Your browser is old and dusty. Try Google Chrome!

Details for sll0477

ORF sll0477
Accession NP_442520.1
Symbol
Category putative biopolymer transport ExbB-like protein
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440561.1_4 Reverse -248 -267 11.4598 0.288
NP_441818.1_9 Forward -322 -303 -8.94866 0.285
NP_441818.1_9 Forward -268 -249 -9.44032 0.291
NP_442744.1_8 Forward -310 -291 -4.42544 0.297
NP_441812.1_3 Forward -218 -204 12.0943 0.21
NP_442909.1_7 Reverse -245 -259 14.9452 0.117
NP_442861.1_4 Reverse -167 -186 20.9431 0.00914
NP_441934.1_10 Forward -148 -134 20.7474 0.0409
NP_441250.1_3 Forward -52 -33 5.11266 0.241
NP_440110.1_8 Forward -219 -200 0.392778 0.211
NP_441859.1_3 Reverse -207 -226 5.11187 0.206
NP_441859.1_3 Reverse -346 -365 4.03023 0.228
NP_440304.1_4 Forward -203 -193 5.28991 0.218
NP_440011.1_1 Forward -318 -299 13.0775 0.258
NP_440307.1_2 Reverse -284 -303 2.0644 0.262
NP_441594.1_6 Forward -262 -243 7.66927 0.17
NP_441925.1_4 Reverse -303 -322 -14.9476 0.263
NP_441083.1_5 Reverse -72 -82 2.92996 0.187
NP_442675.1_4 Reverse -348 -366 -3.71743 0.257
NP_441716.1_1 Forward -322 -308 9.14437 0.124
NP_441624.1_6 Forward -255 -236 13.5683 0.221
NP_441163.1_1 Reverse -243 -260 10.8545 0.203
NP_442634.1_2 Forward -306 -287 3.34271 0.278
NP_441014.1_10 Reverse -191 -210 -2.75457 0.287
NP_442848.1_9 Reverse -296 -315 -0.0988766 0.278
NP_441634.1_8 Forward -261 -247 -0.000409212 0.243
NP_440376.1_1 Reverse -295 -304 2.06468 0.236
NP_442485.1_3 Reverse -245 -264 14.1591 0.0981
NP_440642.1_5 Forward -213 -194 12.0942 0.103
NP_440571.1_5 Reverse -10 -29 13.9625 0.221
NP_442782.1_2 Forward -265 -251 -0.000409212 0.297
NP_442205.1_9 Forward -177 -161 -3.08806 0.278
NP_441127.1_1 Forward -259 -245 9.2427 0.278
NP_439990.1_5 Forward -222 -209 7.78743 0.186
NP_439990.1_8 Forward -150 -131 -2.16383 0.283
NP_441338.2_5 Forward -297 -278 6.78429 0.275
NP_442690.1_1 Reverse -165 -184 -9.14533 0.194
NP_441099.1_5 Reverse -303 -322 9.3409 0.0328
NP_442002.1_9 Forward -188 -181 11.3472 0.185
NP_442002.1_9 Forward -289 -282 11.1505 0.185
NP_440147.1_4 Forward -282 -269 0.707601 0.247
NP_441916.1_7 Forward -95 -85 1.55333 0.282
NP_440206.1_4 Reverse -345 -364 -1.18128 0.29
NP_440465.1_10 Reverse -247 -266 0.294447 0.29
NP_441041.1_4 Forward -265 -246 -10.9153 0.238
NP_442396.1_5 Forward -107 -94 5.23083 0.292
NP_442004.1_6 Reverse -250 -264 3.44117 0.24
NP_441725.1_5 Reverse -193 -203 7.05986 0.106
NP_441725.1_5 Reverse -251 -261 -0.806614 0.271
NP_440202.1_8 Forward -267 -248 9.61179 0.297
NP_440260.1_8 Reverse -292 -310 -4.79907 0.273
NP_441678.1_9 Forward -305 -286 0.0977854 0.225
NP_441087.1_6 Reverse -184 -202 -4.01314 0.296
NP_441556.1_4 Forward -277 -258 14.0542 0.176
NP_442215.1_1 Forward -158 -139 2.55606 0.293
NP_442215.1_2 Forward -385 -369 -6.23465 0.266
NP_442029.1_6 Forward -274 -255 3.73603 0.277
NP_442933.1_5 Reverse -236 -255 9.43923 0.288
NP_442970.1_3 Reverse -32 -50 13.6192 0.197
NP_442313.1_5 Reverse -251 -270 4.62101 0.271
NP_442142.1_4 Reverse -253 -266 7.00021 0.151
NP_442406.1_9 Reverse -294 -313 1.0811 0.274
NP_440730.1_4 Forward -304 -285 -5.50708 0.298
NP_440158.1_8 Reverse -257 -276 11.2092 0.249
NP_440183.1_9 Forward -302 -283 -14.0619 0.263
NP_442253.1_5 Forward -308 -291 -3.10775 0.286
NP_441826.1_5 Forward -268 -249 6.4893 0.222
NP_441251.1_7 Forward -193 -180 12.704 0.266
NP_442227.1_2 Reverse -297 -316 5.11266 0.202
NP_441114.1_3 Reverse -194 -203 7.57121 0.231
NP_440558.1_2 Forward -263 -244 -0.0988766 0.198
NP_440558.1_2 Reverse -247 -266 -6.29373 0.273
NP_440162.1_1 Reverse -23 -42 16.4469 0.285
NP_441518.1_3 Reverse -198 -217 -15.8318 0.299
NP_441878.1_6 Forward -305 -295 -6.21482 0.191
NP_441878.1_6 Forward -260 -250 -7.19813 0.21
NP_441878.1_6 Reverse -294 -304 -7.49312 0.231
NP_441878.1_6 Forward -202 -192 -7.49312 0.231
NP_441445.1_1 Forward -331 -312 1.47442 0.255
NP_441590.1_4 Reverse -252 -271 8.4551 0.249
NP_442267.1_5 Reverse -322 -341 19.2723 0.0281
NP_442962.1_1 Reverse -239 -258 6.98095 0.24
NP_442830.1_5 Reverse -289 -303 -1.37762 0.299
NP_442397.1_9 Reverse -139 -158 1.47442 0.283
NP_441549.1_9 Reverse -246 -264 -4.50408 0.198
NP_441549.1_9 Forward -309 -291 -4.8974 0.198
NP_442888.1_6 Reverse -319 -338 6.58763 0.217
NP_440151.1_2 Reverse -295 -313 16.1446 0.227
NP_442590.1_9 Reverse -286 -305 6.88262 0.252
NP_442998.1_5 Forward -290 -280 8.23984 0.267
NP_440299.1_1 Reverse -194 -207 3.36198 0.247
NP_441007.1_10 Forward -264 -251 -0.275709 0.273
NP_441559.1_8 Reverse -246 -260 -6.39192 0.277
NP_441559.1_8 Reverse -345 -359 -7.37523 0.291
NP_440915.1_6 Reverse -346 -360 -0.590395 0.202
NP_442158.1_4 Reverse -239 -249 16.893 0.129
NP_442866.1_4 Reverse -140 -159 9.24257 0.164
NP_441464.1_8 Reverse -248 -262 8.16106 0.2
NP_441494.1_6 Reverse -245 -258 6.4108 0.289
NP_442484.1_2 Reverse -260 -279 2.16274 0.226
NP_442240.1_1 Reverse -284 -303 6.88182 0.256
NP_440027.1_3 Forward -304 -286 4.93494 0.249
NP_439937.1_9 Forward -261 -244 -11.3682 0.251
NP_442239.1_8 Forward -323 -304 4.52268 0.296
NP_440770.1_3 Reverse -234 -248 17.7975 0.139
NP_440316.1_10 Forward -269 -259 6.56821 0.257
NP_440316.1_10 Forward -260 -250 6.46988 0.257
NP_442790.1_4 Reverse -130 -149 -15.8318 0.297
NP_440282.1_10 Reverse -255 -274 -10.0303 0.29
NP_440531.1_6 Reverse -287 -306 2.75272 0.151
NP_440189.1_10 Forward -77 -58 6.88262 0.242
NP_440487.1_1 Forward -377 -358 -7.57203 0.296
NP_440297.1_9 Reverse -193 -203 6.96153 0.161
NP_440297.1_9 Reverse -251 -261 0.176696 0.282
NP_440834.1_2 Reverse -287 -306 11.995 0.275
NP_440999.1_9 Reverse -255 -269 0.0979218 0.193
NP_440999.1_9 Reverse -246 -260 -3.04867 0.283
NP_440888.1_2 Reverse -302 -316 10.422 0.0946
NP_441268.1_1 Reverse -23 -42 13.5117 0.238
NP_441123.1_6 Reverse -184 -202 9.0656 0.279
NP_442710.1_7 Forward -27 -8 0.177711 0.193
NP_441469.1_8 Forward -260 -251 10.2261 0.227
NP_440710.1_1 Reverse -287 -305 12.6055 0.0425
NP_440148.1_1 Reverse -10 -29 4.52268 0.186
NP_440889.1_2 Forward -259 -240 12.7825 0.151
NP_442204.1_1 Forward -211 -200 3.89358 0.266
NP_440673.1_3 Reverse -194 -201 8.98723 0.203
NP_440592.1_2 Forward -292 -273 0.58944 0.271
NP_441004.1_1 Forward -207 -188 -16.2252 0.283
NP_441004.1_4 Forward -204 -194 10.1081 0.254
NP_442694.1_4 Forward -113 -104 11.7011 0.277
NP_443054.1_2 Reverse -69 -83 3.14618 0.24
NP_442208.1_5 Forward -303 -284 -6.09707 0.266
NP_442208.1_5 Forward -216 -197 -8.94866 0.287
NP_441501.1_9 Reverse -257 -276 15.4366 0.214
NP_440593.1_3 Reverse -304 -323 -3.83545 0.242
NP_442689.1_8 Reverse -169 -186 0.0388413 0.191
NP_440389.1_3 Forward -313 -294 12.2908 0.268
NP_439960.1_10 Reverse -264 -282 -4.30741 0.293
NP_440474.1_8 Reverse -209 -223 4.62054 0.271
NP_442450.1_5 Forward -324 -314 5.38824 0.245
NP_440588.1_2 Reverse -241 -260 -6.78538 0.292
NP_441570.1_1 Reverse -231 -249 -17.7788 0.291
NP_442348.1_2 Reverse -233 -242 9.53783 0.28
NP_442443.1_1 Forward -267 -248 -1.67217 0.24
NP_442815.1_2 Forward -258 -240 11.5239 0.144
NP_441057.1_3 Reverse -370 -389 -13.2752 0.277
NP_442727.1_10 Forward -44 -25 4.12936 0.189
NP_443011.1_4 Reverse -358 -377 11.1109 0.213
NP_440426.1_7 Reverse -76 -95 1.37609 0.241
NP_442346.1_5 Forward -202 -192 4.79825 0.272
NP_442346.1_10 Reverse -254 -273 -2.95047 0.294
NP_440545.1_3 Reverse -246 -263 -7.13932 0.298
NP_441856.1_3 Reverse -58 -77 -2.55715 0.267
NP_441629.1_3 Reverse -288 -307 -4.22953 0.29
NP_440486.1_6 Forward -311 -292 5.80098 0.289
NP_440010.1_10 Forward -308 -289 5.89931 0.226
NP_442027.1_1 Reverse -224 -242 16.1327 0.134
NP_442551.1_4 Reverse -248 -263 -1.5934 0.246
NP_441050.1_5 Reverse -136 -154 3.06741 0.207
NP_441047.1_2 Forward -279 -260 -3.63879 0.298
NP_442943.1_1 Forward -17 -2 5.68962 0.21
NP_440875.1_9 Reverse -352 -362 8.76138 0.233
NP_442089.1_6 Forward -124 -105 4.916 0.262
NP_441239.1_9 Reverse -248 -260 4.95553 0.234
NP_441951.1_4 Forward -303 -284 4.22769 0.273
NP_440400.1_1 Reverse -250 -269 1.17865 0.263
NP_441017.1_6 Forward -205 -191 13.7653 0.174
NP_442629.1_3 Forward -327 -308 0.491109 0.294
NP_442138.1_1 Forward -267 -248 3.04693 0.24
NP_442052.1_8 Forward -306 -296 13.353 0.253
NP_440675.1_10 Reverse -281 -300 15.5357 0.228
NP_440868.1_6 Reverse -275 -294 14.3558 0.257
NP_440812.1_2 Reverse -123 -142 8.94757 0.249
NP_442402.1_4 Forward -55 -36 -8.55607 0.283
NP_442402.1_4 Reverse -371 -390 -9.83437 0.293
NP_442402.1_9 Reverse -292 -311 10.5209 0.269
NP_440696.1_3 Reverse -285 -303 -1.55415 0.26
NP_442923.1_6 Forward -180 -166 10.8022 0.275
NP_441811.1_8 Forward -265 -251 8.06273 0.238
NP_440825.1_6 Forward -113 -94 13.9625 0.242
NP_442532.1_1 Forward -38 -24 9.23901 0.284
NP_440068.1_3 Reverse -344 -363 15.4374 0.154
NP_442533.1_6 Forward -259 -250 3.53964 0.21
NP_442533.1_6 Reverse -302 -311 1.96635 0.28
NP_442533.1_6 Reverse -291 -300 1.37636 0.3
NP_442541.1_10 Reverse -301 -315 10.717 0.186
NP_442541.1_10 Forward -304 -290 1.47397 0.286
NP_442322.1_4 Forward -157 -140 1.02145 0.21
NP_442229.1_9 Reverse -153 -172 19.0748 0.0901
NP_441028.1_6 Reverse -183 -193 3.51951 0.292
NP_441527.1_5 Forward -32 -13 11.6293 0.297
NP_441930.1_2 Forward -269 -259 11.7798 0.275
NP_439955.1_10 Forward -258 -239 11.6017 0.278
NP_442382.1_9 Reverse -174 -193 9.83173 0.281
NP_442213.1_5 Reverse -240 -259 7.27595 0.176
NP_441021.1_1 Reverse -193 -212 -10.9153 0.252
NP_442061.1_6 Forward -110 -100 16.598 0.232
NP_441796.1_8 Forward -275 -257 12.3105 0.199
NP_440855.1_1 Forward -280 -261 0.196116 0.244
NP_441488.1_7 Forward -309 -290 5.89931 0.155
NP_442084.1_2 Reverse -133 -152 15.6341 0.252
NP_442323.1_7 Reverse -187 -206 4.03023 0.224
NP_441510.2_2 Reverse -252 -271 3.73524 0.272
NP_440293.1_10 Forward -271 -252 0.0977854 0.23
NP_439988.1_3 Reverse -110 -124 4.52282 0.295
NP_441246.1_2 Forward -24 -5 5.211 0.195
NP_441246.1_7 Reverse -140 -159 1.17943 0.286
NP_440457.1_1 Forward -205 -193 4.26721 0.168
NP_440457.1_1 Forward -267 -255 -1.14099 0.294
NP_442297.1_3 Reverse -288 -307 10.3234 0.238
NP_442514.1_5 Reverse -288 -307 -4.62285 0.244
NP_441885.1_2 Forward -263 -244 11.0125 0.284
NP_440478.1_9 Forward -308 -289 11.3075 0.255
NP_442341.1_5 Forward -302 -283 20.2556 0.142
NP_442341.1_7 Reverse -293 -307 1.67122 0.282
NP_441756.1_5 Reverse -292 -311 2.85105 0.206
NP_441756.1_5 Reverse -287 -306 1.76941 0.215
NP_440507.2_3 Reverse -247 -266 10.2251 0.208
NP_440727.1_2 Forward -267 -248 -0.590531 0.288
NP_440679.1_10 Forward -272 -253 -12.3902 0.192
NP_440679.1_10 Forward -266 -247 -20.65 0.286
NP_442451.1_2 Forward -267 -248 -9.34199 0.259
NP_439962.1_4 Reverse -246 -265 -9.14533 0.299
NP_442495.1_5 Forward -315 -296 10.9142 0.23
NP_440216.1_1 Forward -304 -290 -10.8168 0.148
NP_440416.1_9 Reverse -284 -303 -14.6519 0.179
NP_440416.1_9 Reverse -249 -268 -17.4051 0.239
NP_440072.1_5 Forward -268 -250 7.4923 0.236
NP_442403.1_8 Forward -85 -66 0.58944 0.241
NP_442154.1_1 Forward -267 -249 -12.0756 0.217
NP_442564.1_10 Forward -297 -283 9.73436 0.296
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACTGGCCTCAATGAGGTTAACCTCGCCAAAAGCATCGTAGAGGGCATCATCGGTGTTGTAATGCCGTGAAGAATAGAGGTTGATCGTGCGGGACTGGGCAGAGGCCCGCCGGGGCAAATTAGCTACCACTAGGGCAGTGAGGGCGGTGCCGCCCACAAAAAAAGTCCGCCGGGAAATCTTAGTTGTCATCGAAGTCTAGGGCAATGGATAGTGGGCAATTTAAAATGAAAGTAATCAATAGTGCAGGCTCAACCCAGTCCCCTTAATCCGAACTAGGCCCCATGTCTGGGCTTGTTTGGCTAGTGATAGATAGCTTAATGGGCATCTGGAGTGGGTCAACCTCGGATAGTCAACTTTATTGCAAATAAAGTGCAATAATCCATAAATTATTGAAGCACTT

CDS

GTGCTGGATAATTGCAAGAGATTATTATTTAGAAAATTTCCCTGTTTTCTGTCCATGGCCCCATCCCCCCTGTTTTTGACTCAAACTCCGCGGCTACTCGATGAGTTTCTTAAGGGAGGGGTAGTGATGTTTCCTTTGTTACTGCTGTCCATCCTTGCCCTTACCACTGCCTTCGAACGAGGTTGGTTTTGGAGTCGCCTACTGATTCAAGAAGACCAGGTTGTGCGGGATGTGCTCGATGCGGCGGTTGAGGATTTGGTAAAGGCTCGGGAAATTGCTGAACATGCTCGACATTTAGCCATTGGTCGTTTTCTGCTGGCTCCCCTTAAACTACGCCATCCTAGTCCAGAAACTTTCCGTTTGGCCATGGAAGCCACCGCCGATAAAGAATTTGCCCGAATGCGACGGGGGGATAAACTCCTGGAAACTATCATTGCCCTAGCTCCTCTCTTGGGCTTGTTAGGCACCGTAACGGGCTTAATTCGCACTTTTAACAATCTCAATATCGGGGGAGGAGGCTCCAGTGCGGAGGCTACCCAGGCCGCCTCGGGCATTGGAGAAGCGTTGATTACCACGGCAGCGGGGATGATGGTGGCGATTTTTGCCCTGTTAGTATTTAGGGTTTTGGTCAGTTTACAGTCCCAACAAATGGATTATTTTGCCGCAGTGGGCAGTGAATTAGAACTTATTTACCGTGAGGTCTGGTACGAACCTCATCAGCCAATGCCCAATTTATTAATGGCGGCTAGAATTGCTGAGCCATAA

Protein

MLDNCKRLLFRKFPCFLSMAPSPLFLTQTPRLLDEFLKGGVVMFPLLLLSILALTTAFERGWFWSRLLIQEDQVVRDVLDAAVEDLVKAREIAEHARHLAIGRFLLAPLKLRHPSPETFRLAMEATADKEFARMRRGDKLLETIIALAPLLGLLGTVTGLIRTFNNLNIGGGGSSAEATQAASGIGEALITTAAGMMVAIFALLVFRVLVSLQSQQMDYFAAVGSELELIYREVWYEPHQPMPNLLMAARIAEP