Your browser is old and dusty. Try Google Chrome!

Details for sll0447

ORF sll0447
Accession NP_442987.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442100.1_1 Reverse -356 -375 11.2199 0.187
NP_441418.1_3 Reverse -76 -95 9.69201 0.287
NP_442657.1_1 Reverse -279 -296 10.3653 0.271
NP_441453.1_8 Forward -398 -381 8.29864 0.25
NP_441098.1_3 Forward -93 -74 9.19359 0.204
NP_441098.1_3 Reverse -8 -27 0.197422 0.25
NP_441098.1_3 Reverse -320 -339 -3.91785 0.28
NP_441499.1_10 Forward -86 -67 18.584 0.143
NP_442972.1_1 Forward -372 -354 12.0951 0.254
NP_442972.1_1 Forward -299 -281 10.1729 0.265
NP_440304.1_4 Reverse -315 -325 2.7333 0.299
NP_441581.1_5 Reverse -316 -335 14.5416 0.288
NP_441716.1_2 Reverse -284 -303 3.92987 0.229
NP_441327.1_1 Forward -300 -281 8.44218 0.211
NP_441327.1_1 Reverse -280 -299 6.32778 0.25
NP_440438.2_8 Reverse -359 -378 8.84924 0.114
NP_441880.2_10 Forward -325 -307 10.1472 0.216
NP_440470.1_5 Reverse -280 -299 11.7928 0.169
NP_440470.1_5 Forward -301 -282 9.88299 0.207
NP_442848.1_1 Forward -202 -188 -4.22864 0.282
NP_441182.1_7 Forward -192 -179 18.6038 0.234
NP_441077.1_6 Forward -299 -283 1.8378 0.294
NP_442496.1_5 Forward -266 -248 5.91901 0.285
NP_442816.1_7 Reverse -276 -295 6.06331 0.242
NP_442690.1_1 Reverse -280 -299 -2.85214 0.142
NP_442690.1_1 Forward -302 -283 -10.4236 0.213
NP_442690.1_1 Forward -301 -282 -13.7669 0.265
NP_442690.1_1 Forward -375 -356 -14.2585 0.271
NP_442690.1_1 Reverse -39 -58 -15.7335 0.28
NP_440993.1_7 Forward -168 -154 19.492 0.131
NP_441646.1_1 Forward -209 -190 -1.18052 0.28
NP_440377.1_1 Forward -148 -131 11.8535 0.271
NP_442996.1_1 Reverse -282 -301 9.40553 0.21
NP_441514.1_4 Forward -301 -282 15.7065 0.214
NP_441079.1_7 Forward -299 -280 2.9486 0.173
NP_442933.1_1 Reverse -4 -23 18.7637 0.162
NP_442933.1_1 Forward -110 -91 8.45061 0.253
NP_442933.1_2 Reverse -71 -89 9.55118 0.257
NP_442933.1_6 Reverse -283 -302 13.5117 0.287
NP_440576.1_2 Forward -245 -226 7.57094 0.269
NP_442970.1_3 Reverse -282 -300 12.3956 0.241
NP_442142.1_4 Forward -199 -186 3.7553 0.246
NP_441448.1_1 Forward -159 -140 4.916 0.268
NP_441764.1_4 Forward -305 -288 15.8066 0.1
NP_441251.1_7 Forward -241 -228 11.819 0.27
NP_441911.1_7 Reverse -280 -299 -1.08295 0.0719
NP_441114.1_3 Reverse -195 -204 6.98123 0.254
NP_441116.1_9 Forward -236 -222 10.9143 0.295
NP_441819.1_5 Reverse -279 -298 10.1695 0.261
NP_442347.1_2 Reverse -188 -197 4.71961 0.266
NP_441728.2_4 Reverse -97 -116 13.8937 0.235
NP_442998.1_5 Forward -17 -7 8.33817 0.264
NP_442998.1_5 Forward -63 -53 7.55152 0.289
NP_440709.1_1 Reverse -284 -303 2.75194 0.219
NP_440243.1_1 Reverse -226 -245 15.708 0.203
NP_441132.1_8 Forward -265 -246 14.2574 0.107
NP_442959.1_5 Forward -247 -228 7.47261 0.231
NP_442239.1_5 Forward -108 -89 11.2293 0.259
NP_440372.1_3 Reverse -287 -301 16.5317 0.165
NP_441138.1_5 Forward -91 -78 3.02202 0.297
NP_440819.1_5 Reverse -306 -314 7.59091 0.272
NP_442917.1_1 Forward -306 -287 7.96345 0.254
NP_440350.1_5 Reverse -253 -272 -6.58872 0.296
NP_441896.1_3 Reverse -113 -132 -0.000545616 0.231
NP_440575.1_1 Reverse -326 -345 -0.197979 0.29
NP_442710.1_7 Forward -300 -281 -2.32114 0.238
NP_440998.1_10 Reverse -97 -116 8.75091 0.178
NP_440148.1_1 Forward -268 -249 -3.73712 0.219
NP_440936.1_10 Reverse -287 -306 -2.24448 0.241
NP_440255.1_4 Forward -293 -274 12.7478 0.271
NP_440104.1_8 Reverse -4 -18 17.4035 0.28
NP_440673.1_3 Reverse -195 -202 8.29892 0.221
NP_442206.1_1 Reverse -139 -158 -14.4552 0.27
NP_440728.1_1 Reverse -281 -300 9.83173 0.286
NP_441668.1_5 Reverse -306 -325 12.2908 0.225
NP_441683.1_7 Forward -356 -337 -8.94866 0.284
NP_441982.1_6 Reverse -305 -314 11.6259 0.288
NP_441982.1_6 Forward -19 -10 11.3395 0.288
NP_442689.1_8 Reverse -284 -301 3.48043 0.171
NP_442689.1_8 Forward -371 -354 -6.35267 0.281
NP_442689.1_8 Forward -298 -281 -6.451 0.285
NP_442689.1_8 Reverse -114 -131 -8.31929 0.294
NP_441031.1_1 Forward -298 -279 8.65445 0.233
NP_440040.1_8 Reverse -69 -88 7.49569 0.203
NP_440943.1_4 Forward -210 -198 14.297 0.297
NP_440199.1_4 Forward -298 -280 19.2914 0.156
NP_442346.1_5 Reverse -138 -148 4.50326 0.286
NP_440250.1_4 Reverse -40 -59 3.44025 0.268
NP_442828.1_9 Forward -24 -8 19.5826 0.289
NP_441329.1_6 Forward -28 -9 1.67069 0.232
NP_441895.1_10 Reverse -303 -322 -19.0768 0.282
NP_441239.1_9 Forward -150 -138 3.18557 0.292
NP_442270.1_9 Forward -207 -188 -10.522 0.259
NP_441541.1_1 Forward -28 -10 5.92249 0.16
NP_441541.1_1 Forward -377 -359 -0.952934 0.237
NP_441541.1_1 Forward -304 -286 -2.76728 0.264
NP_441541.1_1 Forward -294 -276 -4.29515 0.273
NP_441541.1_1 Reverse -90 -108 -4.67712 0.283
NP_440546.1_4 Reverse -139 -149 6.65249 0.288
NP_442465.1_2 Reverse -258 -277 11.0117 0.15
NP_439948.1_2 Forward -23 -5 17.7635 0.259
NP_442039.1_7 Reverse -303 -313 8.33817 0.263
NP_441959.1_8 Reverse -251 -264 9.76976 0.286
NP_442532.1_1 Reverse -285 -299 8.75312 0.294
NP_440914.1_1 Forward -202 -192 10.079 0.158
NP_440263.1_5 Forward -241 -227 7.27608 0.294
NP_441108.1_4 Forward -31 -12 13.7658 0.242
NP_439944.1_9 Reverse -159 -169 5.78156 0.221
NP_441697.1_5 Reverse -170 -189 6.63627 0.155
NP_441697.1_5 Reverse -281 -300 1.38421 0.178
NP_441697.1_5 Reverse -280 -299 -8.35597 0.258
NP_441697.1_5 Forward -381 -362 -8.92892 0.268
NP_441697.1_5 Reverse -316 -335 -9.02441 0.268
NP_440816.1_2 Reverse -305 -324 9.72659 0.218
NP_441028.1_6 Forward -314 -304 7.15773 0.23
NP_441527.1_4 Forward -23 -4 -10.3613 0.27
NP_440935.1_6 Reverse -245 -262 6.54559 0.267
NP_442698.1_10 Forward -348 -329 -0.000545616 0.297
NP_442324.1_7 Forward -278 -259 4.8946 0.288
NP_440987.1_6 Forward -374 -355 14.6487 0.199
NP_440798.1_1 Reverse -281 -299 16.7263 0.294
NP_442509.1_6 Forward -358 -339 25.6638 0.00447
NP_442703.1_9 Forward -268 -250 5.42735 0.244
NP_441173.1_9 Forward -313 -305 14.3753 0.161
NP_440191.1_6 Forward -293 -279 15.5768 0.294
NP_440804.1_7 Reverse -9 -26 13.2144 0.175
NP_442116.1_6 Reverse -282 -299 10.8427 0.215
NP_442116.1_6 Forward -299 -282 5.97264 0.289
NP_442226.1_3 Reverse -204 -223 19.1843 0.125
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACAATCAATGGTAAGGATTATGGATCTGAAGATTTATTACAAACTGATGATGAGTGGGAAGAAATAAATCAGTTTGAAATTGCGTCTTTTTCCCAATTAGAAAATTATATTAAAAATTTTAATCAGACAGTCAAAGAATTAGGAATAAATGAAGTTGATATATTGAGAAATTTTGATGGATCTGGACTTTATCAGTTGAGCAATGACGATCAAGTAATTTTGAAATCTCGTATTAAGAAAGCTTGTCTTCGGAAACATGGCCCAGTATCTGAATTTGAAGCAGAGCCAACTTTTTTAATCGTACTTAAATGTTTTATTGATTTAATTGCAGATAAGTGGTCTAAATCTTAAATATAATTGATAGTCTCATAGAATTTAAATTAGGTAAAAAATCAAACTC

CDS

ATGGAATTTTTTAAACTTATATCAGAACAGTCGTGGATATCAATCTCCATTACCGCTTCAATACTTGCCTTCATATTTTCAATGGTTAGTATTGCTATTAGTATTTTAAATAACAAAAAAATGCGTGGATTTTCATCAGACTTCAGAAAAGTCAAAAAAATCAGTGAAACCGTAGAAACACAAGGAAAAAAAATACTTTTGAATACTTCCGATATCAATCAAGTGCAACAACAACTAAATGTATTAAGTAATCAAATTCAAAAATATAAAGAAAAAAATATTACTTTACACACAAAGGTAGCCGACCTGAGCAGTCAGTTAAATTATTTAAATTCAGTCAATCGATACCACGACAATCGGCCAAAAAGCTTTAATGTAAATGAACTTCAAGTAGGGGAAATAGAGCAACAAAAAGAACAAATTGATCAAGTAAAAATTATTCTTGAGCAGTACGCACAACTAAATGTCGATTATTTCAATCATCCTAACTTTATTCCTGTTGAGCTAACAGAAGAATCTAAAGACAATAGACGAGCTATTGATGGGGAACCAATTATAGAGTTTAAGTCAATTTCAGATAAAGCCAATGCTATTTACCTTATTTTTCAATTCAATAATCAGTTCTACTTAATTCCCAATGCTACCATGCCGAAAATATCAAGATTAATTAAACTAAATAATGATAGTAGAATATTTGAAATGAATGCCGTATCAGATAGATTTGAACTCAAGTTTCCTGCTCATTTAGAGTTAATTAAAGAAAATCATTGGAAGCTAACTTCAAAAGGGAGTTTTGGCGACAAATAA

Protein

MEFFKLISEQSWISISITASILAFIFSMVSIAISILNNKKMRGFSSDFRKVKKISETVETQGKKILLNTSDINQVQQQLNVLSNQIQKYKEKNITLHTKVADLSSQLNYLNSVNRYHDNRPKSFNVNELQVGEIEQQKEQIDQVKIILEQYAQLNVDYFNHPNFIPVELTEESKDNRRAIDGEPIIEFKSISDKANAIYLIFQFNNQFYLIPNATMPKISRLIKLNNDSRIFEMNAVSDRFELKFPAHLELIKENHWKLTSKGSFGDK