Your browser is old and dusty. Try Google Chrome!

Details for sll0445

ORF sll0445
Accession NP_442989.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -256 -242 13.6676 0.166
NP_441061.1_2 Forward -85 -71 1.86788 0.181
NP_441061.1_2 Forward -92 -78 -0.492064 0.231
NP_440557.1_1 Forward -235 -216 0.687771 0.265
NP_440557.1_1 Forward -124 -105 -2.16383 0.284
NP_442291.1_7 Reverse -79 -93 13.6676 0.211
NP_440295.1_2 Forward -248 -229 5.70265 0.289
NP_440897.1_6 Reverse -83 -102 7.27514 0.0861
NP_442151.1_6 Forward -269 -255 5.01447 0.298
NP_441818.1_9 Reverse -75 -94 2.75272 0.184
NP_441818.1_9 Reverse -257 -276 -10.7186 0.298
NP_442744.1_8 Reverse -77 -96 3.53937 0.194
NP_442655.1_2 Reverse -143 -162 2.45773 0.265
NP_439997.1_6 Forward -255 -236 15.5357 0.177
NP_441225.1_10 Reverse -264 -278 19.9608 0.205
NP_440784.1_7 Forward -335 -328 4.26735 0.272
NP_440304.1_4 Reverse -225 -235 5.28991 0.218
NP_441781.1_7 Reverse -256 -275 -0.39387 0.257
NP_439918.1_2 Reverse -59 -78 7.47261 0.154
NP_439918.1_2 Forward -347 -328 3.34271 0.188
NP_439918.1_2 Reverse -65 -84 -2.85214 0.249
NP_441200.1_6 Forward -89 -72 15.6735 0.177
NP_441619.1_8 Reverse -71 -85 7.27547 0.286
NP_442110.1_7 Reverse -58 -72 9.83269 0.0708
NP_440300.1_1 Reverse -321 -340 9.63507 0.233
NP_441925.1_4 Forward -90 -71 -8.06442 0.203
NP_441925.1_4 Forward -294 -275 -16.6192 0.284
NP_440330.1_2 Reverse -274 -293 11.4058 0.291
NP_440856.1_7 Forward -224 -205 -8.45701 0.27
NP_441083.1_3 Forward -87 -77 12.5659 0.249
NP_441942.1_3 Forward -252 -233 18.0525 0.228
NP_442889.1_1 Reverse -257 -276 -12.7836 0.239
NP_440410.1_5 Reverse -111 -130 12.7825 0.251
NP_442570.1_3 Reverse -68 -87 -6.58872 0.258
NP_441025.1_5 Reverse -287 -301 14.7492 0.258
NP_442462.1_2 Reverse -278 -297 7.47261 0.206
NP_440747.1_1 Reverse -36 -54 6.50899 0.259
NP_441130.1_10 Reverse -43 -57 8.16106 0.14
NP_440944.1_2 Forward -31 -12 0.294447 0.256
NP_441667.1_1 Reverse -237 -252 14.1116 0.284
NP_442848.1_5 Forward -87 -69 10.7372 0.232
NP_442848.1_5 Reverse -279 -297 -1.65248 0.276
NP_441012.1_4 Forward -299 -286 7.49244 0.272
NP_441857.1_5 Forward -339 -321 6.31233 0.189
NP_442730.1_8 Forward -94 -75 3.9319 0.273
NP_442485.1_3 Forward -97 -78 -3.44213 0.274
NP_442485.1_3 Reverse -72 -91 -3.93378 0.277
NP_441846.1_10 Reverse -71 -90 -20.5517 0.256
NP_441950.1_7 Reverse -78 -97 -7.37537 0.278
NP_442658.1_1 Reverse -225 -235 9.02601 0.169
NP_442658.1_1 Reverse -325 -335 8.53436 0.189
NP_442198.1_3 Forward -242 -223 2.55606 0.299
NP_440141.1_8 Reverse -218 -237 13.7658 0.156
NP_442782.1_2 Reverse -77 -91 4.91614 0.25
NP_440318.1_1 Forward -242 -223 17.6007 0.0974
NP_440203.1_5 Reverse -38 -48 9.616 0.25
NP_441162.1_3 Reverse -214 -233 12.3892 0.195
NP_439990.1_8 Reverse -127 -146 -3.83545 0.294
NP_442911.1_2 Forward -346 -327 -10.7186 0.286
NP_442911.1_2 Forward -318 -299 -10.817 0.289
NP_440153.1_5 Forward -268 -254 9.14437 0.127
NP_442064.1_1 Forward -241 -222 -6.09707 0.22
NP_443055.1_6 Reverse -122 -140 -2.53818 0.296
NP_440993.1_4 Reverse -281 -298 1.90713 0.3
NP_443044.1_1 Reverse -361 -380 3.34271 0.288
NP_440411.1_10 Forward -238 -219 8.79781 0.293
NP_441646.1_1 Reverse -76 -95 5.30933 0.182
NP_441916.1_7 Forward -118 -108 1.06167 0.294
NP_441916.1_10 Reverse -225 -244 3.24438 0.236
NP_440206.1_4 Forward -282 -263 9.24175 0.191
NP_440206.1_4 Forward -90 -71 -0.689632 0.29
NP_442396.1_5 Forward -340 -327 6.70579 0.225
NP_442004.1_6 Forward -98 -84 2.35953 0.266
NP_440703.1_9 Forward -283 -270 9.5568 0.216
NP_441725.1_5 Forward -235 -225 7.05986 0.106
NP_439966.1_7 Reverse -325 -335 4.20782 0.285
NP_440289.1_2 Forward -89 -76 -3.12731 0.265
NP_440983.1_5 Forward -92 -73 -9.24366 0.3
NP_441678.1_9 Reverse -263 -282 -4.03212 0.288
NP_442281.1_1 Reverse -322 -336 3.53891 0.228
NP_442281.1_1 Forward -300 -286 1.96562 0.282
NP_440723.1_8 Forward -302 -288 10.0294 0.285
NP_443030.1_4 Reverse -220 -239 -0.787193 0.222
NP_443030.1_4 Reverse -250 -269 -6.1954 0.274
NP_441644.1_6 Reverse -45 -55 5.97777 0.172
NP_442215.1_2 Reverse -260 -276 3.69678 0.093
NP_442215.1_2 Forward -238 -222 3.00846 0.104
NP_442215.1_2 Forward -95 -79 -4.1697 0.228
NP_442029.1_6 Reverse -66 -85 9.63589 0.184
NP_442029.1_6 Reverse -65 -84 5.40766 0.25
NP_442029.1_6 Reverse -72 -91 3.34271 0.282
NP_441751.2_8 Forward -85 -71 -6.98191 0.294
NP_442554.1_8 Reverse -84 -94 2.24165 0.276
NP_442554.1_8 Reverse -110 -120 2.14332 0.281
NP_442142.1_4 Reverse -74 -87 3.36198 0.258
NP_442292.1_1 Reverse -110 -119 3.7363 0.192
NP_441525.1_1 Forward -96 -83 15.1623 0.21
NP_440895.1_10 Reverse -246 -263 -4.28772 0.215
NP_440279.1_2 Forward -247 -228 5.60432 0.269
NP_440379.1_5 Reverse -283 -302 -10.7186 0.283
NP_441015.1_8 Reverse -220 -239 4.12936 0.259
NP_441015.1_10 Forward -271 -252 1.37609 0.16
NP_441015.1_10 Reverse -72 -91 0.786102 0.165
NP_441876.1_9 Reverse -40 -50 10.1076 0.3
NP_441826.1_2 Forward -92 -78 3.93283 0.105
NP_441826.1_2 Forward -259 -245 -4.32697 0.295
NP_441637.1_5 Reverse -282 -301 15.8307 0.216
NP_442808.1_1 Forward -87 -77 4.7978 0.19
NP_442808.1_1 Reverse -242 -252 2.43787 0.266
NP_441101.1_10 Reverse -45 -64 0.491109 0.175
NP_440630.1_7 Forward -92 -73 -7.67036 0.287
NP_441114.1_3 Forward -282 -273 7.66954 0.231
NP_440558.1_2 Forward -89 -70 5.211 0.147
NP_440558.1_2 Forward -287 -268 -3.3438 0.234
NP_440558.1_2 Forward -239 -220 -6.1954 0.272
NP_442792.1_5 Reverse -270 -287 8.20031 0.296
NP_441878.1_6 Reverse -82 -92 1.65166 0.0795
NP_441878.1_6 Forward -87 -77 0.57002 0.14
NP_441878.1_6 Reverse -76 -86 -7.29646 0.217
NP_441878.1_6 Reverse -226 -236 -7.39479 0.222
NP_441590.1_4 Forward -91 -72 5.70185 0.27
NP_442066.2_4 Reverse -77 -96 -7.76869 0.286
NP_441433.1_8 Reverse -84 -103 1.86774 0.232
NP_441433.1_8 Reverse -222 -241 -4.32711 0.294
NP_442494.1_7 Reverse -79 -98 0.687771 0.246
NP_442347.1_2 Reverse -328 -337 3.83464 0.284
NP_442645.1_2 Forward -133 -114 -21.4367 0.29
NP_442645.1_2 Reverse -107 -126 -22.0267 0.29
NP_440136.1_2 Forward -335 -328 4.26735 0.218
NP_442998.1_5 Reverse -232 -242 8.82982 0.261
NP_442998.1_5 Forward -390 -380 7.74818 0.284
NP_440299.1_1 Forward -90 -77 6.50855 0.139
NP_442333.2_5 Reverse -216 -235 -6.68705 0.227
NP_442333.2_5 Forward -288 -269 -13.3736 0.255
NP_440456.1_7 Reverse -357 -371 9.63603 0.294
NP_442283.1_2 Forward -271 -252 23.1072 0.0122
NP_442069.1_6 Forward -289 -270 6.78429 0.224
NP_442069.1_8 Reverse -309 -328 4.916 0.262
NP_442866.1_1 Reverse -281 -300 -7.57203 0.266
NP_442993.1_1 Forward -336 -320 -9.67623 0.19
NP_440677.1_6 Reverse -217 -236 8.55425 0.276
NP_441952.1_9 Reverse -223 -242 13.7941 0.282
NP_440327.1_6 Reverse -60 -79 2.94938 0.285
NP_440027.1_3 Reverse -244 -262 2.96833 0.282
NP_440027.1_8 Forward -95 -76 4.52188 0.287
NP_440027.1_8 Forward -83 -64 4.32522 0.291
NP_439937.1_4 Reverse -77 -96 8.84924 0.278
NP_439937.1_9 Forward -85 -68 -17.0714 0.291
NP_440398.1_6 Forward -306 -287 6.19431 0.275
NP_440408.1_7 Forward -296 -277 10.9142 0.239
NP_440408.1_7 Reverse -77 -96 7.7676 0.284
NP_442239.1_8 Reverse -77 -96 6.98095 0.263
NP_441789.1_7 Forward -300 -281 5.30853 0.193
NP_441293.1_3 Reverse -98 -116 12.034 0.291
NP_440316.1_10 Reverse -82 -92 7.35486 0.251
NP_441803.1_2 Forward -91 -72 1.57275 0.229
NP_439977.1_5 Reverse -256 -275 1.86774 0.184
NP_441245.1_3 Reverse -191 -210 8.84924 0.274
NP_442384.1_10 Reverse -122 -135 1.00259 0.271
NP_441877.1_7 Reverse -239 -258 -0.39464 0.284
NP_441018.1_7 Forward -240 -221 14.3558 0.119
NP_441018.1_7 Forward -135 -116 9.73422 0.218
NP_441018.1_7 Reverse -67 -86 8.55425 0.242
NP_440282.1_10 Forward -96 -77 -2.55715 0.232
NP_440297.1_8 Forward -291 -273 10.2456 0.293
NP_440297.1_9 Forward -235 -225 6.96153 0.161
NP_440297.1_9 Forward -307 -297 4.89658 0.217
NP_440297.1_9 Forward -91 -81 -0.216628 0.282
NP_443036.1_1 Forward -303 -284 12.585 0.224
NP_440999.1_9 Forward -164 -150 1.17956 0.169
NP_440999.1_9 Reverse -6 -20 -2.75368 0.276
NP_441551.1_5 Reverse -265 -281 8.90762 0.225
NP_442337.1_8 Forward -103 -84 8.06259 0.191
NP_442337.1_8 Forward -319 -300 -2.0655 0.293
NP_440071.1_1 Reverse -196 -213 10.0679 0.259
NP_441560.1_10 Forward -298 -279 5.70265 0.292
NP_441351.1_8 Reverse -158 -177 0.491109 0.288
NP_440516.1_6 Forward -235 -221 11.1104 0.217
NP_440516.1_6 Forward -359 -345 6.58715 0.293
NP_442120.1_10 Reverse -71 -90 -7.4737 0.222
NP_442823.1_8 Reverse -281 -300 11.0125 0.296
NP_441867.1_5 Reverse -138 -157 14.1591 0.0548
NP_440992.1_2 Reverse -281 -300 11.8975 0.245
NP_442219.1_8 Forward -179 -160 9.9065 0.219
NP_440436.1_4 Forward -235 -226 6.48915 0.157
NP_441884.1_9 Forward -63 -44 -21.7317 0.261
NP_441004.1_1 Reverse -71 -90 -7.4737 0.198
NP_441004.1_1 Reverse -65 -84 -14.9469 0.271
NP_441004.1_1 Forward -178 -159 -17.7001 0.294
NP_441004.1_2 Forward -55 -36 1.76941 0.217
NP_442813.1_4 Forward -238 -219 -2.55715 0.278
NP_442813.1_4 Forward -261 -242 -3.83545 0.296
NP_439949.1_7 Forward -248 -234 15.3392 0.215
NP_442694.1_4 Forward -244 -235 11.9961 0.275
NP_442694.1_4 Reverse -275 -284 10.8161 0.294
NP_441966.1_7 Forward -287 -268 -2.06626 0.297
NP_442308.1_3 Reverse -277 -296 16.5191 0.251
NP_441851.1_10 Forward -337 -327 4.89658 0.24
NP_442856.1_6 Reverse -33 -51 13.883 0.287
NP_441668.1_4 Reverse -61 -80 4.03102 0.183
NP_441349.1_10 Forward -96 -77 -9.34199 0.289
NP_440389.1_5 Forward -93 -74 11.8368 0.277
NP_442843.1_1 Forward -261 -242 -9.047 0.264
NP_442168.1_5 Forward -294 -275 11.4058 0.137
NP_441003.1_9 Reverse -217 -236 5.60432 0.261
NP_441003.1_9 Forward -95 -76 5.40766 0.264
NP_441078.1_4 Reverse -77 -86 6.39124 0.0775
NP_441078.1_4 Forward -86 -77 -1.77023 0.266
NP_442729.1_5 Reverse -274 -284 8.92815 0.235
NP_442348.1_2 Reverse -274 -283 11.8978 0.225
NP_442348.1_2 Forward -245 -236 7.17789 0.285
NP_442443.1_4 Reverse -230 -240 16.7941 0.14
NP_440526.1_3 Forward -85 -74 0.746521 0.271
NP_441432.1_8 Reverse -76 -85 3.34298 0.248
NP_441333.1_1 Forward -109 -99 15.1171 0.175
NP_441732.1_2 Forward -90 -74 -8.0046 0.105
NP_442797.1_1 Forward -91 -72 8.35759 0.137
NP_440281.1_6 Reverse -98 -117 16.7157 0.119
NP_442400.1_10 Reverse -99 -112 9.03802 0.277
NP_442489.1_7 Reverse -77 -86 -1.37691 0.195
NP_441659.2_8 Forward -92 -82 1.455 0.24
NP_441022.1_1 Reverse -19 -28 13.5606 0.216
NP_441040.1_2 Forward -101 -82 -14.4552 0.286
NP_440545.1_3 Reverse -73 -90 -6.54933 0.283
NP_441923.1_6 Forward -340 -326 11.2093 0.25
NP_440486.1_6 Reverse -268 -287 9.83255 0.219
NP_440486.1_6 Reverse -76 -95 5.60432 0.293
NP_440486.1_9 Reverse -271 -285 17.0108 0.177
NP_441126.1_8 Reverse -72 -85 10.7374 0.291
NP_442603.1_7 Forward -269 -255 7.57046 0.202
NP_441895.1_2 Reverse -344 -363 -26.9432 0.275
NP_442699.1_8 Reverse -354 -373 -12.5869 0.255
NP_442045.1_5 Forward -239 -220 8.94757 0.182
NP_442045.1_5 Forward -63 -44 -1.57384 0.29
NP_440875.1_9 Reverse -86 -96 8.46937 0.233
NP_440590.1_4 Reverse -248 -261 0.117615 0.169
NP_440821.1_4 Forward -338 -328 5.09324 0.119
NP_441239.1_9 Forward -88 -76 3.97222 0.269
NP_441951.1_4 Reverse -244 -263 3.73603 0.273
NP_441951.1_6 Forward -293 -274 12.9791 0.205
NP_441951.1_9 Forward -94 -75 5.11266 0.254
NP_442270.1_9 Forward -129 -110 -6.39206 0.207
NP_440833.1_6 Reverse -234 -248 10.5204 0.242
NP_442216.1_4 Forward -367 -359 8.27883 0.255
NP_441617.1_6 Forward -242 -223 -4.52377 0.265
NP_440546.1_6 Forward -222 -203 7.37428 0.273
NP_441474.1_1 Forward -78 -59 2.6536 0.247
NP_441848.1_4 Reverse -226 -242 7.26419 0.292
NP_440696.1_6 Reverse -72 -91 3.14605 0.288
NP_442023.1_2 Reverse -219 -238 6.39097 0.275
NP_442039.1_4 Reverse -328 -335 9.47889 0.145
NP_442039.1_7 Reverse -229 -239 13.943 0.211
NP_442039.1_7 Reverse -86 -96 7.25653 0.277
NP_441811.1_8 Forward -178 -164 5.70279 0.293
NP_442837.1_3 Reverse -328 -335 9.38056 0.132
NP_440160.1_2 Forward -86 -67 -6.88371 0.283
NP_440160.1_2 Reverse -280 -299 -7.08038 0.283
NP_440505.1_4 Reverse -281 -300 16.9521 0.276
NP_442255.1_5 Reverse -159 -178 10.6192 0.227
NP_441408.2_7 Reverse -107 -126 -1.47551 0.251
NP_440914.1_1 Reverse -227 -237 10.6645 0.129
NP_442533.1_6 Reverse -77 -86 4.91628 0.165
NP_442533.1_6 Forward -92 -83 4.22796 0.186
NP_442533.1_6 Reverse -83 -92 4.12963 0.191
NP_442541.1_10 Forward -86 -72 3.93223 0.252
NP_442232.1_3 Reverse -69 -88 -14.4552 0.288
NP_442269.1_4 Forward -258 -239 12.9791 0.283
NP_441028.1_6 Reverse -40 -50 3.8145 0.281
NP_441028.1_6 Reverse -11 -21 3.51951 0.292
NP_443045.1_9 Forward -92 -74 17.3246 0.152
NP_439903.1_3 Forward -257 -238 6.88262 0.277
NP_442306.1_10 Forward -97 -78 -13.3736 0.197
NP_441286.1_1 Forward -237 -225 0.432302 0.113
NP_441286.1_1 Forward -309 -297 -6.35254 0.26
NP_442674.1_1 Reverse -224 -243 12.7942 0.218
NP_442908.1_1 Forward -241 -222 1.17943 0.277
NP_440886.1_7 Reverse -159 -169 3.22451 0.291
NP_442614.1_2 Reverse -83 -97 6.48943 0.291
NP_439995.1_10 Reverse -195 -214 7.47261 0.296
NP_441399.1_6 Forward -289 -270 10.1267 0.297
NP_441401.1_8 Reverse -23 -42 14.3059 0.186
NP_442615.1_1 Reverse -68 -86 -6.4707 0.248
NP_441962.1_4 Reverse -72 -91 -12.3902 0.256
NP_441962.1_4 Reverse -222 -241 -13.7669 0.277
NP_440855.1_5 Forward -88 -69 4.52188 0.285
NP_442020.1_1 Reverse -237 -256 8.65176 0.157
NP_442020.1_1 Reverse -99 -118 -0.689632 0.278
NP_441521.1_5 Forward -296 -277 16.2241 0.141
NP_440634.1_1 Forward -140 -121 12.5858 0.26
NP_441993.1_1 Reverse -77 -96 6.0399 0.188
NP_441993.1_1 Reverse -65 -84 1.4594 0.276
NP_440737.1_2 Reverse -244 -261 17.4434 0.0476
NP_441272.1_7 Forward -252 -242 16.4996 0.2
NP_439988.1_3 Reverse -72 -86 12.0943 0.203
NP_442635.1_2 Forward -300 -281 9.7334 0.297
NP_441246.1_6 Reverse -349 -367 5.32902 0.281
NP_441246.1_7 Reverse -147 -166 1.47442 0.265
NP_439910.1_2 Reverse -101 -118 -13.5308 0.162
NP_439910.1_2 Reverse -239 -256 -22.5773 0.267
NP_439911.1_6 Reverse -281 -300 4.52268 0.205
NP_440457.1_1 Reverse -79 -91 4.46387 0.161
NP_440801.1_9 Forward -238 -224 12.8353 0.286
NP_441984.1_3 Reverse -264 -282 5.82068 0.276
NP_441436.1_6 Reverse -74 -93 8.65258 0.26
NP_442582.1_3 Reverse -98 -112 12.6166 0.284
NP_442341.1_9 Reverse -80 -94 5.21053 0.277
NP_440423.1_6 Forward -62 -43 -13.4719 0.22
NP_440275.1_3 Forward -56 -46 3.71661 0.215
NP_442932.1_9 Reverse -220 -239 7.07928 0.249
NP_440679.1_10 Forward -219 -200 -16.9135 0.275
NP_441122.1_1 Forward -240 -225 4.20813 0.28
NP_442495.1_4 Reverse -74 -84 13.943 0.183
NP_441105.1_3 Forward -97 -78 -8.45701 0.272
NP_440216.1_9 Reverse -229 -238 7.17789 0.286
NP_440172.1_1 Forward -118 -108 5.5849 0.14
NP_440416.1_9 Forward -237 -218 -20.3551 0.284
NP_442116.1_6 Forward -40 -23 7.596 0.254
NP_442154.1_1 Forward -214 -196 7.19731 0.0591
NP_442154.1_1 Reverse -72 -90 -19.1554 0.291
NP_442564.1_9 Forward -295 -281 14.6052 0.227
NP_440261.1_5 Forward -307 -294 -12.0754 0.27
NP_440988.1_10 Reverse -81 -95 7.02871 0.224
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGGGGTAACTTGGATAAATGGGCCGCAGAGATTTTATTCCCCACCCTTTACGTGGTTTATGTATTGGGAGCGCTGTTACTCCTATTCTGGATTGCTAAAGCCCTCAGCAGTGGCTTCACCAAGGCCCAGGACGTGCTCAGCACCGGCGGTCTTTGGTGGATTTTTGCCATTGTCCTCGGTGTAGTGACCATGTTGGCTCTAGTGGGTCTGAGTTTCCTTAACGGCTGGTTTGATGACAGCCGTAACCTAGAACCATTTTTCTGGCTACTGGGCTTCATCATTGTCGATGTCTTGTTAATTTTCTGGCTGCCCACGGCCCTAGCCACTCCCAAATCCATGCGCTACGTGCCACCGGGGTCAATGTTATTACGCAAAATTTATGGAGGTTAGAGGTTAAGCC

CDS

ATGCAAAAAATTTATGCCATCGGTGTGGGGGGCAGTGGAGCTAAATGCGTGGAAGCGGCCATTTTTCTCCATTCCCTGGGGCTGTACGGCGACAACTCCGAACTAAGAATTTTATTGGTCGATGCAGATACCTCTAACGGCAACTCTCAAAGAACTGGGGTCAACTTCCGTACCACCGACGATGCCCAAAAAGCTTTTGGCCAAGGGAAAAGCCCCTTAATGAGTGGACAATTTTTCCACTACGGCACCTGGAATCCCCTGGGGGACCAAGTTCATAACAACAACTTAGCAGGGGTTTTTAACAAACAAGCTTTGCGGGCCAGTGCTCCTCCCTTAGCAAAATTATTTGATGCCCTTTACAGTCCAGCGGAACAAACTGCCGATCTAGGAGTGGGGTTTCGGGGCCGGCCTCCCATCGGTTCAGCGGTGATGAGTCGTTTAGAACTGGATAGTCTCCAGCAAACCCAGGCTGGGGGATGGCAACAGCTATTTAATAATCTAACCACGGATTTAGGGGTAGGTCGGGGCAATGATGTGGTGGTGCATTTCTTTGGCAGTATCTTTGGGGGAACAGGAGCTTCCGGGGTTCCTACCCTGGCTAAACTAATTAGTAATCAGTTAAAACAGGACAATCTTCGAGTTCGTATTCACGCATCTTTGTTGTTACCGTACTTTGCCTTTGAACGTCCTGACGACGGCGATCAAACGGTGTTTGCCGAAACTCGCTTTTTTGCCCTCAATACCCAAGCGGCATTGCAATACTTAACGGAGCAGTCCCAAGGCTGTTTTGATAGTGTGTACTTGATTGGGGACAATGCCCAAACTAGGTATGATTCCCACACTGGGGGCAAAAATCAGGAAAATGGGGCCCATTTTGTCGAACTGTACGCCGCCCTGGCCGCTAACCATGGTTTCGATCAACCCATGGGGGAAACGGTGGCCCACTACATCAGTCGGGGGGATATCAATAGTCTGATTTGGACGGACTTGCCGGATGACGAAATCGCTAAATTAGCCCTCAGTAAGGGAGTGCGCTTTGCCTACGCTTGGTTCTATAACTTTTCCTTGGAGTTGGAAGCGGCCCGGAAGTTGGGAGGTAAAAAGTTTGCGAAGGGTGCTCCTTGGTTCCAACACTTTTTTGCTCTTAGGGCAGGGGAAGAGGATAAACCCCTGGTGGACAATGCCCAGGAAGTGGCCAAAAATGATCTACTCACAGCCTGGGCCAAGAAGTTTTTGCAATGGGCCCAACAGGTTTCCTCTGCCCATGTCAATGGCGAGCAACTTTTTCAGCTCAAACATTTGGACGATCTGAAACAAAACCCCGGTTATCGTGAACATCTCCACCAATTAATTATTGATAAGGAGAAAAGTCAAGCGGCGCAAAGTGGCGATCGCCTGGACACAATCAAGAACCGTTTAGCAGATGAGGGCAAAAGTTATGATAAAGGCGTTTTTGGCTTAGCCCATGCCCTGTTTGATTTACTTTAG

Protein

MQKIYAIGVGGSGAKCVEAAIFLHSLGLYGDNSELRILLVDADTSNGNSQRTGVNFRTTDDAQKAFGQGKSPLMSGQFFHYGTWNPLGDQVHNNNLAGVFNKQALRASAPPLAKLFDALYSPAEQTADLGVGFRGRPPIGSAVMSRLELDSLQQTQAGGWQQLFNNLTTDLGVGRGNDVVVHFFGSIFGGTGASGVPTLAKLISNQLKQDNLRVRIHASLLLPYFAFERPDDGDQTVFAETRFFALNTQAALQYLTEQSQGCFDSVYLIGDNAQTRYDSHTGGKNQENGAHFVELYAALAANHGFDQPMGETVAHYISRGDINSLIWTDLPDDEIAKLALSKGVRFAYAWFYNFSLELEAARKLGGKKFAKGAPWFQHFFALRAGEEDKPLVDNAQEVAKNDLLTAWAKKFLQWAQQVSSAHVNGEQLFQLKHLDDLKQNPGYREHLHQLIIDKEKSQAAQSGDRLDTIKNRLADEGKSYDKGVFGLAHALFDLL