -151 8.53436 0.132
NP_441689.1_5 Reverse -148 -158 5.87944 0.197
NP_440163.1_10 Forward -162 -152 15.2213 0.0762
NP_440344.1_10 Forward -166 -149 12.2319 0.006
NP_440344.1_10 Reverse -308 -325 -1.53445 0.0547
NP_440344.1_10 Forward -331 -314 -2.91109 0.0757
NP_440344.1_10 Forward -295 -278 -13.5308 0.287
NP_440282.1_2 Reverse -106 -125 6.09597 0.295
NP_442910.1_1 Reverse -308 -327 3.53937 0.118
NP_440562.1_10 Reverse -188 -206 9.16393 0.284
NP_441965.1_3 Reverse -305 -324 0.392778 0.238
NP_441965.1_10 Reverse -147 -163 8.61333 0.123
NP_440297.1_9 Reverse -316 -326 9.32148 0.0917
NP_440297.1_9 Reverse -151 -161 9.32148 0.0917
NP_440297.1_9 Forward -158 -148 -0.216628 0.282
NP_440894.1_7 Forward -62 -43 9.24175 0.245
NP_440894.1_10 Forward -164 -145 4.81767 0.243
NP_440999.1_9 Forward -163 -149 11.111 0.0474
NP_440888.1_2 Forward -159 -145 16.2235 0.00758
NP_440888.1_2 Reverse -150 -164 14.5519 0.0168
NP_440888.1_2 Reverse -35 -49 12.3887 0.046
NP_440888.1_2 Forward -137 -123 9.14375 0.137
NP_440888.1_2 Forward -324 -310 6.29216 0.241
NP_442948.1_2 Forward -160 -141 4.32602 0.264
NP_442033.1_10 Forward -161 -142 -14.1602 0.297
NP_441949.1_2 Reverse -140 -159 4.62101 0.261
NP_441543.1_2 Reverse -151 -160 18.486 0.00236
NP_441543.1_2 Forward -158 -149 16.9127 0.00359
NP_441543.1_2 Forward -323 -314 8.65285 0.0968
NP_441543.1_2 Reverse -36 -45 8.65285 0.0968
NP_441543.1_2 Reverse -316 -325 6.29291 0.153
NP_442845.1_2 Forward -50 -36 4.12949 0.267
NP_442845.1_2 Reverse -144 -158 3.44117 0.29
NP_441551.1_5 Reverse -146 -162 7.03934 0.249
NP_441469.1_8 Forward -160 -151 16.126 0.00797
NP_441469.1_8 Reverse -314 -323 12.8811 0.0929
NP_441469.1_8 Reverse -149 -158 6.48957 0.227
NP_441469.1_8 Forward -45 -36 6.39124 0.227
NP_442315.1_1 Forward -119 -101 5.03403 0.256
NP_443064.1_6 Reverse -315 -325 17.7057 0.065
NP_443064.1_6 Forward -159 -149 12.5669 0.0796
NP_442578.1_7 Forward -158 -151 14.5921 0.026
NP_442578.1_7 Reverse -151 -158 14.5921 0.026
NP_442578.1_7 Reverse -316 -323 12.5271 0.0544
NP_442578.1_7 Forward -43 -36 6.0373 0.18
NP_442286.1_1 Forward -159 -140 11.9958 0.169
NP_441462.1_2 Forward -44 -34 16.2046 0.00406
NP_441462.1_2 Forward -159 -149 11.5831 0.00406
NP_441462.1_2 Reverse -150 -160 11.5831 0.00406
NP_441462.1_2 Reverse -315 -325 10.4031 0.011
NP_441462.1_2 Forward -324 -314 1.74999 0.0811
NP_441621.1_7 Forward -46 -32 5.80112 0.0726
NP_441621.1_7 Forward -161 -147 -3.24533 0.188
NP_441621.1_7 Reverse -33 -47 -3.34366 0.188
NP_441621.1_7 Reverse -148 -162 -3.44199 0.188
NP_441621.1_7 Forward -193 -179 -5.01529 0.248
NP_443062.1_1 Forward -137 -119 7.66836 0.17
NP_443062.1_1 Reverse -35 -53 7.27833 0.18
NP_443062.1_1 Reverse -150 -168 6.20575 0.206
NP_443062.1_6 Forward -167 -148 13.5691 0.0914
NP_443062.1_6 Reverse -307 -326 7.27595 0.171
NP_443062.1_6 Reverse -142 -161 2.0644 0.262
NP_442204.1_1 Reverse -124 -135 3.40192 0.266
NP_442204.1_5 Forward -169 -150 5.11266 0.16
NP_440255.1_9 Reverse -339 -358 17.8088 0.212
NP_440516.1_2 Forward -165 -147 5.23069 0.132
NP_440516.1_8 Forward -44 -35 18.9776 0.00442
NP_440516.1_8 Forward -159 -150 16.9127 0.00442
NP_440516.1_8 Reverse -150 -159 16.9127 0.00442
NP_440516.1_8 Reverse -315 -324 7.17789 0.0754
NP_440516.1_8 Forward -324 -315 7.07956 0.0867
NP_440516.1_8 Reverse -35 -44 5.01461 0.118
NP_442428.1_5 Forward -158 -151 15.8704 0.0124
NP_442428.1_5 Reverse -151 -158 15.8704 0.0124
NP_442428.1_5 Forward -323 -316 13.1171 0.038
NP_442428.1_5 Reverse -316 -323 6.23397 0.201
NP_442428.1_5 Forward -43 -36 6.13563 0.209
NP_442428.1_5 Reverse -36 -43 6.0373 0.212
NP_440783.1_8 Forward -217 -198 7.96345 0.229
NP_442859.1_2 Forward -43 -24 4.916 0.212
NP_440673.1_2 Reverse -140 -159 8.63366 0.264
NP_440673.1_3 Forward -157 -150 12.4288 0.0426
NP_440673.1_3 Reverse -152 -159 12.4288 0.0426
NP_440673.1_3 Reverse -37 -44 12.4288 0.0426
NP_440673.1_3 Forward -322 -315 10.1672 0.149
NP_441052.1_2 Forward -159 -149 19.9412 0.00106
NP_441052.1_2 Reverse -150 -160 10.5014 0.0285
NP_441052.1_2 Forward -324 -314 8.23984 0.0482
NP_441052.1_2 Reverse -315 -325 7.35486 0.0742
NP_441052.1_2 Reverse -35 -45 1.25834 0.249
NP_440992.1_2 Forward -329 -310 15.6341 0.189
NP_442219.1_9 Forward -158 -149 17.7976 0.00718
NP_442219.1_9 Reverse -151 -160 8.35786 0.0681
NP_442219.1_9 Forward -323 -314 5.11294 0.186
NP_440436.1_4 Reverse -151 -160 18.1905 0.00233
NP_440436.1_4 Forward -158 -149 17.2072 0.00233
NP_440436.1_4 Reverse -36 -45 8.55409 0.0997
NP_440436.1_4 Forward -323 -314 8.35743 0.109
NP_440436.1_4 Reverse -316 -325 6.39082 0.162
NP_440436.1_4 Reverse -292 -301 5.89917 0.176
NP_441884.1_8 Forward -45 -26 9.3409 0.0541
NP_441884.1_9 Forward -162 -143 -4.72043 0.0594
NP_441884.1_9 Forward -47 -28 -22.715 0.284
NP_440314.1_9 Forward -158 -139 -9.34199 0.264
NP_441719.1_4 Forward -158 -151 16.3621 0.0124
NP_441719.1_4 Reverse -151 -158 16.3621 0.0124
NP_441719.1_4 Forward -43 -36 6.82395 0.0855
NP_441719.1_4 Reverse -316 -323 6.62729 0.151
NP_441719.1_4 Forward -323 -316 6.52896 0.188
NP_441719.1_4 Reverse -36 -43 6.52896 0.188
NP_441733.1_10 Reverse -147 -160 10.639 0.106
NP_441004.1_1 Forward -120 -101 -7.86702 0.2
NP_441004.1_3 Forward -296 -277 8.55425 0.202
NP_441004.1_9 Forward -295 -277 13.635 0.227
NP_442366.1_3 Reverse -149 -167 -0.472507 0.191
NP_442366.1_5 Reverse -312 -322 11.8776 0.156
NP_442366.1_5 Forward -144 -134 9.91099 0.298
NP_439949.1_7 Reverse -256 -270 9.83269 0.296
NP_442854.1_6 Forward -159 -140 4.62101 0.252
NP_442854.1_6 Forward -44 -25 1.76941 0.279
NP_443054.1_2 Forward -326 -312 12.7826 0.0722
NP_443054.1_2 Reverse -148 -162 3.34284 0.24
NP_443054.1_2 Forward -161 -147 3.04785 0.24
NP_440508.1_4 Reverse -122 -141 13.7658 0.229
NP_441851.1_10 Forward -160 -150 16.008 0.00552
NP_441851.1_10 Reverse -149 -159 15.8113 0.00552
NP_441851.1_10 Forward -325 -315 8.1415 0.122
NP_441851.1_10 Reverse -314 -324 6.66654 0.159
NP_441851.1_10 Reverse -127 -137 4.60159 0.259
NP_441542.1_4 Reverse -176 -190 10.7177 0.25
NP_441273.1_5 Reverse -271 -289 18.5045 0.286
NP_442515.1_1 Forward -160 -146 10.3243 0.0533
NP_442515.1_1 Reverse -314 -328 4.42448 0.107
NP_442515.1_1 Reverse -149 -163 4.03116 0.109
NP_441683.1_5 Reverse -155 -174 6.68596 0.28
NP_441540.1_5 Reverse -215 -233 14.768 0.237
NP_441982.1_6 Reverse -137 -146 10.671 0.295
NP_441046.1_2 Forward -292 -273 -0.000545616 0.275
NP_442689.1_8 Forward -362 -345 -4.09106 0.26
NP_440940.1_7 Reverse -305 -323 9.85146 0.154
NP_441349.1_10 Reverse -305 -324 -0.197208 0.0936
NP_441349.1_10 Reverse -140 -159 -7.17871 0.245
NP_441349.1_10 Forward -57 -38 -9.93197 0.3
NP_441409.1_6 Forward -165 -146 -5.99873 0.118
NP_441409.1_8 Reverse -349 -368 9.13744 0.241
NP_440432.1_9 Forward -158 -143 7.05973 0.0441
NP_440432.1_9 Forward -43 -28 -4.24833 0.202
NP_442843.1_1 Forward -62 -43 -11.1119 0.286
NP_442944.1_10 Reverse -98 -117 6.88262 0.269
NP_440474.1_8 Reverse -36 -50 7.47213 0.204
NP_440474.1_8 Reverse -151 -165 7.07881 0.21
NP_440396.1_2 Reverse -83 -101 16.2438 0.278
NP_440396.1_10 Forward -158 -142 12.5458 0.159
NP_442450.1_5 Forward -326 -316 17.0896 0.0321
NP_442450.1_5 Forward -161 -151 9.32148 0.115
NP_440588.1_2 Reverse -306 -325 5.70265 0.0625
NP_442006.1_2 Forward -132 -115 -16.1858 0.243
NP_442006.1_3 Forward -304 -286 -6.66736 0.298
NP_443047.1_7 Forward -43 -24 7.47261 0.22
NP_441570.1_1 Forward -44 -26 2.47742 0.0248
NP_441570.1_1 Forward -324 -306 -7.94566 0.0989
NP_441570.1_1 Forward -159 -141 -7.94566 0.0989
NP_441570.1_1 Reverse -315 -333 -16.3038 0.242
NP_441078.1_4 Forward -159 -150 19.6659 0.0007
NP_441078.1_4 Reverse -150 -159 19.6659 0.0007
NP_441078.1_4 Reverse -315 -324 10.1278 0.016
NP_441078.1_4 Forward -324 -315 9.83282 0.0226
NP_441078.1_4 Forward -44 -35 0.196389 0.205
NP_441078.1_4 Reverse -35 -44 -0.000272808 0.205
NP_442729.1_8 Forward -163 -150 9.45906 0.125
NP_441663.1_8 Reverse -20 -39 -2.85214 0.274
NP_440707.1_7 Forward -61 -42 4.03102 0.284
NP_442443.1_1 Forward -295 -276 -5.21209 0.282
NP_440526.1_3 Forward -158 -147 10.6779 0.0646
NP_440526.1_3 Reverse -151 -162 1.92649 0.267
NP_441432.1_5 Forward -269 -255 16.4209 0.271
NP_441432.1_8 Reverse -149 -158 16.8143 0.00595
NP_441432.1_8 Forward -160 -151 8.25953 0.0755
NP_441432.1_8 Forward -45 -36 5.50626 0.151
NP_441432.1_8 Reverse -314 -323 5.21127 0.185
NP_441432.1_9 Forward -367 -354 8.88924 0.284
NP_442320.1_8 Reverse -144 -158 4.52282 0.0482
NP_442320.1_8 Forward -165 -151 -2.55701 0.0913
NP_442320.1_8 Forward -330 -316 -2.75368 0.0966
NP_442320.1_8 Reverse -309 -323 -3.73699 0.131
NP_441732.1_2 Forward -163 -147 2.91013 0.0145
NP_441732.1_2 Reverse -31 -47 -16.2644 0.165
NP_441732.1_2 Reverse -193 -209 -16.6577 0.186
NP_440629.1_6 Reverse -144 -163 12.3102 0.289
NP_440629.1_6 Reverse -29 -48 12.3102 0.289
NP_442003.1_4 Reverse -299 -318 12.1925 0.272
NP_442815.1_3 Forward -296 -277 11.8975 0.227
NP_440760.1_1 Reverse -150 -169 -21.535 0.238
NP_440760.1_1 Forward -159 -140 -23.305 0.293
NP_440199.1_10 Forward -162 -152 14.533 0.0861
NP_441072.1_2 Forward -55 -36 14.4541 0.153
NP_442400.1_10 Reverse -346 -359 9.41998 0.271
NP_440713.1_4 Reverse -118 -137 4.52268 0.226
NP_442489.1_7 Forward -159 -150 20.1576 0.000695
NP_442489.1_7 Reverse -150 -159 20.1576 0.000695
NP_442489.1_7 Reverse -315 -324 10.4228 0.0151
NP_442489.1_7 Forward -324 -315 10.3245 0.0193
NP_442489.1_7 Forward -44 -35 0.688044 0.152
NP_442489.1_7 Reverse -35 -44 0.688044 0.152
NP_440565.1_7 Forward -199 -180 0.392778 0.249
NP_440559.1_1 Forward -158 -149 17.4043 0.00658
NP_440559.1_1 Reverse -151 -160 8.75118 0.0586
NP_440559.1_1 Reverse -316 -325 7.57121 0.106
NP_441659.2_8 Forward -159 -149 18.1713 0.00133
NP_441659.2_8 Reverse -150 -160 11.9764 0.0147
NP_441659.2_8 Reverse -315 -325 9.61647 0.0284
NP_441659.2_8 Forward -324 -314 2.14332 0.211
NP_441659.2_8 Forward -44 -34 1.84832 0.224
NP_441659.2_8 Forward -137 -127 0.865012 0.256
NP_442346.1_2 Reverse -24 -43 13.7658 0.216
NP_442346.1_5 Reverse -149 -159 16.6963 0.00248
NP_442346.1_5 Forward -325 -315 13.5497 0.0226
NP_442346.1_5 Forward -160 -150 9.02648 0.118
NP_442346.1_5 Reverse -314 -324 5.68323 0.234
NP_440545.1_3 Reverse -146 -163 11.3469 0.0266
NP_440545.1_3 Reverse -31 -48 -2.71443 0.191
NP_440545.1_3 Forward -195 -178 -3.20608 0.201
NP_441629.1_3 Reverse -193 -212 -1.18128 0.259
NP_440250.1_4 Forward -364 -345 4.71854 0.253
NP_440459.1_2 Forward -309 -292 9.38028 0.229
NP_440459.1_2 Forward -305 -288 9.18362 0.233
NP_441653.1_2 Reverse -139 -158 11.9368 0.105
NP_441653.1_2 Forward -55 -36 2.46664 0.291
NP_440010.1_4 Reverse -25 -44 -0.197979 0.25
NP_440010.1_4 Reverse -196 -215 -1.67294 0.267
NP_442603.1_7 Forward -159 -145 9.14375 0.155
NP_441888.1_7 Reverse -286 -300 6.48943 0.225
NP_441948.1_4 Forward -166 -148 7.29564 0.0623
NP_441833.1_4 Forward -158 -151 15.9687 0.0124
NP_441833.1_4 Reverse -151 -158 15.9687 0.0124
NP_441833.1_4 Reverse -36 -43 6.52896 0.0924
NP_441833.1_4 Forward -323 -316 6.3323 0.134
NP_441833.1_4 Reverse -316 -323 6.23397 0.163
NP_441833.1_4 Forward -43 -36 6.23397 0.163
NP_442162.1_9 Forward -158 -151 16.2637 0.0124
NP_442162.1_9 Reverse -151 -158 16.2637 0.0124
NP_442162.1_9 Forward -43 -36 12.9205 0.0282
NP_442162.1_9 Reverse -36 -43 12.9205 0.0282
NP_442162.1_9 Reverse -316 -323 6.52896 0.178
NP_442162.1_9 Forward -323 -316 6.43063 0.208
NP_440671.1_4 Forward -165 -151 7.86607 0.207
NP_442404.1_9 Reverse -38 -52 9.73373 0.263
NP_440772.1_8 Forward -306 -287 8.55425 0.259
NP_442140.1_3 Reverse -36 -46 15.418 0.0393
NP_442140.1_3 Forward -158 -148 13.5497 0.0542
NP_442140.1_3 Reverse -151 -161 8.33817 0.119
NP_442140.1_3 Forward -323 -313 6.37155 0.172
NP_442914.1_8 Reverse -139 -158 7.7676 0.237
NP_440875.1_9 Reverse -37 -47 15.2829 0.0295
NP_440875.1_9 Reverse -152 -162 8.37203 0.233
NP_441813.1_5 Forward -161 -151 17.188 0.00979
NP_441813.1_5 Reverse -148 -158 8.73149 0.0367
NP_441813.1_5 Forward -326 -316 6.27322 0.0971
NP_441813.1_5 Reverse -33 -43 5.5849 0.118
NP_441813.1_5 Forward -302 -292 0.275027 0.206
NP_441813.1_5 Forward -46 -36 0.275027 0.206
NP_441813.1_5 Reverse -313 -323 0.176696 0.215
NP_441813.1_5 Reverse -289 -299 -0.708283 0.272
NP_440590.1_4 Reverse -151 -164 5.32916 0.0585
NP_440590.1_4 Reverse -36 -49 4.54251 0.0601
NP_440590.1_4 Forward -158 -145 4.44418 0.0601
NP_440590.1_4 Reverse -292 -305 2.37923 0.0913
NP_440567.1_1 Reverse -316 -330 7.9644 0.0637
NP_440567.1_1 Forward -323 -309 7.07942 0.0779
NP_440567.1_1 Forward -158 -144 1.86788 0.191
NP_442497.1_10 Forward -158 -149 10.4228 0.0087
NP_442497.1_10 Reverse -151 -160 10.4228 0.0087
NP_442497.1_10 Reverse -316 -325 10.1278 0.0166
NP_442497.1_10 Forward -323 -314 0.589713 0.153
NP_442497.1_10 Reverse -36 -45 0.589713 0.153
NP_442497.1_10 Forward -43 -34 -1.18024 0.256
NP_440821.1_4 Forward -161 -151 19.0562 0.00399
NP_440821.1_4 Reverse -148 -158 17.9746 0.00497
NP_440821.1_4 Forward -326 -316 10.2065 0.0163
NP_440821.1_4 Forward -46 -36 9.02648 0.0364
NP_440821.1_4 Reverse -313 -323 0.471689 0.174
NP_441239.1_9 Reverse -33 -45 15.8703 0.0178
NP_441239.1_9 Forward -161 -149 13.3137 0.037
NP_441239.1_9 Reverse -148 -160 9.67541 0.0987
NP_441239.1_9 Reverse -313 -325 6.1355 0.2
NP_441239.1_9 Reverse -289 -301 5.93884 0.202
NP_441239.1_9 Forward -326 -314 4.66053 0.248
NP_440706.1_1 Reverse -146 -165 15.7324 0.0618
NP_441892.1_1 Reverse -26 -43 -4.58271 0.264
NP_442643.1_5 Forward -89 -70 -5.9004 0.293
NP_441874.1_1 Reverse -249 -263 10.3243 0.261
NP_440546.1_4 Forward -44 -34 15.6695 0.0459
NP_440546.1_4 Reverse -150 -160 11.8882 0.0679
NP_440546.1_4 Reverse -128 -138 11.5973 0.0774
NP_440546.1_4 Forward -159 -149 10.046 0.109
NP_440546.1_4 Reverse -1 -11 8.39772 0.192
NP_440546.1_4 Reverse -35 -45 6.55553 0.291
NP_440462.1_6 Reverse -33 -43 15.5163 0.0142
NP_440462.1_6 Forward -161 -151 15.418 0.0142
NP_440462.1_6 Reverse -148 -158 10.3048 0.0396
NP_440462.1_6 Forward -46 -36 8.4365 0.062
NP_442340.1_3 Reverse -184 -203 -11.2103 0.299
NP_440868.1_4 Reverse -146 -158 16.7552 0.0136
NP_440868.1_4 Forward -48 -36 16.7552 0.0136
NP_440868.1_4 Forward -163 -151 10.7571 0.0364
NP_440868.1_4 Reverse -31 -43 8.6921 0.0582
NP_440868.1_4 Reverse -304 -316 5.05386 0.107
NP_440868.1_4 Reverse -311 -323 -0.944332 0.284
NP_441868.1_4 Forward -331 -317 14.7492 0.282
NP_442402.1_4 Reverse -39 -58 -9.04772 0.285
NP_439948.1_2 Reverse -347 -365 15.5672 0.259
NP_441084.1_6 Reverse -334 -348 9.15021 0.292
NP_442039.1_4 Forward -158 -151 15.1821 0.0124
NP_442039.1_4 Reverse -151 -158 15.1821 0.0124
NP_442039.1_4 Forward -43 -36 11.6422 0.0747
NP_442039.1_7 Reverse -275 -285 7.55152 0.275
NP_441811.1_8 Forward -330 -316 7.57108 0.241
NP_440825.1_7 Forward -323 -313 12.3241 0.168
NP_442837.1_3 Forward -158 -151 15.7721 0.0124
NP_442837.1_3 Reverse -151 -158 15.7721 0.0124
NP_442837.1_3 Forward -323 -316 13.5105 0.0268
NP_442837.1_3 Reverse -316 -323 6.13563 0.25
NP_442837.1_3 Forward -43 -36 6.0373 0.25
NP_442837.1_3 Reverse -36 -43 6.0373 0.25
NP_442053.1_1 Forward -159 -150 18.3876 0.0007
NP_442053.1_1 Reverse -150 -159 18.3876 0.0007
NP_442053.1_1 Reverse -35 -44 14.4544 0.0114
NP_442053.1_1 Reverse -315 -324 8.75118 0.0728
NP_442053.1_1 Forward -324 -315 8.65285 0.0741
NP_442053.1_1 Forward -44 -35 7.86621 0.0863
NP_440505.1_3 Reverse -148 -158 16.598 0.00683
NP_440505.1_3 Forward -161 -151 13.8447 0.0247
NP_440505.1_3 Forward -46 -36 12.5664 0.0482
NP_440505.1_3 Reverse -126 -136 6.96153 0.169
NP_442532.1_7 Forward -44 -30 10.0294 0.171
NP_442532.1_7 Forward -159 -145 4.03116 0.178
NP_440914.1_1 Forward -159 -149 17.5935 0.000537
NP_440914.1_1 Forward -44 -34 10.8597 0.118
NP_440914.1_1 Reverse -150 -160 8.6151 0.186
NP_440914.1_1 Reverse -315 -325 6.66328 0.269
NP_441011.1_8 Reverse -151 -160 16.9127 0.00602
NP_441011.1_8 Forward -323 -314 14.1594 0.0269
NP_441011.1_8 Forward -43 -34 11.5045 0.0778
NP_441011.1_8 Forward -158 -149 8.25953 0.144
NP_441011.1_8 Reverse -36 -45 7.07956 0.179
NP_441011.1_8 Forward -114 -105 5.60459 0.247
NP_442533.1_6 Forward -159 -150 17.2076 0.00137
NP_442533.1_6 Reverse -150 -159 17.2076 0.00137
NP_442533.1_6 Reverse -315 -324 14.651 0.01
NP_442533.1_6 Forward -324 -315 7.37455 0.0898
NP_442533.1_6 Reverse -35 -44 4.42462 0.179
NP_442533.1_6 Forward -137 -128 4.12963 0.191
NP_442229.1_1 Reverse -148 -162 8.94708 0.184
NP_441482.1_7 Forward -330 -316 -1.96703 0.0913
NP_441482.1_7 Forward -165 -151 -9.04686 0.193
NP_441482.1_7 Reverse -144 -158 -10.4235 0.209
NP_439944.1_9 Forward -158 -148 19.1546 0.00329
NP_439944.1_9 Reverse -151 -161 10.3048 0.0887
NP_439944.1_9 Reverse -316 -326 7.74818 0.131
NP_442203.1_1 Reverse -345 -359 15.3858 0.228
NP_441028.1_6 Reverse -187 -197 3.71617 0.281
NP_440115.1_6 Reverse -147 -157 17.9746 0.0163
NP_440115.1_6 Forward -47 -37 9.61647 0.115
NP_440007.1_9 Forward -163 -149 0.786239 0.29
NP_439965.1_1 Forward -333 -314 -1.47551 0.166
NP_439965.1_1 Reverse -306 -325 -5.60541 0.211
NP_439965.1_1 Forward -168 -149 -10.4236 0.3
NP_442492.1_2 Forward -44 -25 0.392778 0.241
NP_442673.1_7 Forward -359 -340 18.3818 0.13
NP_442673.1_7 Reverse -166 -185 15.6125 0.159
NP_441972.1_5 Reverse -316 -335 -9.93197 0.294
NP_441106.1_1 Forward -160 -151 18.191 0.0028
NP_441106.1_1 Reverse -149 -158 9.63616 0.0311
NP_441106.1_1 Reverse -314 -323 8.45619 0.0548
NP_441106.1_1 Forward -45 -36 8.45619 0.0548
NP_441106.1_1 Forward -301 -292 5.70292 0.131
NP_001035870.1_3 Reverse -117 -136 -4.32711 0.278
NP_442306.1_10 Forward -164 -145 -19.6667 0.199
NP_442306.1_10 Reverse -30 -49 -20.2567 0.202
NP_441286.1_1 Reverse -149 -161 14.4936 0.00418
NP_441286.1_1 Forward -160 -148 12.1337 0.0104
NP_441286.1_1 Reverse -314 -326 4.66053 0.031
NP_441286.1_1 Forward -45 -33 -5.27089 0.194
NP_440670.1_8 Forward -159 -150 18.3876 0.000699
NP_440670.1_8 Reverse -150 -159 18.3876 0.000699
NP_440670.1_8 Reverse -315 -324 8.84951 0.0606
NP_440670.1_8 Forward -44 -35 8.75118 0.0606
NP_440670.1_8 Forward -324 -315 8.55452 0.066
NP_440670.1_8 Reverse -35 -44 6.19458 0.124
NP_440886.1_7 Forward -160 -150 17.7774 0.0011
NP_440886.1_7 Reverse -314 -324 17.1874 0.00477
NP_440886.1_7 Reverse -149 -159 7.94438 0.0805
NP_440886.1_7 Forward -45 -35 6.86274 0.113
NP_440886.1_7 Reverse -34 -44 6.76441 0.114
NP_440886.1_7 Forward -318 -308 3.71617 0.267
NP_440886.1_7 Reverse -44 -54 3.22451 0.291
NP_442614.1_2 Reverse -150 -164 7.17775 0.275
NP_442072.1_9 Forward -160 -142 -12.5672 0.0852
NP_442072.1_9 Forward -325 -307 -22.1053 0.22
NP_442072.1_9 Reverse -34 -52 -22.597 0.246
NP_442072.1_9 Reverse -149 -167 -23.3836 0.292
NP_441753.1_10 Reverse -26 -45 1.67108 0.257
NP_441753.1_10 Forward -305 -286 1.27776 0.272
NP_440907.2_8 Reverse -36 -46 15.7125 0.0168
NP_440907.2_8 Forward -158 -148 10.8943 0.0969
NP_440907.2_8 Reverse -151 -161 7.84605 0.117
NP_440907.2_8 Forward -323 -313 4.60114 0.257
NP_441021.1_1 Forward -158 -139 7.96426 0.0558
NP_441021.1_8 Reverse -145 -163 4.34571 0.223
NP_441463.1_3 Forward -334 -315 5.99764 0.0683
NP_441463.1_3 Reverse -140 -159 0.294447 0.132
NP_441463.1_6 Forward -161 -147 8.92841 0.25
NP_440501.1_6 Forward -319 -300 20.7464 0.113
NP_441626.1_2 Forward -158 -151 15.7721 0.0124
NP_441626.1_2 Reverse -151 -158 15.7721 0.0124
NP_441626.1_2 Forward -43 -36 12.2322 0.0511
NP_441626.1_2 Reverse -316 -323 6.0373 0.212
NP_441626.1_2 Forward -323 -316 5.93897 0.231
NP_441626.1_2 Reverse -36 -43 5.93897 0.231
NP_442211.1_3 Forward -306 -287 8.15285 0.275
NP_442365.1_7 Forward -163 -144 -1.08219 0.189
NP_441401.1_8 Forward -358 -339 23.0518 0.0174
NP_442615.1_1 Forward -168 -150 3.65739 0.0528
NP_442615.1_1 Forward -333 -315 -0.472507 0.116
NP_442615.1_1 Reverse -141 -159 -5.48739 0.215
NP_442615.1_1 Forward -53 -35 -7.15901 0.278
NP_441962.1_4 Reverse -145 -164 -5.9004 0.175
NP_441962.1_4 Forward -329 -310 -13.4719 0.273
NP_440387.1_1 Forward -159 -143 13.5299 0.00861
NP_440387.1_1 Forward -44 -28 -3.48138 0.16
NP_440387.1_1 Reverse -150 -166 -4.56302 0.19
NP_440387.1_1 Reverse -83 -99 -5.25134 0.222
NP_441431.1_2 Forward -47 -33 12.5853 0.114
NP_441431.1_2 Reverse -32 -46 9.6354 0.181
NP_441431.1_2 Forward -162 -148 5.70218 0.291
NP_441488.1_7 Reverse -253 -272 10.9142 0.113
NP_440634.1_7 Forward -134 -115 21.5339 0.0885
NP_441993.1_1 Reverse -240 -259 5.06532 0.208
NP_442224.1_1 Forward -139 -120 -5.11376 0.249
NP_441174.1_4 Reverse -257 -267 14.1397 0.267
NP_440114.1_10 Forward -44 -30 13.9626 0.0464
NP_440114.1_10 Reverse -150 -164 13.5693 0.0531
NP_440114.1_10 Forward -159 -145 7.57108 0.231
NP_440114.1_10 Reverse -128 -142 7.27608 0.239
NP_440114.1_10 Reverse -35 -49 6.98109 0.25
NP_441720.1_2 Forward -163 -144 9.63507 0.213
NP_440293.1_3 Reverse -121 -140 -0.885524 0.238
NP_440766.1_4 Reverse -146 -160 7.66941 0.0884
NP_440766.1_4 Forward -48 -34 2.45787 0.184
NP_440422.1_10 Forward -363 -344 5.85408 0.259
NP_441237.1_9 Forward -158 -148 14.9263 0.0242
NP_442743.1_4 Forward -323 -304 1.76941 0.174
NP_442103.1_1 Reverse -114 -128 12.3893 0.266
NP_442930.1_1 Forward -170 -160 10.206 0.278
NP_439910.1_2 Forward -167 -150 -3.99273 0.0691
NP_439910.1_2 Reverse -142 -159 -13.5308 0.162
NP_439910.1_2 Forward -52 -35 -21.594 0.183
NP_442867.1_8 Forward -135 -116 4.71934 0.277
NP_440457.1_1 Forward -328 -316 9.77374 0.092
NP_440457.1_1 Reverse -124 -136 4.75886 0.154
NP_440457.1_1 Forward -48 -36 2.49725 0.21
NP_440457.1_1 Reverse -146 -158 0.23564 0.25
NP_440457.1_1 Forward -163 -151 -0.0593532 0.25
NP_440798.1_6 Reverse -36 -49 11.1307 0.0665
NP_440798.1_6 Forward -158 -145 3.26421 0.151
NP_440798.1_6 Forward -306 -293 1.49425 0.212
NP_440798.1_6 Forward -43 -30 0.412608 0.267
NP_440473.1_9 Forward -55 -36 1.96607 0.0985
NP_440473.1_9 Reverse -24 -43 -6.68705 0.236
NP_442509.1_9 Reverse -150 -160 16.2041 0.00739
NP_442509.1_9 Forward -324 -314 16.1058 0.00871
NP_442509.1_9 Reverse -35 -45 9.71433 0.192
NP_442509.1_9 Reverse -315 -325 8.3377 0.192
NP_442509.1_9 Forward -159 -149 8.14104 0.192
NP_440554.1_4 Reverse -151 -161 14.6313 0.02
NP_440554.1_4 Reverse -36 -46 10.9931 0.0429
NP_440554.1_4 Forward -158 -148 6.37155 0.123
NP_440554.1_4 Forward -299 -289 5.09324 0.162
NP_441845.1_6 Reverse -303 -321 2.77242 0.245
NP_441885.1_5 Forward -159 -149 20.9245 0.000538
NP_441885.1_5 Reverse -150 -160 11.4848 0.00668
NP_441885.1_5 Reverse -315 -325 1.94665 0.0935
NP_441885.1_5 Forward -324 -314 1.65166 0.106
NP_441885.1_5 Forward -44 -34 -0.0199663 0.186
NP_442341.1_7 Reverse -149 -163 16.0275 0.0189
NP_442341.1_7 Forward -160 -146 10.226 0.0678
NP_442341.1_7 Reverse -314 -328 5.50613 0.154
NP_442341.1_9 Reverse -313 -327 5.40719 0.271
NP_442341.1_9 Forward -304 -290 5.01387 0.284
NP_442341.1_9 Forward -161 -147 4.52221 0.299
NP_441756.1_5 Reverse -287 -306 -4.42544 0.294
NP_441173.1_9 Forward -285 -277 13.2937 0.17
NP_443000.1_7 Reverse -148 -158 10.4031 0.0345
NP_443000.1_7 Forward -161 -151 8.73149 0.0437
NP_443000.1_7 Forward -326 -316 5.97822 0.125
NP_440507.2_1 Reverse -274 -293 17.8957 0.151
NP_440507.2_3 Reverse -141 -160 7.07848 0.29
NP_441842.1_1 Reverse -37 -50 12.2117 0.222
NP_441842.1_3 Forward -41 -23 15.8504 0.199
NP_440275.1_3 Reverse -148 -158 17.6796 0.0102
NP_440275.1_3 Forward -46 -36 15.418 0.0178
NP_440275.1_3 Forward -161 -151 8.4365 0.0602
NP_440091.1_1 Reverse -146 -158 15.8703 0.0161
NP_440091.1_1 Forward -163 -151 10.7571 0.0429
NP_440091.1_1 Reverse -311 -323 9.57708 0.0567
NP_440091.1_1 Forward -48 -36 8.00379 0.0714
NP_443060.1_5 Reverse -307 -326 6.58682 0.235
NP_443010.1_10 Forward -162 -145 12.1443 0.0935
NP_443010.1_10 Reverse -147 -164 7.40921 0.172
NP_443010.1_10 Forward -47 -30 5.57317 0.203
NP_442451.1_2 Forward -167 -148 -3.14714 0.191
NP_442495.1_3 Reverse -248 -266 11.8189 0.259
NP_440149.1_8 Forward -159 -140 -3.3438 0.187
NP_441105.1_3 Forward -170 -151 -7.67036 0.258
NP_440216.1_1 Reverse -150 -164 -1.47537 0.0328
NP_440216.1_1 Forward -159 -145 -1.5737 0.034
NP_440216.1_1 Forward -324 -310 -2.16369 0.0482
NP_440216.1_1 Reverse -315 -329 -3.147 0.0729
NP_440216.1_1 Reverse -35 -49 -5.40861 0.129
NP_440216.1_1 Forward -300 -286 -10.5218 0.145
NP_440216.1_1 Reverse -291 -305 -11.1118 0.163
NP_440172.1_1 Forward -159 -149 15.0247 0.00945
NP_440172.1_1 Reverse -315 -325 13.4514 0.021
NP_440172.1_1 Forward -44 -34 8.82982 0.0586
NP_440172.1_1 Reverse -150 -160 8.73149 0.0586
NP_440172.1_1 Forward -191 -181 4.10993 0.205
NP_442015.1_10 Reverse -287 -300 4.93583 0.156
NP_442015.1_10 Reverse -146 -159 2.87088 0.187
NP_442015.1_10 Forward -163 -150 0.805932 0.218
NP_442015.1_10 Reverse -311 -324 -0.964025 0.289
NP_442015.1_10 Forward -328 -315 -1.16069 0.297
NP_441226.1_7 Forward -158 -151 14.4934 0.0123
NP_441226.1_7 Reverse -151 -158 14.4934 0.0123
NP_441226.1_7 Forward -43 -36 12.7234 0.0312
NP_441226.1_7 Reverse -36 -43 11.5435 0.0757
NP_441226.1_7 Forward -136 -129 8.29857 0.205
NP_441111.1_7 Forward -158 -150 18.7023 0.00294
NP_441111.1_7 Reverse -151 -159 18.7023 0.00294
NP_441111.1_7 Reverse -316 -324 8.96754 0.0463
NP_441111.1_7 Forward -323 -315 8.86921 0.0589
NP_441111.1_7 Reverse -36 -44 8.86921 0.0589
NP_441111.1_7 Reverse -292 -300 -0.668896 0.274
NP_442379.1_10 Reverse -143 -160 -0.846137 0.223
NP_441766.1_2 Forward -159 -150 17.5026 0.00297
NP_441766.1_2 Reverse -150 -159 17.5026 0.00297
NP_441766.1_2 Reverse -35 -44 14.7494 0.00772
NP_441766.1_2 Reverse -315 -324 7.86621 0.0703
NP_441766.1_2 Forward -324 -315 7.66954 0.0723
NP_441766.1_2 Reverse -291 -300 2.94966 0.245
NP_440416.1_1 Forward -44 -25 -7.67036 0.218
NP_440416.1_9 Reverse -121 -140 0.392778 0.0527
NP_443052.1_8 Reverse -140 -159 -6.98204 0.151
NP_443052.1_8 Forward -54 -35 -7.67036 0.162
NP_443052.1_9 Reverse -293 -312 -3.93378 0.253
NP_440261.1_5 Forward -158 -145 -2.73398 0.0924
NP_440261.1_5 Reverse -151 -164 -2.93064 0.0983
NP_440261.1_5 Reverse -36 -49 -4.9956 0.183
NP_440988.1_2 Reverse -47 -65 13.8838 0.159
NP_440988.1_10 Forward -161 -147 10.1267 0.187
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATTTAGTACCGATGATTGATGTCTTGATGTCGGTATTAACCTTTTTTGTAATTTTAACCATGTCTTTGACTGGTAGGGTGATCGCCGATCTAGAGCCACCGGAGAGCGCAGGCGGTTTTGCCAAAGAAGAGGATTCATCCCCCCAAACAAAGGTCAAGGCACCTAGTTTAGATGTGGGTTTAAATCGTCAGGGTGACGTTTTGCTGGGAGGCAATATCGTCGAAAGGGATAAATTATTAACGGCGATCGCCACCTTTTTAGCGACCCATCCCCAGGGTGAGGTGAGGTTAACGGTGGACGGACAGTTAAACTATCGTCAAGTGGATGATTTATTAGTCCAAATGGTGGAAGTAGGCGGCGATCGGGTCCTTTTGGTGGTTCATAAATCAGACCCAGAGCT

CDS

ATGAAATTTAGACACCGACAAGACCGGGACAAATTGCCGGAACTAGAAATTACCCCCATGCTCAATGTGATGCTGGTCGTGTTGGCCTTTTTTGTCGCCGTTGCCGCCAACCTAGCGGAAGAGGGAGCATCTTTGCTGGTTCGTTTACCCCAGGAAGCTGAAACTACGGAGGTCCAATCCGCCGAAGCGCCATTAGAAAACCCGGAAGAGCCGCAATTTCTCCCAGTGGTGTTACACCCAGGGGGAAAACTCTCGGTAAATGATCGCCCTGTGGAAAAAGCTCAACTTCTACAGCAGTTACCTAACTATTTGCAACAGTCCCCCCAGCGCTACGTTTACCTGCGGGTGTCAGGGGACGTTCCCTATCAAAGTGCCATTGAAATTCTCTCTAGCTTGAAGGAAGTGGGCGGTGATCGGGTTTCCCTCTTAATTGGTGCTGGGGCCATGCCTTGA

Protein

MKFRHRQDRDKLPELEITPMLNVMLVVLAFFVAVAANLAEEGASLLVRLPQEAETTEVQSAEAPLENPEEPQFLPVVLHPGGKLSVNDRPVEKAQLLQQLPNYLQQSPQRYVYLRVSGDVPYQSAIEILSSLKEVGGDRVSLLIGAGAMP