Your browser is old and dusty. Try Google Chrome!

Details for sll0451

ORF sll0451
Accession NP_442982.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -227 -241 7.57108 0.101
NP_441061.1_2 Reverse -323 -337 -2.45868 0.293
NP_440795.1_7 Forward -9 -2 14.6904 0.0123
NP_440795.1_7 Reverse -2 -9 14.6904 0.0123
NP_440795.1_7 Reverse -55 -62 11.1505 0.108
NP_441480.1_1 Forward -400 -381 4.42435 0.287
NP_440897.1_6 Reverse -226 -245 3.83357 0.142
NP_441453.1_4 Reverse -1 -9 16.539 0.00633
NP_441453.1_4 Forward -10 -2 16.539 0.00633
NP_441453.1_4 Reverse -226 -234 4.14932 0.264
NP_441960.1_3 Reverse -212 -231 18.1889 0.116
NP_442151.1_6 Reverse -226 -240 6.58777 0.228
NP_442151.1_6 Reverse -1 -15 5.89945 0.256
NP_441818.1_1 Reverse -2 -13 9.59626 0.232
NP_441818.1_9 Reverse -187 -206 -10.227 0.292
NP_440226.1_1 Reverse -1 -20 14.1591 0.0325
NP_442744.1_9 Forward -16 -2 14.3866 0.266
NP_442173.1_1 Forward -9 -1 15.4574 0.00633
NP_442173.1_1 Reverse -2 -10 15.4574 0.00633
NP_442752.1_4 Forward -10 -3 13.8055 0.0199
NP_442752.1_4 Reverse -1 -8 13.8055 0.0199
NP_442752.1_4 Reverse -100 -107 7.90559 0.144
NP_443027.1_4 Forward -12 -2 16.2046 0.0437
NP_442975.1_10 Reverse -50 -64 14.9452 0.0451
NP_440784.1_7 Forward -9 -2 15.9687 0.0123
NP_440784.1_7 Reverse -2 -9 15.9687 0.0123
NP_440061.1_9 Forward -237 -223 8.65209 0.167
NP_440110.1_8 Forward -345 -326 8.55425 0.0916
NP_441145.1_7 Forward -134 -115 7.37428 0.22
NP_442062.1_3 Reverse -117 -136 0.491109 0.239
NP_442062.1_8 Reverse -1 -11 10.3048 0.0493
NP_442062.1_8 Forward -235 -225 4.79825 0.198
NP_442062.1_8 Reverse -226 -236 4.60159 0.206
NP_441859.1_3 Forward -392 -373 4.52188 0.221
NP_440304.1_4 Forward -12 -2 19.9412 0.00364
NP_442242.1_4 Forward -9 -2 14.3954 0.0124
NP_442242.1_4 Reverse -2 -9 14.3954 0.0124
NP_440044.1_8 Reverse -2 -21 -1.67217 0.248
NP_441208.1_9 Forward -290 -276 5.99778 0.254
NP_440764.1_3 Reverse -93 -111 13.0972 0.277
NP_442742.1_9 Reverse -39 -58 -9.63698 0.269
NP_442742.1_9 Reverse -40 -59 -13.3736 0.274
NP_442110.1_7 Reverse -1 -15 1.96621 0.222
NP_441082.1_10 Reverse -182 -195 12.0157 0.236
NP_441925.1_4 Forward -202 -183 -17.6025 0.297
NP_441402.1_4 Reverse -362 -381 19.9606 0.0842
NP_441083.1_5 Reverse -1 -11 11.2881 0.0159
NP_441083.1_5 Forward -235 -225 1.06167 0.218
NP_441083.1_5 Reverse -226 -236 1.06167 0.218
NP_441738.1_2 Forward -8 -1 15.28 0.0102
NP_441738.1_2 Reverse -3 -10 15.28 0.0102
NP_441558.1_5 Reverse -347 -366 7.37428 0.182
NP_440209.1_1 Reverse -1 -9 18.1123 0.00295
NP_440209.1_1 Forward -10 -2 18.1123 0.00295
NP_441713.1_1 Forward -260 -241 -15.8318 0.273
NP_442570.1_3 Reverse -179 -198 -5.70374 0.248
NP_441716.1_1 Reverse -226 -240 3.24451 0.272
NP_440906.1_5 Forward -9 -2 15.8704 0.0124
NP_440906.1_5 Reverse -2 -9 15.8704 0.0124
NP_440747.1_10 Reverse -223 -235 7.31547 0.00577
NP_440747.1_10 Forward -13 -1 -1.92764 0.0192
NP_440747.1_10 Forward -238 -226 -11.8591 0.161
NP_442145.1_4 Reverse -19 -38 7.4002 0.214
NP_442330.1_4 Forward -170 -151 14.5557 0.286
NP_440470.1_5 Reverse -110 -129 7.87766 0.268
NP_441014.1_10 Reverse -225 -244 -0.591301 0.252
NP_442848.1_1 Forward -16 -2 6.6861 0.0791
NP_442848.1_4 Forward -264 -250 8.84938 0.282
NP_441012.1_4 Reverse -345 -358 5.42749 0.297
NP_443018.1_3 Forward -9 -2 14.8871 0.0123
NP_443018.1_3 Reverse -2 -9 14.8871 0.0123
NP_443018.1_3 Forward -234 -227 4.26735 0.267
NP_443018.1_3 Reverse -227 -234 4.16902 0.278
NP_440376.1_1 Forward -10 -1 19.4693 0.000692
NP_440376.1_1 Reverse -1 -10 19.4693 0.000692
NP_440376.1_1 Forward -235 -226 14.356 0.01
NP_440376.1_1 Reverse -226 -235 0.393051 0.279
NP_441588.1_4 Reverse -3 -13 6.66654 0.185
NP_442687.1_7 Forward -11 -1 9.02648 0.0994
NP_442687.1_7 Forward -255 -245 4.99491 0.225
NP_442687.1_7 Reverse -225 -235 4.79825 0.234
NP_442530.1_2 Reverse -23 -33 11.6814 0.282
NP_440533.1_6 Forward -111 -92 10.6192 0.274
NP_442658.1_1 Forward -12 -2 13.0576 0.04
NP_440141.1_3 Reverse -168 -187 7.37428 0.274
NP_440656.1_8 Forward -21 -2 1.67108 0.124
NP_440184.1_7 Reverse -113 -132 14.3693 0.28
NP_441958.1_5 Forward -11 -1 21.2195 0.000805
NP_440450.1_7 Forward -197 -183 20.0584 0.0346
NP_442685.1_2 Forward -131 -121 15.3197 0.206
NP_441097.1_2 Reverse -178 -195 19.5084 0.0607
NP_442690.1_1 Forward -46 -27 -13.3736 0.26
NP_442911.1_2 Forward -245 -226 -2.55715 0.0995
NP_440153.1_5 Reverse -2 -16 8.06273 0.149
NP_442236.1_7 Reverse -98 -117 15.3391 0.186
NP_440602.1_8 Reverse -1 -15 13.3726 0.174
NP_440138.1_6 Forward -240 -221 5.89851 0.227
NP_441099.1_5 Reverse -216 -235 -9.63698 0.229
NP_442002.1_1 Reverse -178 -196 -6.76569 0.249
NP_441654.1_7 Reverse -290 -309 11.6619 0.285
NP_441646.1_1 Forward -236 -217 1.27776 0.232
NP_442438.1_10 Reverse -329 -343 0.392915 0.229
NP_440377.1_1 Forward -79 -62 11.9501 0.27
NP_441674.1_10 Forward -400 -382 -0.865831 0.29
NP_440147.1_4 Reverse -387 -400 3.95252 0.175
NP_440147.1_4 Forward -226 -213 0.215946 0.261
NP_441550.1_8 Forward -12 -2 13.0576 0.0273
NP_441916.1_7 Reverse -1 -11 18.9579 0.00144
NP_441916.1_7 Forward -63 -53 4.10993 0.19
NP_441041.1_4 Forward -235 -216 -9.83364 0.223
NP_441041.1_7 Forward -13 -1 9.65268 0.108
NP_440174.1_8 Forward -307 -288 13.1758 0.271
NP_440569.1_10 Reverse -112 -131 5.96782 0.236
NP_442996.1_1 Reverse -26 -45 7.78217 0.21
NP_441547.1_2 Forward -246 -228 13.9821 0.0948
NP_441725.1_5 Reverse -2 -12 11.1898 0.0247
NP_441725.1_5 Reverse -227 -237 -0.708283 0.267
NP_439966.1_7 Forward -12 -2 14.8275 0.0177
NP_440736.1_3 Reverse -380 -399 9.14423 0.145
NP_442941.1_3 Reverse -2 -12 19.9412 0.00262
NP_442941.1_3 Reverse -227 -237 0.668351 0.19
NP_442941.1_3 Forward -234 -224 -0.0199663 0.244
NP_440983.1_5 Reverse -248 -267 5.50599 0.178
NP_440260.1_8 Reverse -334 -352 -6.07737 0.285
NP_442281.1_1 Forward -15 -1 17.8952 0.00513
NP_442281.1_1 Forward -201 -187 3.8339 0.217
NP_441566.1_3 Forward -103 -84 13.8641 0.229
NP_442575.1_8 Forward -185 -166 -0.590531 0.232
NP_001035871.2_2 Forward -28 -9 14.7669 0.296
NP_441860.1_1 Forward -118 -104 16.9068 0.276
NP_441556.1_10 Forward -293 -279 12.9472 0.189
NP_440498.1_1 Forward -19 -1 5.23069 0.109
NP_442982.1_1 Forward -387 -374 20.4715 0.264
NP_442982.1_2 Forward -51 -33 25.9785 0.0101
NP_442982.1_3 Forward -267 -248 21.9273 0.097
NP_442982.1_4 Forward -91 -72 21.6314 0.102
NP_442982.1_5 Forward -20 -1 21.8289 0.0449
NP_441644.1_6 Reverse -1 -11 19.0557 0.000803
NP_441644.1_6 Forward -235 -225 6.37109 0.161
NP_441644.1_6 Reverse -226 -236 6.17443 0.165
NP_441644.1_6 Reverse -215 -225 4.69947 0.228
NP_442215.1_2 Reverse -224 -240 -5.34967 0.249
NP_442215.1_2 Forward -400 -384 -7.0213 0.284
NP_442029.1_10 Forward -109 -90 11.7992 0.178
NP_440253.1_2 Reverse -1 -19 16.0471 0.0145
NP_440929.1_8 Forward -10 -1 19.2726 0.000701
NP_440929.1_8 Reverse -1 -10 19.2726 0.000701
NP_440929.1_8 Reverse -226 -235 6.68623 0.0887
NP_442933.1_6 Forward -136 -117 14.7531 0.284
NP_442933.1_10 Forward -10 -1 17.601 0.00325
NP_442933.1_10 Reverse -1 -10 17.601 0.00325
NP_442933.1_10 Forward -235 -226 5.01461 0.204
NP_441751.2_8 Reverse -2 -16 5.50613 0.0423
NP_441751.2_8 Forward -234 -220 -4.62196 0.176
NP_442554.1_8 Reverse -2 -12 16.9913 0.0065
NP_442554.1_8 Forward -234 -224 5.5849 0.145
NP_442554.1_8 Reverse -227 -237 5.38824 0.15
NP_442554.1_8 Reverse -216 -226 3.71661 0.215
NP_442142.1_4 Reverse -223 -236 4.24695 0.227
NP_442292.1_1 Reverse -2 -11 17.5026 0.00435
NP_442292.1_1 Reverse -227 -236 6.09625 0.116
NP_442292.1_1 Forward -234 -225 -0.786921 0.287
NP_441715.1_4 Reverse -2 -12 14.238 0.0295
NP_441198.1_8 Forward -12 -2 13.2713 0.108
NP_440379.1_5 Reverse -211 -230 9.93088 0.133
NP_441468.1_1 Forward -9 -2 15.8704 0.0124
NP_441468.1_1 Reverse -2 -9 15.8704 0.0124
NP_441468.1_1 Forward -234 -227 4.36568 0.237
NP_441673.1_1 Forward -10 -1 20.8459 0.000698
NP_441673.1_1 Reverse -1 -10 20.8459 0.000698
NP_441673.1_1 Forward -235 -226 1.57302 0.0764
NP_441673.1_1 Reverse -226 -235 1.57302 0.0764
NP_442253.1_5 Reverse -217 -234 -0.649475 0.227
NP_441826.1_2 Forward -16 -2 2.06454 0.136
NP_441764.1_8 Reverse -258 -268 13.4162 0.284
NP_442868.1_6 Reverse -224 -234 1.35667 0.205
NP_442868.1_6 Forward -12 -2 1.06167 0.205
NP_441251.1_7 Forward -220 -207 13.294 0.266
NP_441251.1_7 Reverse -74 -87 12.0157 0.268
NP_441251.1_8 Reverse -61 -74 10.6614 0.28
NP_442227.1_2 Reverse -319 -338 -3.73712 0.295
NP_442361.1_3 Reverse -48 -61 11.819 0.23
NP_442808.1_1 Forward -11 -1 8.73102 0.0481
NP_442808.1_1 Reverse -225 -235 4.7978 0.19
NP_442808.1_1 Forward -197 -187 4.10949 0.207
NP_442775.1_6 Forward -363 -344 11.5042 0.277
NP_440145.1_3 Forward -20 -1 18.0924 0.00908
NP_440145.1_3 Reverse -216 -235 -1.7705 0.156
NP_442050.1_5 Forward -12 -2 18.0724 0.00365
NP_440558.1_2 Reverse -217 -236 14.4541 0.0634
NP_440558.1_5 Forward -235 -221 16.8142 0.239
NP_441518.1_3 Forward -20 -1 -2.36049 0.113
NP_441878.1_6 Forward -11 -1 10.5014 0.0176
NP_441878.1_6 Forward -236 -226 2.43831 0.0379
NP_441878.1_6 Reverse -225 -235 -0.0199663 0.163
NP_441036.1_8 Forward -11 -1 15.713 0.00724
NP_441557.1_5 Forward -10 -1 19.9609 0.000699
NP_441557.1_5 Reverse -1 -10 19.9609 0.000699
NP_441557.1_5 Forward -235 -226 0.688044 0.128
NP_441557.1_5 Reverse -226 -235 0.688044 0.128
NP_441433.1_8 Forward -268 -249 5.99764 0.174
NP_441308.1_8 Forward -12 -2 13.353 0.218
NP_442183.1_1 Reverse -1 -15 18.5841 0.00743
NP_442183.1_1 Reverse -156 -170 5.80112 0.203
NP_442183.1_1 Reverse -360 -374 4.22782 0.271
NP_440440.1_5 Reverse -261 -280 9.3409 0.198
NP_442170.1_5 Reverse -1 -20 -3.04881 0.267
NP_442347.1_2 Forward -397 -388 5.99792 0.201
NP_442347.1_2 Reverse -2 -11 3.34298 0.284
NP_442645.1_2 Reverse -218 -237 -4.03212 0.0531
NP_440547.1_1 Reverse -209 -228 10.815 0.216
NP_442888.1_9 Reverse -48 -67 15.0441 0.199
NP_441037.1_4 Forward -12 -2 7.31769 0.237
NP_442508.1_8 Forward -64 -47 10.9536 0.264
NP_440151.1_5 Forward -303 -284 2.94938 0.29
NP_441633.1_3 Reverse -387 -400 -1.94734 0.168
NP_440136.1_2 Forward -9 -2 15.9687 0.0123
NP_440136.1_2 Reverse -2 -9 15.9687 0.0123
NP_442590.1_10 Forward -248 -229 5.30933 0.264
NP_442998.1_5 Forward -19 -9 7.84651 0.28
NP_442998.1_10 Forward -8 -1 15.5754 0.0102
NP_442998.1_10 Reverse -3 -10 15.5754 0.0102
NP_442998.1_10 Reverse -247 -254 10.4622 0.0819
NP_440899.1_8 Reverse -73 -92 -7.86702 0.246
NP_440299.1_1 Forward -67 -54 11.3267 0.0506
NP_440299.1_1 Reverse -222 -235 5.91857 0.158
NP_440299.1_1 Forward -239 -226 3.65697 0.237
NP_441799.1_1 Reverse -222 -236 5.21053 0.218
NP_441007.1_10 Forward -15 -2 2.47756 0.186
NP_441007.1_10 Forward -259 -246 -0.472371 0.285
NP_441435.1_5 Reverse -372 -391 6.98095 0.183
NP_440256.1_1 Reverse -223 -242 -10.227 0.297
NP_441559.1_8 Reverse -273 -287 14.3559 0.0574
NP_441559.1_8 Reverse -151 -165 13.0776 0.0574
NP_441559.1_8 Forward -240 -226 -6.68692 0.279
NP_442158.1_4 Forward -265 -255 11.1898 0.28
NP_441179.1_4 Reverse -338 -357 9.7334 0.225
NP_441866.1_4 Reverse -73 -86 16.7464 0.234
NP_441464.1_10 Reverse -185 -199 15.3392 0.166
NP_441464.1_10 Forward -265 -251 12.291 0.201
NP_441464.1_10 Forward -267 -253 7.47274 0.296
NP_440787.1_5 Forward -45 -31 15.2409 0.215
NP_440306.1_8 Reverse -32 -51 -0.591301 0.222
NP_441494.1_6 Forward -331 -318 9.06573 0.227
NP_441494.1_6 Forward -166 -153 6.80412 0.272
NP_442993.1_1 Reverse -1 -17 9.49831 0.0186
NP_442386.1_9 Reverse -225 -234 10.324 0.132
NP_442386.1_9 Forward -197 -188 6.58748 0.219
NP_442386.1_9 Forward -11 -2 6.39082 0.219
NP_442386.1_9 Forward -392 -383 6.19416 0.23
NP_440570.1_5 Forward -245 -226 2.26107 0.234
NP_441340.1_5 Forward -9 -2 15.6737 0.0124
NP_441340.1_5 Reverse -2 -9 15.6737 0.0124
NP_441340.1_5 Reverse -227 -234 4.07068 0.239
NP_440168.1_8 Reverse -214 -233 3.44104 0.244
NP_440327.1_6 Forward -275 -256 2.26107 0.298
NP_440327.1_6 Forward -274 -255 2.26107 0.298
NP_441248.1_10 Forward -46 -36 17.4139 0.189
NP_442714.1_7 Forward -214 -195 -2.45882 0.299
NP_441027.1_1 Reverse -79 -93 10.8154 0.277
NP_440586.1_8 Forward -9 -2 13.2151 0.026
NP_440586.1_8 Reverse -2 -9 13.2151 0.026
NP_440586.1_8 Reverse -227 -234 7.70858 0.227
NP_440586.1_8 Reverse -350 -357 5.8403 0.283
NP_442251.1_6 Forward -9 -2 15.2804 0.0124
NP_442251.1_6 Reverse -2 -9 15.2804 0.0124
NP_441262.1_3 Reverse -1 -8 14.7888 0.0223
NP_441262.1_3 Forward -10 -3 14.7888 0.0223
NP_443051.1_1 Forward -11 -2 19.5676 0.00335
NP_440372.1_2 Forward -9 -2 16.3621 0.0124
NP_440372.1_2 Reverse -2 -9 16.3621 0.0124
NP_440819.1_5 Forward -51 -43 7.59091 0.272
NP_439977.1_5 Reverse -220 -239 17.6007 0.0361
NP_440139.1_1 Reverse -174 -193 6.29183 0.143
NP_440267.1_2 Forward -15 -1 18.7801 0.0237
NP_442384.1_10 Forward -235 -222 9.55739 0.0523
NP_442384.1_10 Reverse -226 -239 4.54251 0.153
NP_442114.1_8 Forward -89 -75 3.44058 0.295
NP_441877.1_9 Forward -135 -118 2.00546 0.292
NP_442262.1_10 Forward -9 -2 14.1988 0.0123
NP_442262.1_10 Reverse -2 -9 14.1988 0.0123
NP_442262.1_10 Reverse -216 -223 8.49558 0.226
NP_441689.1_5 Forward -12 -2 17.8758 0.0158
NP_440562.1_3 Reverse -2 -19 5.74204 0.153
NP_442693.1_6 Forward -230 -211 0.491109 0.278
NP_442693.1_6 Forward -196 -177 -0.787193 0.297
NP_440297.1_9 Forward -357 -347 9.61647 0.0917
NP_440297.1_9 Reverse -2 -12 9.22315 0.0917
NP_440297.1_9 Reverse -227 -237 6.46988 0.185
NP_440297.1_9 Reverse -105 -115 0.275027 0.282
NP_441896.1_3 Forward -174 -155 -2.55715 0.284
NP_440888.1_2 Reverse -1 -15 13.5686 0.027
NP_440888.1_2 Reverse -226 -240 9.73373 0.116
NP_440888.1_2 Forward -287 -273 8.65209 0.152
NP_440792.1_5 Reverse -2 -21 5.99764 0.24
NP_441543.1_2 Reverse -2 -11 15.9293 0.00518
NP_441543.1_2 Reverse -227 -236 5.21127 0.209
NP_442845.1_2 Forward -235 -221 4.03116 0.271
NP_442845.1_2 Reverse -376 -390 3.93283 0.272
NP_441551.1_5 Reverse -211 -227 5.76105 0.297
NP_441469.1_8 Forward -11 -2 6.5879 0.227
NP_442315.1_2 Reverse -126 -138 8.29878 0.297
NP_443064.1_6 Reverse -389 -399 12.7608 0.0796
NP_443064.1_6 Forward -109 -99 10.9186 0.13
NP_443064.1_6 Reverse -1 -11 10.8217 0.13
NP_443064.1_6 Reverse -278 -288 9.17338 0.242
NP_442337.1_8 Forward -74 -55 -0.885524 0.278
NP_442578.1_7 Forward -9 -2 14.5921 0.026
NP_442578.1_7 Reverse -2 -9 14.5921 0.026
NP_440710.1_1 Forward -71 -53 -9.32229 0.297
NP_440710.1_2 Forward -75 -56 11.9958 0.237
NP_441462.1_2 Reverse -1 -11 20.2362 0.000805
NP_443062.1_1 Reverse -215 -233 6.30325 0.204
NP_443062.1_1 Reverse -349 -367 3.76806 0.285
NP_443062.1_1 Reverse -1 -19 3.37804 0.3
NP_442204.1_1 Forward -101 -90 4.18857 0.256
NP_442204.1_1 Forward -14 -3 0.157002 0.283
NP_440516.1_8 Forward -10 -1 16.9127 0.00442
NP_440516.1_8 Reverse -1 -10 16.9127 0.00442
NP_440516.1_8 Forward -224 -215 -0.68859 0.297
NP_442428.1_5 Forward -9 -2 15.8704 0.0124
NP_442428.1_5 Reverse -2 -9 15.8704 0.0124
NP_442428.1_5 Forward -234 -227 4.66067 0.244
NP_442120.1_10 Reverse -337 -356 -11.0136 0.262
NP_440603.1_9 Forward -234 -215 1.17943 0.278
NP_440673.1_3 Forward -8 -1 12.4288 0.0426
NP_440673.1_3 Reverse -3 -10 12.4288 0.0426
NP_440673.1_3 Forward -292 -285 5.44732 0.294
NP_441052.1_2 Reverse -1 -11 10.4031 0.0285
NP_441052.1_2 Reverse -226 -236 7.45319 0.0712
NP_441052.1_2 Forward -235 -225 7.25653 0.0765
NP_442219.1_9 Reverse -2 -11 8.25953 0.0681
NP_442219.1_9 Forward -234 -225 5.11294 0.186
NP_440436.1_4 Reverse -2 -11 9.24241 0.0871
NP_440436.1_4 Reverse -227 -236 4.81753 0.239
NP_442907.1_9 Reverse -227 -246 10.4225 0.102
NP_441719.1_4 Forward -9 -2 16.3621 0.0124
NP_441719.1_4 Reverse -2 -9 16.3621 0.0124
NP_441004.1_5 Reverse -56 -70 9.73436 0.248
NP_441437.1_1 Reverse -246 -265 8.65258 0.265
NP_439949.1_7 Forward -218 -204 11.996 0.273
NP_440864.1_3 Reverse -251 -270 14.0608 0.179
NP_441851.1_10 Forward -11 -1 8.53483 0.114
NP_441851.1_10 Forward -236 -226 4.79825 0.247
NP_442208.1_5 Forward -229 -210 -8.45701 0.275
NP_441542.1_4 Forward -156 -142 3.93283 0.264
NP_442515.1_1 Reverse -278 -292 -3.54032 0.292
NP_442515.1_8 Reverse -59 -77 16.3421 0.164
NP_440593.1_3 Reverse -215 -234 8.35759 0.109
NP_441982.1_6 Forward -52 -43 11.6259 0.288
NP_441982.1_6 Reverse -200 -209 11.3395 0.288
NP_442689.1_8 Reverse -113 -130 -4.48438 0.267
NP_441349.1_10 Forward -20 -1 3.34271 0.0676
NP_440432.1_9 Reverse -2 -17 5.97809 0.0486
NP_442843.1_8 Reverse -194 -213 12.0942 0.213
NP_440474.1_8 Reverse -2 -16 5.60385 0.246
NP_440431.1_3 Forward -58 -39 -9.14533 0.241
NP_442450.1_5 Forward -12 -2 9.41981 0.115
NP_442168.1_5 Reverse -216 -235 -1.47551 0.264
NP_440588.1_2 Forward -233 -214 -6.78538 0.292
NP_443047.1_7 Reverse -2 -21 5.80098 0.228
NP_442243.1_1 Reverse -220 -238 2.28001 0.204
NP_441570.1_1 Reverse -1 -19 0.314141 0.0395
NP_441570.1_1 Reverse -54 -72 -16.7954 0.254
NP_440078.1_10 Forward -287 -268 7.86593 0.216
NP_441078.1_4 Forward -10 -1 19.6659 0.0007
NP_441078.1_4 Reverse -1 -10 19.6659 0.0007
NP_441078.1_4 Forward -235 -226 7.86621 0.0432
NP_441078.1_4 Reverse -226 -235 0.884706 0.154
NP_442348.1_2 Forward -215 -206 16.0277 0.113
NP_442348.1_2 Reverse -110 -119 12.2911 0.218
NP_442348.1_2 Reverse -109 -118 7.47288 0.28
NP_440526.1_3 Reverse -2 -13 1.82816 0.267
NP_441432.1_8 Forward -11 -2 16.8143 0.00595
NP_441432.1_8 Forward -236 -227 11.3078 0.0569
NP_441432.1_9 Reverse -117 -130 14.4158 0.146
NP_441432.1_9 Reverse -20 -33 12.6706 0.199
NP_441432.1_9 Reverse -32 -45 11.4101 0.227
NP_442320.1_8 Forward -16 -2 3.8345 0.0578
NP_440199.1_10 Forward -13 -3 14.238 0.0861
NP_442353.1_4 Forward -241 -222 -0.886293 0.293
NP_442489.1_7 Forward -10 -1 20.1576 0.000695
NP_442489.1_7 Reverse -1 -10 20.1576 0.000695
NP_442489.1_7 Forward -235 -226 8.35786 0.0225
NP_442489.1_7 Reverse -226 -235 0.884706 0.145
NP_440559.1_1 Reverse -2 -11 8.65285 0.0586
NP_441659.2_8 Reverse -1 -11 20.9245 0.000805
NP_441659.2_8 Reverse -226 -236 6.76487 0.0678
NP_442749.1_5 Forward -89 -72 10.7303 0.186
NP_441022.1_1 Reverse -50 -59 10.587 0.294
NP_442346.1_5 Forward -11 -1 16.303 0.00248
NP_442346.1_5 Forward -236 -226 6.37155 0.205
NP_442346.1_5 Reverse -225 -235 6.17489 0.212
NP_442346.1_5 Reverse -348 -358 4.69992 0.276
NP_442603.1_7 Reverse -226 -240 7.76712 0.195
NP_442603.1_8 Reverse -140 -158 21.1603 0.0587
NP_442603.1_9 Reverse -213 -231 6.90232 0.279
NP_441585.1_9 Reverse -308 -327 20.3871 0.17
NP_441833.1_4 Forward -9 -2 15.9687 0.0124
NP_441833.1_4 Reverse -2 -9 15.9687 0.0124
NP_440912.1_3 Reverse -26 -45 8.75009 0.271
NP_441895.1_10 Forward -23 -4 -18.5851 0.282
NP_442162.1_9 Forward -9 -2 16.2637 0.0124
NP_442162.1_9 Reverse -2 -9 16.2637 0.0124
NP_440671.1_4 Forward -16 -2 13.7659 0.0748
NP_442943.1_1 Forward -128 -113 23.4906 0.0604
NP_442140.1_3 Reverse -350 -360 5.68323 0.198
NP_440875.1_9 Forward -389 -379 9.05339 0.233
NP_440875.1_9 Reverse -3 -13 7.59334 0.255
NP_441813.1_5 Forward -12 -2 15.9097 0.01
NP_440590.1_4 Forward -164 -151 -5.48725 0.28
NP_440567.1_1 Forward -234 -220 -0.393733 0.281
NP_442497.1_10 Reverse -2 -11 17.601 0.00813
NP_440821.1_4 Forward -12 -2 11.0914 0.0146
NP_440227.1_2 Reverse -38 -54 11.8583 0.271
NP_440227.1_6 Forward -130 -116 18.728 0.165
NP_441239.1_9 Reverse -218 -230 10.1671 0.0861
NP_441239.1_9 Forward -115 -103 8.9871 0.117
NP_441239.1_9 Reverse -213 -225 8.00379 0.145
NP_441892.1_1 Reverse -223 -240 3.48043 0.125
NP_440665.1_1 Forward -344 -325 -17.0118 0.297
NP_442669.1_1 Forward -132 -113 4.12936 0.14
NP_442643.1_3 Reverse -171 -190 -3.04881 0.261
NP_441017.1_6 Reverse -345 -359 12.2903 0.221
NP_442083.1_10 Reverse -205 -224 4.71934 0.2
NP_440833.1_6 Forward -81 -67 14.7486 0.146
NP_442138.1_10 Reverse -1 -20 0.196116 0.14
NP_440546.1_4 Reverse -1 -11 13.5365 0.0459
NP_440546.1_4 Forward -224 -214 8.78555 0.171
NP_440462.1_6 Forward -12 -2 16.893 0.00853
NP_440868.1_4 Forward -14 -2 5.93884 0.0879
NP_440401.1_9 Forward -192 -185 14.5917 0.287
NP_442499.1_3 Forward -236 -218 3.85406 0.289
NP_442479.1_9 Forward -80 -61 -9.83364 0.266
NP_440341.1_1 Reverse -187 -206 3.44104 0.292
NP_442402.1_4 Reverse -33 -52 1.57197 0.173
NP_442402.1_4 Reverse -34 -53 -6.29447 0.255
NP_442402.1_4 Forward -394 -375 -8.16275 0.278
NP_441848.1_4 Reverse -197 -213 8.50558 0.288
NP_439948.1_2 Forward -43 -25 16.1401 0.259
NP_441084.1_6 Reverse -380 -394 10.4106 0.241
NP_441084.1_6 Reverse -347 -361 10.3137 0.248
NP_440843.1_8 Forward -352 -333 12.1925 0.297
NP_442023.1_2 Reverse -252 -271 16.4207 0.106
NP_442039.1_4 Forward -9 -2 15.1821 0.0124
NP_442039.1_4 Reverse -2 -9 15.1821 0.0124
NP_442039.1_7 Forward -98 -88 8.33817 0.263
NP_441926.1_3 Reverse -1 -17 16.1848 0.0428
NP_441926.1_3 Forward -254 -238 3.50012 0.219
NP_440825.1_6 Forward -301 -282 7.96426 0.285
NP_442837.1_3 Forward -9 -2 15.7721 0.0124
NP_442837.1_3 Reverse -2 -9 15.7721 0.0124
NP_440160.1_2 Reverse -337 -356 -9.24366 0.293
NP_442053.1_1 Forward -10 -1 18.3876 0.0007
NP_442053.1_1 Reverse -1 -10 18.3876 0.0007
NP_442053.1_1 Forward -235 -226 5.3096 0.197
NP_440505.1_3 Forward -12 -2 15.123 0.014
NP_440505.1_3 Reverse -276 -286 8.53483 0.141
NP_442659.1_5 Forward -357 -338 19.764 0.139
NP_441701.1_3 Forward -239 -222 12.2319 0.207
NP_440207.2_2 Reverse -335 -354 17.8227 0.268
NP_440009.1_3 Reverse -172 -191 18.289 0.0475
NP_440914.1_1 Reverse -1 -11 16.3248 0.00196
NP_440914.1_1 Forward -235 -225 6.85846 0.263
NP_440914.1_1 Reverse -278 -288 6.66328 0.269
NP_441011.1_8 Reverse -2 -11 16.6177 0.00602
NP_442533.1_3 Reverse -41 -59 16.9006 0.186
NP_442533.1_6 Forward -10 -1 17.2076 0.00137
NP_442533.1_6 Reverse -1 -10 17.2076 0.00137
NP_442533.1_6 Reverse -226 -235 8.25953 0.0776
NP_442533.1_6 Forward -235 -226 6.8829 0.101
NP_442533.1_6 Forward -229 -220 3.83464 0.202
NP_442541.1_10 Forward -230 -216 2.65393 0.254
NP_440263.1_5 Reverse -74 -88 7.66941 0.294
NP_442322.1_4 Forward -199 -182 -5.76335 0.272
NP_440854.1_7 Reverse -32 -46 14.8115 0.246
NP_441482.1_7 Forward -16 -2 6.19444 0.0332
NP_441235.1_5 Forward -178 -159 16.0274 0.229
NP_439944.1_9 Reverse -2 -12 17.6796 0.00347
NP_439944.1_9 Forward -234 -224 5.5849 0.239
NP_439944.1_9 Reverse -55 -65 4.79825 0.296
NP_441697.1_5 Forward -139 -120 -9.97933 0.278
NP_441028.1_6 Reverse -86 -96 8.04271 0.217
NP_441028.1_6 Reverse -12 -22 4.30615 0.278
NP_440115.1_6 Forward -257 -247 6.46988 0.181
NP_439965.1_9 Forward -229 -210 7.07928 0.236
NP_441961.1_3 Reverse -218 -237 11.7008 0.253
NP_441602.1_3 Forward -234 -215 1.86774 0.206
NP_441602.1_3 Forward -351 -332 -3.14714 0.241
NP_441106.1_1 Forward -11 -2 18.486 0.0028
NP_441106.1_3 Forward -136 -117 10.4225 0.27
NP_442588.1_6 Forward -305 -286 8.45592 0.173
NP_441286.1_1 Reverse -225 -237 2.10393 0.0737
NP_441286.1_1 Forward -236 -224 -6.35254 0.26
NP_442674.1_1 Reverse -276 -295 10.2702 0.285
NP_440670.1_8 Forward -10 -1 18.3876 0.000699
NP_440670.1_8 Reverse -1 -10 18.3876 0.000699
NP_440886.1_7 Forward -11 -1 8.04271 0.0805
NP_442614.1_2 Forward -340 -326 6.88276 0.28
NP_441399.1_6 Forward -235 -216 12.7816 0.201
NP_442072.1_9 Forward -399 -381 -22.302 0.229
NP_440907.2_8 Reverse -2 -12 9.51767 0.103
NP_440907.2_9 Forward -82 -63 8.25844 0.125
NP_442264.1_5 Reverse -220 -234 11.7993 0.253
NP_442893.1_4 Reverse -69 -88 -1.67294 0.273
NP_441626.1_2 Forward -9 -2 15.7721 0.0124
NP_441626.1_2 Reverse -2 -9 15.7721 0.0124
NP_441626.1_2 Forward -62 -55 11.1505 0.0716
NP_442794.1_1 Forward -239 -227 4.75886 0.249
NP_442615.1_1 Forward -19 -1 -5.48739 0.215
NP_441962.1_4 Reverse -338 -357 -12.7836 0.265
NP_441962.1_4 Reverse -221 -240 -14.2585 0.285
NP_440387.1_1 Reverse -1 -17 7.2367 0.0282
NP_440387.1_1 Forward -254 -238 -4.1697 0.178
NP_440387.1_1 Reverse -226 -242 -4.95634 0.208
NP_441431.1_2 Reverse -379 -393 7.96378 0.23
NP_441431.1_2 Forward -199 -185 5.50552 0.298
NP_442020.1_1 Forward -128 -109 1.17865 0.255
NP_441836.1_2 Reverse -220 -239 -4.72043 0.262
NP_440114.1_10 Reverse -1 -15 19.0758 0.00367
NP_440114.1_10 Forward -391 -377 7.66941 0.229
NP_440114.1_10 Reverse -245 -259 7.27608 0.239
NP_440293.1_3 Forward -237 -218 3.93269 0.192
NP_440293.1_9 Forward -235 -221 10.7645 0.261
NP_440766.1_5 Forward -51 -39 10.7115 0.268
NP_440422.1_10 Reverse -111 -130 6.91902 0.24
NP_441246.1_10 Reverse -114 -132 10.6389 0.29
NP_442930.1_1 Forward -80 -70 10.4026 0.276
NP_439910.1_2 Forward -18 -1 -13.4325 0.162
NP_440457.1_1 Reverse -187 -199 1.80894 0.223
NP_440457.1_1 Forward -14 -2 0.137309 0.25
NP_440213.1_5 Reverse -344 -363 12.9791 0.196
NP_441801.1_4 Forward -116 -106 3.12662 0.231
NP_440801.1_8 Reverse -259 -278 2.65439 0.229
NP_442509.1_9 Reverse -1 -11 8.04271 0.192
NP_441489.1_3 Forward -53 -39 12.3301 0.198
NP_440554.1_4 Reverse -2 -12 16.1063 0.0189
NP_440554.1_4 Reverse -216 -226 2.04498 0.279
NP_441885.1_5 Reverse -1 -11 11.3864 0.00668
NP_441885.1_5 Reverse -226 -236 2.24165 0.0822
NP_441885.1_5 Forward -235 -225 1.65166 0.106
NP_442341.1_7 Reverse -225 -239 7.66941 0.0994
NP_442341.1_9 Forward -238 -224 5.80051 0.255
NP_441173.1_9 Reverse -44 -52 14.3753 0.161
NP_441173.1_9 Reverse -45 -53 10.2454 0.261
NP_442395.2_4 Reverse -214 -233 0.588665 0.264
NP_443000.1_7 Forward -12 -2 17.4829 0.00719
NP_443000.1_7 Forward -237 -227 4.79825 0.169
NP_443000.1_7 Reverse -224 -234 0.668351 0.293
NP_441842.1_1 Reverse -247 -260 11.3267 0.257
NP_440275.1_3 Forward -12 -2 9.12481 0.055
NP_440275.1_3 Forward -345 -335 6.27322 0.118
NP_440091.1_1 Forward -14 -2 8.9871 0.0567
NP_441307.1_4 Forward -300 -281 8.06259 0.177
NP_441902.1_3 Forward -52 -42 13.9535 0.226
NP_441902.1_3 Forward -96 -86 12.3986 0.253
NP_440804.1_4 Forward -46 -37 16.716 0.145
NP_441105.1_3 Reverse -371 -390 -6.29373 0.232
NP_442373.1_2 Reverse -180 -199 -9.53865 0.264
NP_440216.1_1 Reverse -1 -15 5.99778 0.0166
NP_440216.1_1 Forward -235 -221 -10.7185 0.146
NP_440172.1_1 Reverse -1 -11 17.5813 0.00421
NP_440172.1_1 Forward -235 -225 2.7333 0.268
NP_442015.1_10 Reverse -222 -235 -0.964025 0.289
NP_441226.1_7 Forward -9 -2 14.4934 0.0123
NP_441226.1_7 Reverse -2 -9 14.4934 0.0123
NP_441226.1_7 Reverse -227 -234 11.2485 0.0971
NP_441226.1_7 Forward -195 -188 5.34865 0.289
NP_441111.1_7 Forward -9 -1 18.7023 0.00294
NP_441111.1_7 Reverse -2 -10 18.7023 0.00294
NP_441111.1_7 Forward -234 -226 -0.570565 0.233
NP_441111.1_7 Reverse -227 -235 -0.570565 0.233
NP_441177.1_7 Forward -206 -187 11.7 0.2
NP_441766.1_2 Forward -10 -1 17.5026 0.00297
NP_441766.1_2 Reverse -1 -10 17.5026 0.00297
NP_440416.1_1 Reverse -1 -20 -3.14714 0.116
NP_440416.1_1 Forward -302 -283 -12.4886 0.272
NP_440416.1_9 Forward -231 -212 -9.73531 0.134
NP_443052.1_8 Forward -20 -1 -12.3902 0.254
NP_443052.1_9 Reverse -163 -182 -3.24547 0.247
NP_442116.1_6 Reverse -26 -43 5.68616 0.291
NP_442154.1_1 Forward -271 -253 -10.2073 0.202
NP_442154.1_1 Reverse -187 -205 -18.0738 0.276
NP_442154.1_1 Reverse -188 -206 -18.4671 0.282
NP_442046.1_2 Forward -44 -31 14.7662 0.276
NP_440261.1_5 Reverse -246 -259 -12.4687 0.297
NP_440988.1_2 Forward -109 -91 7.19731 0.299
NP_440988.1_10 Forward -237 -223 6.44783 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGGCTGATTCCCAATGGCTTCTATCAACTGATGCAATCCATTAACCATGGCACTTGGTACGCCCGCAGTGCGGAGGTAATTGGTTCCAGTTGGATGCAGGGCACTGTTTGGTTGCGGATTCCCGGCGACTTGATCTTTGCTGTGGGGGCAATAGTGTTACTCTATGGCGTTGGCCAGGCCATCTGGGGCATTTTTCAACAACCCACCCAACCCCAACCGTTGGATGAAGTACAGGTGGAAACGCCTGCGACTTAATTGCTCTCCAATCCTAAAAATTGTTTAAAAAGTCCCCTGGCTCACCAAGTTGGGGGACAATTAACTCAAAATTTCCCAGTATTGCGACAGCTTTTGGGAAAAAAATTAGGTTAATAATTGCCAATATGGAAAAAAGGCGATCGCC

CDS

GTGGAAATTAATTGGTCTTGGCAACGGTTTAATGATATTTCTGGGGAAGCAATGCACGAAATGCTTGCCCTACGGCAGGAAGTGTTTGTGGTAGAGCAGGGATGTTTATATCTAGACGCTGACGGGTTGGATAAACAATCATGGCACCTGTTTGGTCGCACCAATGATCAACAATTAGTGGCCTACGCACGACTGAATTTTCCCAATACCAGATACCCGGAACCATCTTTCGGTCGGGTGCTCACAAGTAAAGCAATAAGGGGAATGGGCGCTGGCAGGAAGATTGTCGCAGCCTGCATCCAGAAAAGCTTGCGGGAGTATCCAAACTTAGATCTGCAGATTTCAGCCCAGGCTCACCTTACCGAGTTTTATGCAGAATTTGGTTTTACAAAGGTTGGTGATCCCTATGATGACCACGGTATAGAACACATCAGTATGATTTTCCGTGTTCCGCCCAATGGGTGA

Protein

MEINWSWQRFNDISGEAMHEMLALRQEVFVVEQGCLYLDADGLDKQSWHLFGRTNDQQLVAYARLNFPNTRYPEPSFGRVLTSKAIRGMGAGRKIVAACIQKSLREYPNLDLQISAQAHLTEFYAEFGFTKVGDPYDDHGIEHISMIFRVPPNG