Your browser is old and dusty. Try Google Chrome!

Details for sll0470

ORF sll0470
Accession NP_442533.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -163 -149 1.86788 0.181
NP_442100.1_1 Reverse -294 -313 7.97315 0.242
NP_441418.1_6 Forward -167 -148 -30.7781 0.296
NP_443043.1_6 Forward -364 -345 28.5154 0.00175
NP_441818.1_9 Forward -274 -255 -6.68705 0.264
NP_441098.1_3 Forward -245 -226 -1.04673 0.268
NP_440150.1_6 Reverse -260 -279 6.39097 0.229
NP_442744.1_8 Reverse -203 -222 -6.78538 0.297
NP_442655.1_10 Reverse -12 -31 -10.1286 0.22
NP_441859.1_3 Forward -168 -149 3.24359 0.246
NP_441859.1_5 Reverse -188 -207 2.3594 0.295
NP_441802.1_1 Forward -380 -361 16.2241 0.174
NP_440304.1_4 Reverse -33 -43 2.04498 0.299
NP_441935.1_1 Forward -227 -208 4.81767 0.293
NP_441208.1_9 Forward -258 -244 5.50613 0.267
NP_441594.1_6 Reverse -6 -25 -0.000545616 0.294
NP_442196.1_10 Reverse -201 -220 13.4708 0.201
NP_441925.1_4 Reverse -156 -175 -11.4077 0.252
NP_441434.1_7 Forward -106 -92 2.65453 0.273
NP_441738.1_2 Reverse -366 -373 8.1019 0.204
NP_441738.1_2 Forward -41 -34 6.72528 0.236
NP_440659.1_8 Forward -91 -72 11.3075 0.295
NP_442570.1_3 Reverse -201 -220 -7.37537 0.27
NP_439953.1_2 Forward -170 -152 16.1454 0.183
NP_441716.1_1 Forward -255 -241 4.12949 0.258
NP_440851.1_6 Forward -223 -206 0.530496 0.288
NP_440906.1_5 Forward -254 -247 5.64398 0.292
NP_440747.1_10 Reverse -275 -287 -12.5474 0.297
NP_442634.1_4 Forward -257 -243 2.45787 0.137
NP_440842.1_4 Reverse -226 -245 1.13476 0.248
NP_440057.1_9 Reverse -188 -207 15.8307 0.184
NP_441014.1_10 Forward -31 -12 -0.39464 0.25
NP_442848.1_5 Reverse -180 -198 -1.84914 0.276
NP_441634.1_9 Forward -277 -258 13.2733 0.191
NP_442687.1_7 Forward -256 -246 12.9597 0.0613
NP_442485.1_3 Forward -169 -150 -1.96717 0.261
NP_442485.1_3 Reverse -192 -211 -5.31042 0.289
NP_441846.1_10 Forward -273 -254 -22.0267 0.257
NP_441013.1_3 Forward -213 -194 15.3391 0.201
NP_441682.1_2 Reverse -264 -283 13.9625 0.1
NP_441950.1_8 Reverse -215 -229 4.22782 0.298
NP_440887.1_4 Forward -188 -169 15.2603 0.242
NP_442782.1_2 Forward -377 -363 9.04604 0.198
NP_442782.1_2 Forward -272 -258 2.94952 0.269
NP_442782.1_2 Forward -196 -182 1.47456 0.281
NP_442544.1_2 Forward -220 -206 -0.0987402 0.217
NP_440800.1_7 Reverse -182 -196 10.226 0.294
NP_442300.1_10 Forward -221 -202 12.2908 0.275
NP_442321.1_1 Reverse -201 -220 8.65258 0.0887
NP_439990.1_8 Reverse -292 -311 0.884433 0.283
NP_440369.1_8 Forward -209 -190 18.9705 0.0905
NP_443055.1_6 Forward -227 -209 3.55831 0.195
NP_443055.1_6 Reverse -202 -220 -1.35821 0.277
NP_440138.1_6 Forward -162 -143 1.96529 0.273
NP_442431.1_10 Forward -230 -212 1.19912 0.259
NP_442885.1_4 Forward -138 -125 14.5663 0.294
NP_441000.1_5 Forward -94 -75 5.89851 0.248
NP_442771.1_1 Reverse -244 -262 -0.865831 0.12
NP_441916.1_7 Reverse -158 -168 3.02829 0.232
NP_440289.1_2 Forward -290 -277 0.0192843 0.178
NP_440260.1_8 Forward -222 -204 6.01734 0.154
NP_441678.1_9 Forward -273 -254 4.916 0.191
NP_442281.1_1 Reverse -198 -212 2.94893 0.249
NP_441079.1_7 Reverse -305 -324 -0.984623 0.2
NP_441860.1_1 Reverse -61 -75 16.1311 0.276
NP_442982.1_5 Reverse -236 -255 -1.08219 0.263
NP_441751.2_8 Forward -286 -272 -5.70361 0.231
NP_442554.1_8 Reverse -204 -214 2.63497 0.265
NP_442167.1_6 Reverse -208 -224 11.6609 0.242
NP_442313.1_3 Reverse -67 -86 9.0459 0.224
NP_441024.1_7 Forward -40 -22 8.96649 0.292
NP_442408.2_1 Forward -43 -24 -1.7705 0.241
NP_440881.1_4 Forward -365 -346 -0.688862 0.265
NP_441448.1_1 Reverse -261 -280 8.06259 0.21
NP_440183.1_9 Forward -210 -191 -14.8485 0.271
NP_440183.1_9 Reverse -265 -284 -21.0434 0.296
NP_440183.1_9 Forward -285 -266 -21.1417 0.296
NP_440379.1_5 Forward -222 -203 -7.08038 0.24
NP_441015.1_10 Reverse -22 -41 -9.14533 0.28
NP_441330.1_1 Reverse -198 -217 -14.8485 0.248
NP_441056.1_1 Forward -30 -11 -1.7705 0.19
NP_442427.1_8 Reverse -52 -71 7.47261 0.214
NP_442808.1_1 Forward -288 -278 3.71617 0.227
NP_442808.1_1 Forward -355 -345 1.94622 0.281
NP_442808.1_1 Reverse -174 -184 1.84789 0.281
NP_441114.1_3 Reverse -293 -302 14.5527 0.193
NP_441114.1_3 Reverse -205 -214 7.66954 0.231
NP_440558.1_2 Reverse -151 -170 8.25926 0.113
NP_440558.1_2 Forward -222 -203 -6.58872 0.277
NP_440558.1_2 Reverse -288 -307 -7.08038 0.287
NP_441878.1_6 Forward -213 -203 0.57002 0.14
NP_441878.1_6 Forward -256 -246 -7.59145 0.245
NP_441878.1_6 Forward -134 -124 -7.98478 0.285
NP_441036.1_3 Reverse -34 -53 9.73422 0.114
NP_441433.1_8 Reverse -1 -20 -3.73712 0.283
NP_441308.1_8 Forward -229 -219 11.8781 0.22
NP_441458.1_10 Forward -39 -20 2.85105 0.261
NP_441564.1_10 Reverse -179 -198 7.47261 0.179
NP_441116.1_9 Reverse -14 -28 14.3559 0.229
NP_441574.1_1 Forward -167 -148 7.47261 0.11
NP_441063.1_8 Forward -387 -373 16.5082 0.257
NP_441597.1_6 Forward -43 -29 18.1016 0.252
NP_442594.1_8 Forward -303 -284 5.89931 0.236
NP_442590.1_9 Reverse -262 -281 6.88262 0.252
NP_440299.1_1 Reverse -171 -184 2.37867 0.291
NP_441799.1_1 Reverse -360 -374 7.86545 0.13
NP_442802.1_2 Reverse -200 -219 11.8967 0.298
NP_440256.1_1 Reverse -184 -203 -10.1286 0.295
NP_441229.1_10 Reverse -282 -301 -4.32711 0.288
NP_441559.1_8 Reverse -199 -213 -5.80194 0.27
NP_441559.1_8 Reverse -350 -364 -7.57189 0.295
NP_440915.1_6 Reverse -351 -365 -2.65535 0.278
NP_441296.1_9 Reverse -364 -377 11.0318 0.233
NP_442452.1_8 Reverse -9 -23 13.7653 0.273
NP_440748.1_5 Reverse -178 -197 1.0811 0.24
NP_441464.1_8 Reverse -216 -230 6.19444 0.243
NP_442150.1_8 Reverse -63 -82 19.6348 0.102
NP_440787.1_5 Reverse -186 -200 10.816 0.256
NP_441199.1_6 Reverse -242 -261 11.7992 0.0648
NP_442791.1_5 Forward -279 -260 -8.35868 0.279
NP_441676.1_9 Reverse -156 -173 11.3462 0.253
NP_442240.1_1 Forward -104 -85 7.76679 0.25
NP_440027.1_3 Reverse -203 -221 5.03327 0.249
NP_439937.1_8 Forward -169 -150 -2.36049 0.259
NP_439937.1_9 Reverse -153 -170 -11.9582 0.269
NP_439937.1_9 Forward -365 -348 -12.9415 0.278
NP_439937.1_9 Reverse -363 -380 -17.0714 0.291
NP_439937.1_9 Reverse -154 -171 -17.268 0.296
NP_441657.1_5 Reverse -199 -218 0.58944 0.205
NP_439943.1_7 Reverse -182 -201 1.96607 0.299
NP_441803.1_2 Reverse -211 -230 -1.08219 0.294
NP_442384.1_10 Reverse -263 -276 0.805932 0.278
NP_441980.1_6 Reverse -207 -225 19.4887 0.281
NP_440530.1_6 Forward -312 -298 16.9123 0.201
NP_442262.1_10 Reverse -22 -29 8.20058 0.25
NP_441689.1_5 Reverse -185 -195 4.89613 0.286
NP_440531.1_6 Reverse -255 -274 4.03102 0.133
NP_440531.1_6 Reverse -195 -214 -2.85214 0.258
NP_441060.1_3 Forward -275 -256 9.24257 0.226
NP_440189.1_2 Forward -380 -361 5.01433 0.268
NP_441640.1_8 Reverse -16 -35 -2.36049 0.229
NP_440297.1_9 Reverse -204 -214 -0.118297 0.282
NP_442280.1_10 Reverse -259 -277 6.91543 0.268
NP_442067.1_4 Reverse -252 -271 14.8474 0.0735
NP_440999.1_9 Reverse -154 -168 11.5043 0.0447
NP_440888.1_2 Forward -36 -22 5.21053 0.288
NP_440491.1_1 Forward -272 -253 7.69667 0.261
NP_442948.1_2 Forward -168 -149 5.30933 0.256
NP_441949.1_5 Forward -296 -277 14.247 0.182
NP_441469.1_8 Forward -213 -204 10.7178 0.202
NP_440257.1_3 Reverse -183 -197 20.9441 0.17
NP_442578.1_7 Forward -166 -159 9.97054 0.112
NP_442204.1_5 Forward -265 -246 4.42435 0.167
NP_440818.1_6 Forward -274 -255 14.5524 0.22
NP_440818.1_6 Reverse -255 -274 13.2741 0.228
NP_441443.1_10 Reverse -205 -223 1.19838 0.284
NP_442120.1_10 Forward -202 -183 -11.8986 0.265
NP_440992.1_5 Forward -357 -338 14.7126 0.272
NP_442219.1_8 Forward -282 -263 9.23007 0.234
NP_440592.1_8 Reverse -81 -100 12.7825 0.253
NP_440689.1_7 Reverse -215 -233 18.9962 0.134
NP_441086.1_3 Forward -250 -231 5.75208 0.289
NP_441004.1_1 Forward -261 -242 -9.73531 0.211
NP_441004.1_2 Forward -223 -204 4.81767 0.195
NP_442366.1_3 Reverse -33 -51 -1.65248 0.216
NP_442366.1_3 Forward -256 -238 -4.20908 0.266
NP_441851.1_10 Forward -213 -203 5.48657 0.211
NP_442208.1_5 Forward -227 -208 -2.95047 0.252
NP_442208.1_5 Forward -378 -359 -8.55534 0.277
NP_441668.1_4 Forward -387 -368 1.96607 0.207
NP_441683.1_7 Reverse -15 -34 -13.0786 0.3
NP_440396.1_1 Forward -287 -268 -5.40875 0.272
NP_440431.1_3 Reverse -174 -193 -4.6221 0.179
NP_442450.1_5 Reverse -124 -134 4.69992 0.297
NP_440588.1_2 Reverse -146 -165 -3.73712 0.195
NP_440588.1_2 Reverse -237 -256 -6.88371 0.294
NP_442006.1_2 Forward -272 -255 -16.0874 0.238
NP_442006.1_2 Reverse -210 -227 -16.2841 0.247
NP_442006.1_2 Reverse -6 -23 -17.2674 0.271
NP_441570.1_1 Forward -255 -237 -10.9939 0.184
NP_441078.1_4 Reverse -246 -255 -1.18024 0.237
NP_440539.1_9 Reverse -108 -127 6.4893 0.23
NP_440526.1_3 Forward -43 -32 0.746521 0.271
NP_441432.1_8 Reverse -245 -254 2.75299 0.287
NP_441732.1_2 Reverse -242 -258 -17.5427 0.27
NP_442797.1_7 Forward -221 -203 3.3624 0.234
NP_441040.1_2 Forward -52 -33 -8.55534 0.236
NP_442346.1_5 Forward -213 -203 5.87989 0.225
NP_440352.1_5 Reverse -23 -42 11.1957 0.267
NP_440545.1_3 Forward -259 -242 1.8088 0.112
NP_440545.1_3 Reverse -145 -162 -4.87771 0.235
NP_440459.1_2 Reverse -201 -218 15.8701 0.106
NP_442603.1_9 Reverse -196 -214 7.19731 0.279
NP_442603.1_9 Reverse -163 -181 -0.374176 0.3
NP_440946.1_6 Forward -230 -211 7.7676 0.294
NP_441895.1_10 Forward -307 -288 -18.5851 0.282
NP_441112.1_6 Reverse -193 -212 -4.32711 0.296
NP_440671.1_4 Reverse -15 -29 6.48943 0.245
NP_441044.1_4 Reverse -243 -261 0.609134 0.293
NP_440772.1_8 Reverse -188 -207 14.2574 0.253
NP_440772.1_8 Forward -293 -274 12.4875 0.253
NP_442021.1_3 Forward -202 -183 -7.37537 0.268
NP_442547.1_3 Forward -395 -376 18.879 0.0833
NP_442547.1_7 Reverse -200 -219 17.9119 0.141
NP_440590.1_4 Reverse -176 -189 -4.11062 0.258
NP_440590.1_4 Forward -277 -264 -5.78224 0.289
NP_441239.1_9 Reverse -201 -213 11.2487 0.0648
NP_441951.1_9 Forward -286 -267 -0.983855 0.283
NP_441892.1_1 Forward -221 -204 6.43035 0.0982
NP_441892.1_1 Reverse -194 -211 -2.3211 0.22
NP_440604.1_6 Forward -255 -236 -2.75381 0.225
NP_440604.1_6 Forward -377 -358 -3.3438 0.225
NP_440876.1_5 Forward -94 -75 8.75091 0.277
NP_442138.1_1 Forward -166 -147 1.57197 0.26
NP_442052.1_8 Forward -214 -204 12.5664 0.265
NP_440546.1_4 Reverse -203 -213 8.10685 0.203
NP_440546.1_7 Reverse -210 -220 16.4013 0.234
NP_440675.1_10 Reverse -264 -283 11.8975 0.256
NP_442340.1_3 Reverse -2 -21 -2.85214 0.205
NP_441848.1_4 Forward -324 -308 9.74698 0.275
NP_440653.1_10 Reverse -176 -195 3.93269 0.259
NP_442358.1_6 Reverse -22 -40 9.16393 0.223
NP_440160.1_2 Reverse -198 -217 -8.16202 0.286
NP_442360.1_5 Forward -218 -208 12.7631 0.298
NP_441252.1_6 Forward -380 -373 11.6422 0.288
NP_441252.1_6 Forward -199 -192 11.6422 0.288
NP_441203.1_1 Forward -224 -205 -12.9802 0.149
NP_441203.1_1 Forward -376 -357 -15.4385 0.229
NP_441408.2_7 Reverse -201 -220 -0.590531 0.234
NP_442533.1_1 Reverse -18 -37 -15.3402 0.254
NP_442533.1_6 Forward -212 -203 13.7661 0.0185
NP_442232.1_9 Forward -218 -199 16.2232 0.224
NP_443016.1_1 Reverse -285 -304 -5.31042 0.245
NP_441482.1_7 Reverse -240 -254 -3.63866 0.133
NP_441482.1_7 Reverse -181 -195 -11.8985 0.286
NP_441527.1_4 Reverse -93 -112 -8.35597 0.243
NP_440115.1_6 Reverse -275 -285 4.99491 0.277
NP_441972.1_5 Forward -277 -258 -6.98204 0.24
NP_441420.1_1 Reverse -277 -296 -4.91709 0.292
NP_441286.1_1 Reverse -277 -289 -6.15587 0.251
NP_441930.1_2 Reverse -154 -164 11.2881 0.298
NP_440028.1_6 Reverse -16 -34 13.5888 0.232
NP_442459.1_7 Forward -195 -176 -1.67217 0.298
NP_440387.1_1 Forward -167 -151 -5.93965 0.258
NP_441431.1_2 Reverse -200 -214 5.50552 0.298
NP_441488.1_8 Forward -35 -21 15.0436 0.146
NP_441993.1_1 Forward -218 -199 12.2772 0.101
NP_441174.1_2 Reverse -184 -198 12.9793 0.23
NP_441858.1_2 Forward -272 -253 8.86857 0.293
NP_441206.1_4 Forward -113 -94 -0.0988766 0.115
NP_440293.1_3 Forward -220 -201 -5.40875 0.276
NP_440293.1_3 Reverse -261 -280 -5.80207 0.282
NP_440293.1_3 Reverse -202 -221 -6.78538 0.293
NP_439988.1_3 Forward -223 -209 14.1593 0.185
NP_439988.1_3 Reverse -258 -272 3.73617 0.298
NP_440643.1_6 Reverse -199 -218 9.14423 0.138
NP_442867.1_8 Reverse -255 -274 14.7491 0.164
NP_442867.1_8 Reverse -256 -275 8.84924 0.23
NP_442867.1_8 Forward -226 -207 7.86593 0.242
NP_442680.1_5 Reverse -13 -32 3.00294 0.237
NP_440473.1_1 Reverse -200 -219 11.161 0.283
NP_440660.1_6 Reverse -202 -221 10.7175 0.282
NP_441159.1_9 Forward -106 -87 13.5691 0.126
NP_440554.1_4 Reverse -365 -375 1.74999 0.29
NP_440478.1_10 Reverse -261 -275 6.48943 0.291
NP_440552.1_8 Reverse -289 -306 9.60133 0.293
NP_441842.1_10 Forward -380 -366 10.226 0.167
NP_442354.1_8 Forward -97 -78 17.6007 0.22
NP_442275.1_1 Forward -281 -262 3.44104 0.284
NP_442275.1_1 Reverse -269 -288 3.34271 0.284
NP_441902.1_3 Forward -379 -369 12.6902 0.236
NP_443010.1_10 Forward -376 -359 3.15733 0.261
NP_441122.1_1 Reverse -287 -302 14.0412 0.126
NP_440149.1_8 Forward -196 -177 -7.57203 0.288
NP_441105.1_3 Reverse -176 -195 -7.76869 0.259
NP_440216.1_9 Reverse -389 -398 6.09625 0.289
NP_440216.1_9 Reverse -390 -399 5.70292 0.29
NP_440216.1_9 Reverse -200 -209 5.50626 0.292
NP_440172.1_1 Forward -196 -186 11.6814 0.0359
NP_441226.1_1 Reverse -201 -215 17.6002 0.211
NP_441226.1_7 Reverse -255 -262 5.64364 0.286
NP_440416.1_9 Forward -214 -195 -18.5851 0.26
NP_440416.1_9 Reverse -202 -221 -20.8467 0.289
NP_443052.1_9 Reverse -256 -275 -6.1954 0.279
NP_442116.1_6 Reverse -232 -249 7.50051 0.254
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCTTTCCGTGGCTAATTTAATTGGGGAAGCGATTTGGCGCATCCACGAGGAAAGCTCCGTCAGCAGTATGTTCCGCTAGGAATAACAATAATTTTTTGTGGACAATGGTAAAGCTGGATAGCCAGGCTGGCCAAAGCTGGGACGGGGTGATAGTCTTGGTTAAGTAATTTGAAGCTGATGCCGCCTTGGGCCATGCCTTGGTTCGGCAATTTCTTTGGCTATGCTAGTAGTTGGGCGGTCAATGCCGTCATCCAGTTACTATTTTCGGGCTCAGGCTTGTTTGCAAGCTTTGTTCTATGCCCGGTTCTGTTGCCTCAATTGCTAACTCTTGAGGATTTCTCAAATAGATTTCCACTAGACATTCCCCCTTTTCCATCTCAATTTCCTCGGAGGCCAAGCC

CDS

ATGTCTATGCCATCTATGCCTAAATTTTCCCAAGCTAAATTGTCCAAAAAACTACTCGCGCTTCTCTCCCTAAGTGGTGTTTTGGTGATGGGGTTGCCTGCCATTGGTTTTGCCCAAGGTAACTCTGGATTCACTATTTTTAGTGGGGTGGATAATCGTAGCGATATTCTGGATTACTACTTACAATTCAACGGTCGTTCTGGTCAAAGGGACCGCTATAAACTGTATATCCCCGCCAAGAAAATGACCCAGGGGGCGAAAGTTCTATACGTTTCCTACCCCGAAAATTTTGATGGCACTTTCGATGTAGATAAAGTCCGGGTTGAAACTAAACGCCAGGGAAACATTGAAATTGAAGATGTGGTTTGGGACAAAGAAAGTCGCTTTTTACAGATTGTTTTGGCAGAGCCAGCAGAACCCAACAGTCAGGTGACCATTACCCTTTCCAATGTTACTAACCCCAGCCTTGGAACTTATTACATGGTGGCCGATGCCATGGTATCCGGTGATATTCCCGTCCGAGTTTATTTAGGGACTTGGATTGTGAGTATTAACCGCTAG

Protein

MSMPSMPKFSQAKLSKKLLALLSLSGVLVMGLPAIGFAQGNSGFTIFSGVDNRSDILDYYLQFNGRSGQRDRYKLYIPAKKMTQGAKVLYVSYPENFDGTFDVDKVRVETKRQGNIEIEDVVWDKESRFLQIVLAEPAEPNSQVTITLSNVTNPSLGTYYMVADAMVSGDIPVRVYLGTWIVSINR