Your browser is old and dusty. Try Google Chrome!

Details for sll0426

ORF sll0426
Accession NP_441798.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -326 -340 10.226 0.0636
NP_441061.1_2 Forward -333 -319 1.76955 0.183
NP_440795.1_7 Forward -333 -326 14.6904 0.0123
NP_440795.1_7 Reverse -326 -333 14.6904 0.0123
NP_440795.1_7 Forward -41 -34 14.6904 0.0123
NP_440795.1_7 Reverse -34 -41 14.6904 0.0123
NP_440795.1_7 Reverse -254 -261 10.2655 0.154
NP_441418.1_6 Reverse -325 -344 -11.1119 0.0445
NP_441418.1_6 Forward -334 -315 -13.6686 0.0777
NP_441418.1_6 Forward -346 -327 -29.4015 0.224
NP_440815.1_5 Forward -204 -185 6.58763 0.273
NP_442291.1_5 Reverse -32 -48 -4.66135 0.281
NP_440897.1_6 Reverse -325 -344 16.5182 0.0255
NP_441453.1_1 Reverse -26 -44 3.06666 0.278
NP_441453.1_4 Reverse -325 -333 16.539 0.00633
NP_441453.1_4 Reverse -33 -41 16.539 0.00633
NP_441453.1_4 Forward -334 -326 16.539 0.00633
NP_441453.1_4 Forward -42 -34 16.539 0.00633
NP_441453.1_7 Forward -256 -249 11.6422 0.298
NP_441453.1_8 Forward -258 -241 6.43035 0.293
NP_441623.1_1 Forward -341 -323 11.9172 0.0833
NP_442151.1_6 Reverse -325 -339 20.4524 0.0045
NP_442151.1_6 Forward -334 -320 14.1593 0.0395
NP_442151.1_6 Reverse -33 -47 7.9644 0.184
NP_442151.1_6 Forward -42 -28 7.47274 0.197
NP_441818.1_1 Reverse -326 -337 15.6928 0.0257
NP_441818.1_1 Forward -333 -322 14.0211 0.0577
NP_441818.1_1 Reverse -34 -45 9.20294 0.25
NP_441818.1_9 Reverse -310 -329 6.09597 0.148
NP_440226.1_1 Reverse -33 -52 17.6007 0.0184
NP_440226.1_1 Forward -42 -23 10.5209 0.0617
NP_441630.1_3 Forward -342 -323 17.3057 0.0318
NP_441630.1_3 Reverse -317 -336 -1.37718 0.298
NP_440150.1_6 Reverse -322 -341 1.17943 0.295
NP_442287.1_3 Forward -50 -33 12.4278 0.3
NP_442655.1_1 Forward -47 -28 0.196116 0.24
NP_442173.1_1 Forward -333 -325 15.4574 0.00633
NP_442173.1_1 Forward -41 -33 15.4574 0.00633
NP_442173.1_1 Reverse -326 -334 15.4574 0.00633
NP_442173.1_1 Reverse -34 -42 15.4574 0.00633
NP_442173.1_1 Reverse -254 -262 4.54265 0.27
NP_442752.1_4 Forward -334 -327 13.8055 0.0199
NP_442752.1_4 Reverse -325 -332 13.8055 0.0199
NP_442752.1_4 Forward -42 -35 13.8055 0.0199
NP_442752.1_4 Reverse -33 -40 13.8055 0.0199
NP_442752.1_4 Forward -380 -373 5.44732 0.202
NP_443027.1_4 Forward -44 -34 13.2547 0.0521
NP_443027.1_4 Forward -336 -326 13.1564 0.0521
NP_443027.1_4 Forward -382 -372 9.12481 0.177
NP_443027.1_4 Reverse -31 -41 7.25653 0.24
NP_443027.1_4 Reverse -323 -333 6.46988 0.275
NP_441812.1_3 Forward -335 -321 6.78443 0.291
NP_442975.1_10 Forward -46 -32 12.487 0.0477
NP_442975.1_10 Forward -338 -324 3.24392 0.26
NP_442975.1_10 Reverse -321 -335 3.04726 0.263
NP_442975.1_10 Reverse -29 -43 2.06395 0.284
NP_440784.1_7 Forward -333 -326 15.9687 0.0123
NP_440784.1_7 Reverse -326 -333 15.9687 0.0123
NP_440784.1_7 Forward -41 -34 15.9687 0.0123
NP_440784.1_7 Reverse -34 -41 15.9687 0.0123
NP_442909.1_7 Forward -333 -319 8.75042 0.163
NP_442909.1_7 Forward -339 -325 7.57046 0.21
NP_441934.1_8 Reverse -72 -91 14.1591 0.222
NP_441250.1_3 Forward -126 -107 3.34271 0.266
NP_440061.1_9 Forward -336 -322 14.9452 0.0555
NP_440061.1_9 Reverse -323 -337 5.40719 0.286
NP_440110.1_4 Forward -345 -326 18.4857 0.052
NP_440110.1_8 Reverse -323 -342 10.4225 0.0878
NP_442062.1_8 Forward -334 -324 17.6796 0.00193
NP_442062.1_8 Reverse -325 -335 17.3846 0.00193
NP_442062.1_8 Reverse -33 -43 10.3048 0.0493
NP_442062.1_8 Forward -42 -32 10.3048 0.0493
NP_440761.1_4 Reverse -320 -339 -12.2919 0.241
NP_441859.1_3 Forward -335 -316 19.4681 0.0319
NP_440304.1_4 Reverse -323 -333 17.9746 0.00654
NP_440304.1_4 Forward -44 -34 10.8948 0.051
NP_440304.1_4 Reverse -31 -41 10.8948 0.051
NP_440304.1_4 Forward -336 -326 9.91146 0.051
NP_442242.1_4 Forward -333 -326 14.3954 0.0124
NP_442242.1_4 Reverse -326 -333 14.3954 0.0124
NP_442242.1_4 Forward -41 -34 14.3954 0.0124
NP_442242.1_4 Reverse -34 -41 14.3954 0.0124
NP_440044.1_8 Reverse -326 -345 19.0757 0.0159
NP_440916.1_1 Reverse -173 -187 8.06273 0.28
NP_439918.1_2 Reverse -2 -21 1.0811 0.217
NP_439918.1_2 Reverse -7 -26 -2.95047 0.251
NP_441619.1_9 Forward -73 -54 3.44104 0.269
NP_441208.1_9 Reverse -30 -44 16.9125 0.0647
NP_441208.1_9 Reverse -322 -336 9.2427 0.217
NP_441208.1_9 Forward -337 -323 8.45605 0.219
NP_441594.1_6 Forward -173 -154 7.47261 0.172
NP_441594.1_6 Reverse -316 -335 4.12936 0.222
NP_441594.1_6 Reverse -322 -341 3.53937 0.227
NP_441594.1_6 Forward -337 -318 2.16274 0.255
NP_440370.1_10 Reverse -24 -43 10.0292 0.211
NP_442110.1_7 Reverse -325 -339 17.2075 0.0249
NP_442110.1_7 Reverse -33 -47 1.86788 0.222
NP_440856.1_4 Forward -49 -30 -0.983855 0.189
NP_441083.1_5 Reverse -325 -335 20.3345 0.00053
NP_441083.1_5 Forward -334 -324 19.3512 0.000718
NP_441083.1_5 Forward -42 -32 11.2881 0.0159
NP_441083.1_5 Reverse -33 -43 11.2881 0.0159
NP_442827.1_8 Forward -342 -323 24.2863 0.0085
NP_442827.1_8 Reverse -317 -336 5.40686 0.12
NP_441141.1_4 Reverse -315 -334 9.53756 0.292
NP_441738.1_2 Forward -332 -325 15.28 0.0102
NP_441738.1_2 Reverse -327 -334 15.28 0.0102
NP_441738.1_2 Forward -40 -33 15.28 0.0102
NP_441738.1_2 Reverse -35 -42 15.28 0.0102
NP_441738.1_2 Reverse -373 -380 9.77352 0.143
NP_441738.1_2 Reverse -215 -222 6.52862 0.261
NP_441558.1_5 Reverse -323 -342 13.5691 0.057
NP_441558.1_5 Forward -336 -317 11.7008 0.0783
NP_441558.1_5 Forward -44 -25 10.2259 0.102
NP_441558.1_5 Forward -313 -294 9.14423 0.129
NP_440209.1_1 Reverse -325 -333 18.1123 0.00295
NP_440209.1_1 Reverse -33 -41 18.1123 0.00295
NP_440209.1_1 Forward -334 -326 18.1123 0.00295
NP_440209.1_1 Forward -42 -34 18.1123 0.00295
NP_442889.1_8 Forward -45 -31 10.8154 0.0775
NP_440447.1_6 Reverse -25 -43 3.16574 0.207
NP_440056.1_1 Forward -27 -8 11.1109 0.191
NP_441713.1_1 Reverse -27 -46 1.76941 0.0651
NP_441713.1_1 Reverse -319 -338 -9.93197 0.188
NP_441713.1_1 Forward -48 -29 -13.6686 0.257
NP_441770.1_5 Forward -207 -188 5.70265 0.209
NP_440178.1_7 Reverse -324 -343 -12.5869 0.121
NP_440178.1_7 Reverse -32 -51 -22.42 0.265
NP_441716.1_1 Reverse -325 -339 13.4709 0.0689
NP_441716.1_1 Forward -334 -320 11.8976 0.0888
NP_441716.1_1 Forward -42 -28 4.22782 0.256
NP_441598.1_3 Forward -21 -2 15.979 0.147
NP_442111.1_4 Forward -43 -29 15.8309 0.0194
NP_442111.1_4 Forward -335 -321 10.521 0.0535
NP_442111.1_4 Reverse -324 -338 9.2427 0.0619
NP_441163.1_1 Reverse -363 -380 9.47787 0.226
NP_441163.1_1 Reverse -317 -334 4.0697 0.294
NP_440906.1_5 Forward -333 -326 15.8704 0.0124
NP_440906.1_5 Reverse -326 -333 15.8704 0.0124
NP_440906.1_5 Forward -41 -34 15.8704 0.0124
NP_440906.1_5 Reverse -34 -41 15.8704 0.0124
NP_440747.1_10 Reverse -30 -42 15.2803 0.0019
NP_440747.1_10 Forward -337 -325 7.51213 0.00286
NP_440747.1_10 Forward -45 -33 7.4138 0.00422
NP_440747.1_10 Reverse -322 -334 -1.92764 0.0192
NP_441130.1_10 Forward -336 -322 17.4042 0.0167
NP_441130.1_10 Reverse -323 -337 16.8142 0.0213
NP_441130.1_10 Forward -382 -368 6.09611 0.202
NP_442973.1_5 Forward -51 -32 13.5691 0.167
NP_442973.1_7 Forward -192 -173 14.7491 0.209
NP_441486.1_1 Forward -337 -323 6.09611 0.0344
NP_441486.1_1 Forward -45 -31 -2.16369 0.175
NP_441486.1_1 Reverse -322 -336 -3.147 0.176
NP_442634.1_2 Reverse -27 -46 4.71934 0.265
NP_442634.1_4 Forward -44 -30 17.3058 0.01
NP_442634.1_4 Reverse -323 -337 2.94952 0.124
NP_442634.1_4 Reverse -251 -265 -1.47537 0.149
NP_442634.1_4 Reverse -31 -45 -1.96703 0.149
NP_442634.1_4 Forward -336 -322 -5.01529 0.228
NP_441265.1_3 Reverse -27 -41 4.71948 0.181
NP_441265.1_3 Forward -340 -326 2.94952 0.181
NP_440403.1_4 Forward -343 -324 -1.47551 0.174
NP_440403.1_10 Reverse -322 -341 4.12936 0.267
NP_441014.1_8 Reverse -242 -261 3.73603 0.214
NP_441014.1_8 Forward -132 -113 -9.44032 0.295
NP_442848.1_1 Forward -340 -326 7.57108 0.0791
NP_441012.1_4 Reverse -186 -199 9.75405 0.272
NP_441012.1_4 Forward -367 -354 9.55739 0.272
NP_443018.1_3 Forward -333 -326 14.8871 0.0123
NP_443018.1_3 Reverse -326 -333 14.8871 0.0123
NP_443018.1_3 Forward -41 -34 14.8871 0.0123
NP_443018.1_3 Reverse -34 -41 14.8871 0.0123
NP_443018.1_3 Forward -192 -185 10.2655 0.107
NP_443018.1_3 Reverse -390 -397 7.6106 0.156
NP_441316.1_7 Forward -44 -29 2.43817 0.154
NP_441634.1_8 Forward -336 -322 5.89945 0.114
NP_441634.1_8 Reverse -17 -31 -1.96703 0.295
NP_441634.1_8 Reverse -323 -337 -3.44199 0.295
NP_440376.1_1 Forward -334 -325 19.4693 0.000692
NP_440376.1_1 Reverse -325 -334 19.4693 0.000692
NP_440376.1_1 Forward -42 -33 19.4693 0.000692
NP_440376.1_1 Reverse -33 -42 19.4693 0.000692
NP_441588.1_4 Forward -40 -30 7.05986 0.178
NP_441588.1_4 Reverse -35 -45 6.76487 0.185
NP_442687.1_7 Reverse -324 -334 18.5646 0.0028
NP_442687.1_7 Forward -67 -57 10.6981 0.0994
NP_442687.1_7 Forward -43 -33 9.02648 0.0994
NP_442687.1_7 Reverse -32 -42 9.02648 0.0994
NP_442687.1_7 Forward -335 -325 8.92815 0.0994
NP_441846.1_10 Forward -261 -242 -12.7836 0.194
NP_441846.1_10 Forward -203 -184 -22.5183 0.261
NP_440642.1_10 Forward -120 -106 4.03056 0.263
NP_441013.1_2 Reverse -179 -197 0.314141 0.254
NP_441950.1_7 Reverse -319 -338 -3.24547 0.207
NP_441763.1_10 Forward -21 -2 5.60352 0.284
NP_440360.1_10 Forward -332 -318 17.1092 0.0856
NP_442658.1_1 Reverse -323 -333 17.6791 0.00565
NP_442658.1_1 Forward -44 -34 14.2375 0.0237
NP_442658.1_1 Reverse -31 -41 13.0576 0.04
NP_442658.1_1 Forward -336 -326 9.616 0.147
NP_442198.1_3 Forward -346 -327 3.6377 0.285
NP_440141.1_8 Reverse -316 -335 5.40766 0.275
NP_442782.1_2 Reverse -357 -371 4.62115 0.251
NP_442782.1_2 Forward -262 -248 1.17956 0.282
NP_442205.1_9 Reverse -319 -335 6.05672 0.119
NP_441414.1_9 Forward -334 -315 -7.37537 0.217
NP_441414.1_9 Reverse -325 -344 -8.94866 0.249
NP_440720.1_1 Forward -345 -326 13.4708 0.124
NP_441256.1_1 Reverse -181 -200 1.17943 0.169
NP_442937.1_5 Reverse -119 -138 9.53756 0.187
NP_442937.1_5 Forward -339 -320 5.89931 0.295
NP_441958.1_5 Forward -43 -33 21.2195 0.000805
NP_441958.1_5 Reverse -32 -42 21.2195 0.000805
NP_441958.1_5 Reverse -324 -334 20.5312 0.000966
NP_441958.1_5 Forward -335 -325 12.2714 0.00183
NP_441127.1_1 Reverse -131 -145 8.84938 0.284
NP_440203.1_5 Reverse -328 -338 12.6642 0.141
NP_440203.1_5 Forward -331 -321 10.4026 0.225
NP_440203.1_5 Forward -39 -29 9.81266 0.245
NP_440203.1_5 Reverse -239 -249 9.12434 0.271
NP_440203.1_5 Reverse -215 -225 9.02601 0.275
NP_439905.1_1 Forward -333 -320 17.8172 0.0359
NP_439905.1_1 Reverse -326 -339 10.5407 0.216
NP_440984.1_7 Forward -47 -33 15.7325 0.0488
NP_440984.1_7 Forward -339 -325 12.8809 0.121
NP_440984.1_7 Reverse -320 -334 12.1926 0.122
NP_440984.1_7 Forward -138 -124 4.52282 0.299
NP_439990.1_5 Reverse -28 -41 8.08242 0.181
NP_442911.1_2 Reverse -315 -334 3.93269 0.0406
NP_442911.1_2 Forward -344 -325 -2.26216 0.096
NP_442911.1_2 Reverse -361 -380 -10.4236 0.279
NP_442911.1_2 Reverse -23 -42 -11.1119 0.299
NP_441580.1_6 Reverse -242 -261 1.76941 0.117
NP_441580.1_6 Forward -21 -2 -3.73712 0.235
NP_440153.1_5 Reverse -326 -340 12.4876 0.0645
NP_440153.1_5 Reverse -34 -48 4.91614 0.193
NP_440153.1_8 Reverse -325 -338 4.44418 0.2
NP_440153.1_8 Forward -292 -279 -1.94734 0.23
NP_442064.1_1 Reverse -28 -47 -11.2103 0.259
NP_443055.1_6 Reverse -19 -37 -1.45654 0.279
NP_443055.1_6 Forward -398 -380 -2.34152 0.294
NP_440993.1_2 Forward -339 -323 13.8249 0.0656
NP_440993.1_2 Forward -47 -31 2.51681 0.265
NP_440993.1_3 Forward -344 -325 5.2102 0.156
NP_440993.1_3 Forward -52 -33 -1.47628 0.282
NP_440993.1_4 Forward -78 -61 1.8088 0.3
NP_440602.1_2 Reverse -28 -47 2.45773 0.263
NP_442210.1_5 Reverse -311 -330 11.7008 0.22
NP_442210.1_9 Reverse -3 -21 13.8838 0.209
NP_441099.1_5 Reverse -243 -262 -9.63698 0.229
NP_441099.1_5 Forward -344 -325 -11.4069 0.28
NP_442002.1_9 Reverse -324 -331 14.1004 0.074
NP_440809.1_9 Reverse -316 -334 3.06741 0.118
NP_441294.1_7 Forward -46 -32 12.9942 0.0767
NP_441294.1_7 Forward -338 -324 11.5544 0.137
NP_441294.1_7 Reverse -321 -335 10.1145 0.207
NP_440106.1_2 Forward -358 -340 10.1472 0.298
NP_441646.1_1 Reverse -318 -337 8.45592 0.141
NP_442438.1_10 Forward -339 -325 17.6008 0.0186
NP_442438.1_10 Forward -172 -158 -0.393733 0.259
NP_440879.1_6 Reverse -320 -339 7.07928 0.15
NP_441000.1_6 Reverse -32 -46 5.1128 0.0933
NP_441000.1_6 Reverse -324 -338 -4.62196 0.248
NP_440605.1_4 Reverse -23 -42 18.5218 0.0577
NP_442771.1_1 Reverse -323 -341 -4.60241 0.166
NP_442771.1_1 Reverse -369 -387 -10.3056 0.254
NP_440484.1_3 Forward -44 -30 10.1277 0.242
NP_440147.1_4 Reverse -31 -44 19.9805 0.00251
NP_440147.1_4 Reverse -323 -336 13.3923 0.0326
NP_440147.1_4 Forward -336 -323 11.819 0.0326
NP_440147.1_4 Forward -44 -31 9.75405 0.0371
NP_441550.1_8 Reverse -323 -333 19.8424 0.00352
NP_441550.1_8 Forward -336 -326 16.7941 0.00906
NP_441550.1_8 Forward -44 -34 15.8108 0.0132
NP_441550.1_8 Reverse -31 -41 15.3192 0.0132
NP_441550.1_8 Reverse -300 -310 5.97777 0.22
NP_441916.1_7 Forward -42 -32 18.9579 0.00144
NP_441916.1_7 Reverse -33 -43 18.9579 0.00144
NP_441916.1_7 Forward -334 -324 16.893 0.00407
NP_441916.1_7 Reverse -325 -335 10.3048 0.0261
NP_441916.1_7 Forward -262 -252 6.27322 0.102
NP_441916.1_7 Forward -66 -56 2.53664 0.25
NP_440465.1_10 Forward -337 -318 9.3409 0.173
NP_440465.1_10 Reverse -322 -341 2.0644 0.275
NP_441041.1_4 Forward -340 -321 -12.3902 0.265
NP_441041.1_4 Forward -42 -23 -13.0786 0.28
NP_441041.1_7 Forward -45 -33 16.6495 0.0131
NP_441041.1_7 Reverse -30 -42 14.4144 0.0348
NP_441041.1_7 Reverse -322 -334 12.568 0.0611
NP_441041.1_7 Reverse -368 -380 4.79381 0.295
NP_440569.1_7 Forward -331 -312 9.93088 0.286
NP_442004.1_6 Reverse -325 -339 9.04604 0.14
NP_442004.1_6 Forward -334 -320 8.06273 0.149
NP_442004.1_6 Reverse -253 -267 6.58777 0.171
NP_442004.1_6 Forward -42 -28 3.44117 0.24
NP_441725.1_5 Forward -333 -323 18.7612 0.0119
NP_441725.1_5 Reverse -326 -336 9.02648 0.0553
NP_441725.1_5 Forward -41 -31 1.94665 0.115
NP_441725.1_5 Reverse -34 -44 1.94665 0.115
NP_439966.1_7 Forward -336 -326 14.8275 0.0177
NP_439966.1_7 Forward -44 -34 14.3359 0.0203
NP_439966.1_7 Reverse -323 -333 8.14104 0.14
NP_439966.1_7 Reverse -31 -41 6.27276 0.185
NP_439966.1_9 Forward -224 -215 3.83464 0.253
NP_439966.1_9 Reverse -323 -332 0.983037 0.253
NP_439966.1_9 Forward -336 -327 0.884706 0.253
NP_440736.1_3 Forward -44 -25 -0.39387 0.282
NP_442941.1_3 Reverse -34 -44 19.2529 0.00262
NP_442941.1_3 Forward -41 -31 11.0914 0.0116
NP_442941.1_3 Reverse -326 -336 10.9931 0.0116
NP_442941.1_3 Reverse -254 -264 5.68323 0.103
NP_442941.1_3 Forward -333 -323 2.43831 0.14
NP_440289.1_2 Reverse -322 -335 11.524 0.0191
NP_440289.1_2 Forward -45 -32 5.91914 0.0605
NP_440289.1_2 Forward -337 -324 5.03416 0.0636
NP_440983.1_5 Forward -331 -312 -3.54046 0.239
NP_440983.1_5 Reverse -328 -347 -5.80207 0.273
NP_440260.1_8 Reverse -24 -42 -5.58572 0.275
NP_441514.1_1 Reverse -114 -124 13.2946 0.299
NP_442281.1_1 Forward -47 -33 16.8135 0.00698
NP_442281.1_1 Forward -339 -325 6.29216 0.13
NP_442281.1_1 Reverse -208 -222 3.63724 0.224
NP_442281.1_1 Reverse -28 -42 1.5723 0.296
NP_441334.1_7 Reverse -323 -342 -1.57384 0.0619
NP_441334.1_7 Forward -44 -25 -12.9802 0.181
NP_440177.1_9 Reverse -116 -135 14.2574 0.213
NP_440177.1_9 Forward -348 -329 12.1925 0.238
NP_442256.1_2 Reverse -323 -341 3.75572 0.107
NP_442256.1_2 Forward -336 -318 -8.63398 0.232
NP_440437.1_1 Forward -340 -321 1.37609 0.151
NP_440647.1_9 Forward -44 -26 2.37909 0.295
NP_442012.1_1 Forward -340 -321 12.9791 0.066
NP_442012.1_1 Reverse -319 -338 1.17943 0.222
NP_441457.1_7 Reverse -323 -342 -0.295539 0.288
NP_441556.1_10 Forward -339 -325 15.8674 0.139
NP_441556.1_10 Reverse -320 -334 13.7259 0.178
NP_440498.1_1 Reverse -24 -42 6.60732 0.0856
NP_442982.1_5 Forward -52 -33 -1.7705 0.269
NP_442982.1_5 Reverse -23 -42 -2.75381 0.289
NP_441644.1_6 Forward -42 -32 19.0557 0.000803
NP_441644.1_6 Reverse -33 -43 19.0557 0.000803
NP_441644.1_6 Reverse -325 -335 17.3841 0.00127
NP_441644.1_6 Forward -334 -324 15.7125 0.0048
NP_441644.1_6 Forward -340 -330 6.37109 0.161
NP_441644.1_6 Reverse -184 -194 4.01116 0.253
NP_441644.1_6 Reverse -389 -399 3.61784 0.272
NP_442215.1_1 Forward -197 -178 6.68596 0.22
NP_442215.1_2 Reverse -323 -339 -3.18639 0.211
NP_442215.1_2 Forward -336 -320 -5.448 0.25
NP_442215.1_2 Reverse -176 -192 -5.84132 0.26
NP_442215.1_2 Reverse -66 -82 -7.41462 0.294
NP_442177.1_6 Reverse -306 -325 11.6025 0.233
NP_440253.1_2 Reverse -325 -343 -1.65248 0.245
NP_440253.1_2 Reverse -33 -51 -2.24246 0.262
NP_440929.1_8 Forward -334 -325 19.2726 0.000701
NP_440929.1_8 Reverse -325 -334 19.2726 0.000701
NP_440929.1_8 Forward -42 -33 19.2726 0.000701
NP_440929.1_8 Reverse -33 -42 19.2726 0.000701
NP_442933.1_10 Forward -334 -325 17.601 0.00325
NP_442933.1_10 Reverse -325 -334 17.601 0.00325
NP_442933.1_10 Forward -42 -33 17.601 0.00325
NP_442933.1_10 Reverse -33 -42 17.601 0.00325
NP_441751.2_8 Forward -333 -319 11.6026 0.0222
NP_441751.2_8 Forward -41 -27 7.07942 0.0341
NP_441751.2_8 Reverse -185 -199 -4.52363 0.174
NP_441751.2_8 Reverse -34 -48 -4.52363 0.174
NP_441751.2_8 Reverse -237 -251 -6.68692 0.277
NP_442554.1_8 Reverse -326 -336 18.0729 0.00543
NP_442554.1_8 Reverse -34 -44 17.2863 0.00543
NP_442554.1_8 Forward -333 -323 16.9913 0.0065
NP_442554.1_8 Forward -41 -31 16.4013 0.0065
NP_442554.1_8 Reverse -185 -195 4.99491 0.163
NP_442554.1_8 Forward -397 -387 2.53664 0.268
NP_442167.1_6 Forward -344 -328 9.98926 0.298
NP_442167.1_8 Reverse -181 -195 19.6651 0.255
NP_441762.1_7 Reverse -324 -336 11.2487 0.0142
NP_441762.1_7 Forward -335 -323 2.59558 0.0676
NP_441762.1_7 Forward -43 -31 0.432302 0.0747
NP_441762.1_7 Reverse -32 -44 -6.74586 0.284
NP_442142.1_4 Forward -45 -32 12.2117 0.0464
NP_442142.1_4 Reverse -30 -43 12.2117 0.0464
NP_442142.1_4 Forward -196 -183 8.67183 0.111
NP_442142.1_4 Reverse -181 -194 8.37683 0.116
NP_442142.1_4 Reverse -322 -335 4.05029 0.234
NP_442142.1_4 Forward -31 -18 3.55864 0.251
NP_442292.1_1 Reverse -326 -335 18.486 0.00229
NP_442292.1_1 Forward -41 -32 17.5026 0.00435
NP_442292.1_1 Reverse -34 -43 17.5026 0.00435
NP_442292.1_1 Forward -333 -324 9.53783 0.0183
NP_442292.1_5 Reverse -321 -340 0.392778 0.257
NP_442292.1_5 Forward -338 -319 -0.983855 0.257
NP_442476.1_6 Reverse -326 -340 5.89945 0.131
NP_442476.1_6 Forward -333 -319 5.30946 0.138
NP_440895.1_6 Reverse -310 -323 13.9823 0.202
NP_440421.1_1 Forward -151 -137 13.4709 0.297
NP_443009.1_5 Reverse -32 -43 15.7911 0.0107
NP_443009.1_5 Forward -335 -324 15.7911 0.0107
NP_443009.1_5 Forward -43 -32 15.7911 0.0107
NP_443009.1_5 Reverse -324 -335 11.1696 0.066
NP_443009.1_5 Reverse -370 -381 7.03967 0.141
NP_441715.1_4 Reverse -34 -44 16.7946 0.0106
NP_441715.1_4 Reverse -326 -336 7.84651 0.107
NP_441715.1_4 Forward -41 -31 7.35486 0.108
NP_440357.1_3 Forward -336 -317 8.94757 0.203
NP_440777.1_8 Reverse -341 -360 12.6841 0.243
NP_440183.1_1 Forward -261 -242 9.43923 0.244
NP_441198.1_5 Reverse -327 -340 14.7683 0.206
NP_441198.1_8 Reverse -323 -333 15.2245 0.0427
NP_441198.1_8 Reverse -31 -41 12.783 0.116
NP_440379.1_5 Reverse -4 -23 -10.227 0.276
NP_441468.1_1 Forward -333 -326 15.8704 0.0124
NP_441468.1_1 Reverse -326 -333 15.8704 0.0124
NP_441468.1_1 Forward -41 -34 15.8704 0.0124
NP_441468.1_1 Reverse -34 -41 15.8704 0.0124
NP_441468.1_9 Reverse -186 -200 16.3225 0.282
NP_441020.2_7 Forward -21 -2 11.5033 0.22
NP_441015.1_8 Forward -319 -300 0.0977854 0.28
NP_441015.1_10 Reverse -320 -339 3.04771 0.142
NP_441015.1_10 Reverse -113 -132 -7.57203 0.269
NP_441673.1_1 Forward -334 -325 20.8459 0.000698
NP_441673.1_1 Reverse -325 -334 20.8459 0.000698
NP_441673.1_1 Forward -42 -33 20.8459 0.000698
NP_441673.1_1 Reverse -33 -42 20.8459 0.000698
NP_441826.1_2 Forward -340 -326 14.2576 0.0203
NP_441826.1_2 Reverse -319 -333 3.63784 0.107
NP_441330.1_1 Forward -47 -28 -3.3438 0.0791
NP_441637.1_9 Reverse -148 -166 -3.71743 0.296
NP_442490.1_9 Forward -346 -327 -0.000545616 0.179
NP_442868.1_6 Forward -336 -326 17.4829 0.012
NP_442868.1_6 Reverse -323 -333 16.7946 0.0131
NP_442868.1_6 Forward -44 -34 10.4031 0.038
NP_442868.1_6 Reverse -31 -41 0.963343 0.205
NP_440051.1_10 Reverse -215 -227 18.4263 0.134
NP_441612.1_2 Forward -245 -235 8.6461 0.21
NP_441612.1_2 Reverse -325 -335 8.54929 0.21
NP_442227.1_2 Forward -290 -271 7.27595 0.196
NP_442227.1_2 Reverse -238 -257 -1.37718 0.262
NP_442427.1_8 Forward -51 -32 8.84924 0.192
NP_442808.1_1 Reverse -324 -334 8.73102 0.0481
NP_442808.1_1 Reverse -32 -42 8.73102 0.0481
NP_442808.1_1 Forward -43 -33 8.73102 0.0481
NP_442808.1_1 Forward -335 -325 8.63269 0.0481
NP_442808.1_1 Reverse -183 -193 5.78111 0.141
NP_441101.1_1 Reverse -323 -341 9.36059 0.286
NP_441101.1_10 Forward -338 -319 0.687771 0.173
NP_440145.1_3 Reverse -23 -42 25.2705 0.00286
NP_440145.1_3 Reverse -114 -133 -2.85214 0.181
NP_442820.1_3 Forward -140 -130 17.9741 0.187
NP_442820.1_10 Forward -340 -322 22.8319 0.0541
NP_442542.1_2 Reverse -323 -336 13.3923 0.114
NP_442542.1_9 Forward -341 -327 13.4703 0.108
NP_442050.1_1 Forward -183 -164 8.35759 0.251
NP_442050.1_5 Forward -44 -34 15.9091 0.0091
NP_442050.1_5 Forward -336 -326 15.6142 0.01
NP_442050.1_5 Reverse -323 -333 14.9258 0.0175
NP_442050.1_5 Reverse -31 -41 9.22267 0.193
NP_441114.1_3 Reverse -297 -306 7.27622 0.247
NP_440558.1_2 Forward -87 -68 0.491109 0.19
NP_440558.1_2 Reverse -130 -149 -0.688862 0.204
NP_440558.1_2 Forward -31 -12 -0.885524 0.205
NP_440558.1_2 Forward -337 -318 -2.85214 0.231
NP_440558.1_2 Forward -202 -183 -7.08038 0.287
NP_440111.2_2 Forward -345 -326 -2.16383 0.247
NP_442789.1_4 Forward -187 -168 -4.32711 0.259
NP_442789.1_4 Reverse -323 -342 -6.49039 0.285
NP_440923.1_4 Forward -35 -16 2.55606 0.225
NP_441878.1_6 Reverse -324 -334 20.2362 0.0046
NP_441878.1_6 Forward -43 -33 10.5014 0.0176
NP_441878.1_6 Reverse -32 -42 10.5014 0.0176
NP_441878.1_6 Forward -335 -325 10.4031 0.0176
NP_441036.1_8 Forward -43 -33 15.713 0.00724
NP_441036.1_8 Reverse -32 -42 15.713 0.00724
NP_441036.1_8 Reverse -252 -262 9.22315 0.174
NP_441036.1_8 Reverse -324 -334 8.4365 0.174
NP_441036.1_8 Forward -335 -325 8.33817 0.174
NP_442650.1_2 Reverse -325 -339 4.81781 0.163
NP_441557.1_5 Forward -334 -325 19.9609 0.000699
NP_441557.1_5 Reverse -325 -334 19.9609 0.000699
NP_441557.1_5 Forward -42 -33 19.9609 0.000699
NP_441557.1_5 Reverse -33 -42 19.9609 0.000699
NP_441445.1_1 Reverse -316 -335 20.354 0.0269
NP_441590.1_4 Forward -21 -2 8.16011 0.249
NP_442066.2_4 Reverse -325 -344 -7.27704 0.276
NP_442066.2_9 Forward -46 -33 10.2457 0.154
NP_442830.1_5 Reverse -183 -197 -0.492641 0.297
NP_442183.1_1 Forward -334 -320 9.73436 0.094
NP_442183.1_1 Reverse -371 -385 7.57108 0.138
NP_442183.1_1 Reverse -325 -339 6.48943 0.171
NP_440979.1_3 Forward -333 -315 14.1788 0.234
NP_440979.1_6 Reverse -59 -78 14.0608 0.27
NP_440276.1_2 Forward -110 -91 14.5459 0.209
NP_441549.1_9 Reverse -321 -339 7.88563 0.0711
NP_441549.1_9 Forward -338 -320 0.117479 0.126
NP_442347.1_2 Reverse -326 -335 12.4878 0.056
NP_442347.1_2 Forward -333 -324 3.34298 0.284
NP_442347.1_2 Forward -41 -32 3.34298 0.284
NP_442347.1_2 Reverse -34 -43 3.34298 0.284
NP_442645.1_2 Reverse -323 -342 -18.1918 0.27
NP_442645.1_2 Forward -223 -204 -19.6667 0.288
NP_442645.1_2 Reverse -25 -44 -22.3217 0.29
NP_442888.1_6 Forward -322 -303 5.50599 0.228
NP_441037.1_4 Reverse -323 -333 18.9151 0.00351
NP_441037.1_4 Reverse -31 -41 15.0168 0.028
NP_441037.1_4 Forward -336 -326 9.55921 0.21
NP_441037.1_4 Forward -44 -34 7.22024 0.237
NP_442594.1_8 Reverse -113 -132 13.7658 0.146
NP_442594.1_8 Reverse -17 -36 2.26107 0.295
NP_442508.1_9 Reverse -6 -20 18.8791 0.159
NP_442738.1_4 Forward -327 -308 9.3409 0.247
NP_441633.1_3 Forward -336 -323 13.1956 0.018
NP_441633.1_3 Reverse -323 -336 -3.4223 0.177
NP_441633.1_3 Forward -44 -31 -3.81562 0.177
NP_441633.1_3 Reverse -31 -44 -6.07724 0.236
NP_440136.1_2 Forward -333 -326 15.9687 0.0123
NP_440136.1_2 Reverse -326 -333 15.9687 0.0123
NP_440136.1_2 Forward -41 -34 15.9687 0.0123
NP_440136.1_2 Reverse -34 -41 15.9687 0.0123
NP_440136.1_2 Reverse -254 -261 4.26735 0.218
NP_442590.1_10 Reverse -26 -45 6.58763 0.241
NP_442590.1_10 Forward -340 -321 3.24438 0.294
NP_442998.1_5 Reverse -368 -378 14.3364 0.149
NP_442998.1_5 Reverse -288 -298 12.0747 0.176
NP_442998.1_10 Forward -332 -325 15.5754 0.0102
NP_442998.1_10 Reverse -327 -334 15.5754 0.0102
NP_442998.1_10 Forward -40 -33 15.5754 0.0102
NP_442998.1_10 Reverse -35 -42 15.5754 0.0102
NP_442998.1_10 Reverse -59 -66 4.07068 0.276
NP_440899.1_2 Reverse -242 -261 6.09517 0.269
NP_440299.1_1 Forward -338 -325 19.4882 0.00234
NP_440299.1_1 Reverse -29 -42 9.45847 0.0709
NP_440299.1_1 Reverse -321 -334 6.50855 0.139
NP_440299.1_1 Forward -384 -371 4.14862 0.217
NP_441799.1_1 Reverse -29 -43 18.8785 0.00745
NP_441799.1_1 Reverse -321 -335 17.3052 0.011
NP_441799.1_1 Forward -46 -32 13.4703 0.032
NP_441007.1_10 Reverse -320 -333 11.7207 0.0599
NP_441007.1_10 Forward -339 -326 9.16406 0.104
NP_441007.1_10 Forward -47 -34 2.67422 0.183
NP_440256.1_1 Reverse -30 -49 22.3206 0.00281
NP_440256.1_1 Forward -265 -246 -6.29373 0.207
NP_440256.1_1 Forward -45 -26 -8.16202 0.253
NP_441512.1_4 Reverse -321 -340 8.45592 0.264
NP_440456.1_7 Reverse -127 -141 13.8643 0.281
NP_441559.1_8 Reverse -28 -42 8.35772 0.0676
NP_441559.1_8 Reverse -320 -334 -6.68692 0.279
NP_441559.1_8 Reverse -189 -203 -6.68692 0.279
NP_441559.1_8 Forward -339 -325 -6.78525 0.279
NP_441559.1_8 Forward -47 -33 -7.2769 0.289
NP_442756.1_2 Forward -348 -329 4.12936 0.296
NP_440915.1_6 Forward -338 -324 13.3726 0.0187
NP_440915.1_6 Forward -46 -32 10.816 0.0301
NP_440915.1_6 Reverse -29 -43 10.0294 0.0357
NP_440915.1_6 Reverse -321 -335 -2.16369 0.26
NP_441704.1_8 Forward -345 -326 12.3883 0.122
NP_442452.1_8 Forward -340 -326 14.0603 0.273
NP_441464.1_8 Forward -334 -320 18.9775 0.0644
NP_441464.1_10 Reverse -314 -328 10.0294 0.262
NP_440695.1_5 Forward -334 -315 -0.983855 0.284
NP_441939.1_3 Reverse -326 -345 16.3224 0.0401
NP_441199.1_6 Forward -338 -319 7.7676 0.116
NP_441494.1_6 Reverse -320 -333 10.5407 0.225
NP_441494.1_6 Forward -339 -326 8.27909 0.23
NP_439985.1_7 Reverse -319 -338 12.5858 0.163
NP_442993.1_1 Forward -42 -26 -9.28291 0.181
NP_442993.1_1 Forward -334 -318 -9.47957 0.186
NP_442993.1_1 Reverse -33 -49 -9.47957 0.186
NP_442993.1_1 Forward -304 -288 -11.3479 0.244
NP_440677.1_1 Reverse -316 -335 9.24257 0.187
NP_440677.1_1 Reverse -331 -350 7.57094 0.234
NP_442386.1_9 Forward -335 -326 13.8639 0.0289
NP_442386.1_9 Reverse -324 -333 6.39082 0.219
NP_442386.1_9 Forward -43 -34 6.39082 0.219
NP_442386.1_9 Reverse -32 -41 6.39082 0.219
NP_441750.1_1 Reverse -310 -329 -13.2752 0.3
NP_441340.1_5 Forward -333 -326 15.6737 0.0124
NP_441340.1_5 Reverse -326 -333 15.6737 0.0124
NP_441340.1_5 Forward -41 -34 15.6737 0.0124
NP_441340.1_5 Reverse -34 -41 15.6737 0.0124
NP_442484.1_2 Forward -261 -242 2.26107 0.226
NP_442484.1_2 Reverse -8 -27 -1.96717 0.3
NP_440168.1_8 Forward -263 -244 7.86593 0.179
NP_440327.1_6 Reverse -310 -329 4.81767 0.266
NP_442240.1_1 Forward -342 -323 24.9746 0.00787
NP_442240.1_1 Forward -343 -324 9.43841 0.227
NP_442240.1_2 Reverse -326 -345 -14.3569 0.178
NP_442240.1_2 Reverse -358 -377 -20.4534 0.295
NP_440586.1_1 Reverse -321 -340 -2.0655 0.25
NP_440586.1_1 Reverse -318 -337 -4.91709 0.278
NP_440586.1_8 Forward -333 -326 13.2151 0.026
NP_440586.1_8 Forward -41 -34 13.2151 0.026
NP_440586.1_8 Reverse -326 -333 13.2151 0.026
NP_440586.1_8 Reverse -34 -41 13.2151 0.026
NP_440586.1_8 Forward -192 -185 9.08521 0.178
NP_440586.1_8 Reverse -219 -226 7.02027 0.279
NP_442251.1_6 Forward -333 -326 15.2804 0.0124
NP_442251.1_6 Reverse -326 -333 15.2804 0.0124
NP_442251.1_6 Forward -41 -34 15.2804 0.0124
NP_442251.1_6 Reverse -34 -41 15.2804 0.0124
NP_441262.1_3 Reverse -325 -332 14.7888 0.0223
NP_441262.1_3 Reverse -33 -40 14.7888 0.0223
NP_441262.1_3 Forward -334 -327 14.7888 0.0223
NP_441262.1_3 Forward -42 -35 14.7888 0.0223
NP_440027.1_3 Forward -272 -254 12.5064 0.159
NP_440027.1_3 Reverse -325 -343 5.91824 0.232
NP_443051.1_1 Reverse -32 -41 19.5676 0.00335
NP_443051.1_1 Forward -43 -34 19.5676 0.00335
NP_443051.1_1 Reverse -324 -333 18.0926 0.00402
NP_443051.1_1 Forward -335 -326 10.4228 0.00754
NP_439996.1_6 Forward -344 -325 10.5371 0.209
NP_439984.1_3 Reverse -318 -332 16.6169 0.115
NP_439937.1_9 Forward -381 -364 8.5929 0.0679
NP_439937.1_9 Forward -335 -318 4.65968 0.0798
NP_439937.1_9 Reverse -324 -341 -6.255 0.157
NP_439937.1_9 Forward -43 -26 -14.8098 0.287
NP_441595.1_5 Forward -341 -323 9.0656 0.217
NP_440408.1_7 Reverse -325 -344 7.47261 0.288
NP_440439.1_1 Forward -337 -324 12.8023 0.0231
NP_440439.1_1 Forward -45 -32 10.639 0.0362
NP_440439.1_1 Reverse -30 -43 8.9674 0.0488
NP_440439.1_1 Reverse -322 -335 3.75586 0.11
NP_440439.1_1 Reverse -250 -263 0.314277 0.194
NP_440372.1_2 Forward -333 -326 16.3621 0.0124
NP_440372.1_2 Reverse -326 -333 16.3621 0.0124
NP_440372.1_2 Forward -41 -34 16.3621 0.0124
NP_440372.1_2 Reverse -34 -41 16.3621 0.0124
NP_440271.1_2 Forward -202 -183 -0.0988766 0.292
NP_441138.1_1 Forward -226 -207 11.7992 0.216
NP_441789.1_7 Reverse -227 -246 -2.45958 0.257
NP_440316.1_10 Forward -194 -184 7.55152 0.246
NP_442488.1_7 Reverse -132 -151 8.35759 0.287
NP_441803.1_2 Forward -339 -320 1.47442 0.23
NP_439977.1_5 Reverse -319 -338 -3.3438 0.299
NP_441572.1_7 Forward -48 -29 12.0942 0.0431
NP_440267.1_2 Forward -47 -33 20.6484 0.00946
NP_442384.1_10 Forward -42 -29 14.4739 0.0148
NP_442384.1_10 Reverse -325 -338 12.9006 0.0241
NP_442384.1_10 Forward -334 -321 11.6223 0.0341
NP_442384.1_10 Reverse -33 -46 2.57589 0.22
NP_442384.1_10 Reverse -371 -384 1.59258 0.253
NP_440530.1_5 Forward -362 -343 7.86593 0.258
NP_442790.1_4 Reverse -316 -335 -10.3253 0.206
NP_442262.1_10 Forward -333 -326 14.1988 0.0123
NP_442262.1_10 Reverse -326 -333 14.1988 0.0123
NP_442262.1_10 Forward -41 -34 14.1988 0.0123
NP_442262.1_10 Reverse -34 -41 14.1988 0.0123
NP_442262.1_10 Forward -192 -185 9.18389 0.211
NP_442262.1_10 Reverse -390 -397 8.8889 0.219
NP_441689.1_5 Reverse -31 -41 8.3377 0.132
NP_441689.1_5 Forward -44 -34 8.3377 0.132
NP_441689.1_5 Forward -264 -254 8.04271 0.166
NP_441689.1_5 Forward -336 -326 5.87944 0.197
NP_441689.1_5 Forward -400 -390 4.99446 0.285
NP_440163.1_10 Forward -196 -186 8.82982 0.26
NP_440344.1_10 Reverse -318 -335 -0.649475 0.0444
NP_440344.1_10 Forward -341 -324 -10.1876 0.17
NP_440282.1_10 Forward -323 -304 -4.03212 0.25
NP_440282.1_10 Forward -82 -63 -5.21209 0.25
NP_440282.1_10 Reverse -315 -334 -7.08038 0.251
NP_440531.1_6 Forward -342 -323 -2.26216 0.247
NP_440531.1_6 Reverse -317 -336 -4.81876 0.287
NP_440531.1_8 Reverse -113 -132 4.52268 0.269
NP_442123.1_10 Forward -347 -328 17.2074 0.164
NP_440487.1_1 Reverse -322 -341 -5.11376 0.214
NP_440562.1_3 Forward -41 -24 4.26707 0.199
NP_440562.1_10 Reverse -24 -42 11.9172 0.206
NP_441965.1_3 Forward -344 -325 2.26107 0.212
NP_441965.1_10 Forward -45 -29 8.02334 0.135
NP_440297.1_9 Forward -333 -323 9.51814 0.0917
NP_440297.1_9 Forward -41 -31 -0.216628 0.282
NP_440297.1_9 Reverse -326 -336 -0.216628 0.282
NP_440297.1_9 Reverse -34 -44 -0.216628 0.282
NP_440297.1_9 Reverse -185 -195 -0.609952 0.292
NP_442280.1_10 Reverse -185 -203 9.25304 0.233
NP_442280.1_10 Forward -261 -243 7.79204 0.268
NP_441896.1_3 Forward -343 -324 1.27776 0.218
NP_441896.1_5 Reverse -1 -8 15.3787 0.268
NP_440990.1_7 Forward -346 -327 4.916 0.292
NP_440990.1_10 Reverse -313 -332 18.4857 0.249
NP_440894.1_10 Reverse -320 -339 16.5191 0.0698
NP_440894.1_10 Reverse -150 -169 8.45592 0.176
NP_440999.1_9 Forward -338 -324 9.63603 0.0615
NP_440999.1_9 Reverse -321 -335 8.94771 0.0698
NP_440999.1_9 Forward -46 -32 -0.885388 0.22
NP_440999.1_9 Forward -32 -18 -0.885388 0.22
NP_440888.1_2 Reverse -325 -339 21.5334 0.000502
NP_440888.1_2 Reverse -33 -47 15.5352 0.0102
NP_440888.1_2 Reverse -158 -172 7.96378 0.175
NP_440888.1_2 Forward -334 -320 7.47213 0.194
NP_440888.1_2 Forward -42 -28 6.39049 0.236
NP_440600.1_4 Forward -50 -32 -7.84733 0.294
NP_440179.1_6 Forward -333 -314 6.88262 0.209
NP_440491.1_1 Reverse -322 -341 17.2475 0.0567
NP_440052.1_5 Forward -345 -326 -4.52377 0.259
NP_442277.1_4 Forward -343 -324 19.8614 0.0213
NP_442277.1_4 Forward -51 -32 10.2251 0.0949
NP_442033.1_10 Forward -44 -25 -3.44213 0.171
NP_442033.1_10 Reverse -323 -342 -5.80207 0.18
NP_442033.1_10 Forward -274 -255 -12.7836 0.277
NP_442033.1_10 Forward -336 -317 -13.4719 0.287
NP_441949.1_4 Forward -79 -60 5.70265 0.281
NP_441543.1_2 Reverse -326 -335 16.9127 0.00359
NP_441543.1_2 Forward -41 -32 15.9293 0.00518
NP_441543.1_2 Reverse -34 -43 15.9293 0.00518
NP_441543.1_2 Forward -333 -324 9.34117 0.0818
NP_442845.1_2 Reverse -27 -41 11.0127 0.138
NP_442845.1_2 Reverse -325 -339 7.27608 0.195
NP_442845.1_2 Reverse -319 -333 6.58777 0.207
NP_442845.1_2 Forward -340 -326 6.3911 0.21
NP_441551.1_5 Reverse -180 -196 11.6609 0.166
NP_441551.1_5 Reverse -321 -337 7.92432 0.241
NP_441551.1_5 Forward -338 -322 7.82599 0.241
NP_441918.1_7 Reverse -74 -93 1.0811 0.288
NP_441258.1_9 Reverse -322 -341 16.2241 0.139
NP_441469.1_8 Reverse -324 -333 13.3727 0.073
NP_441469.1_8 Forward -43 -34 6.5879 0.227
NP_441469.1_8 Reverse -32 -41 6.5879 0.227
NP_441469.1_8 Forward -335 -326 6.48957 0.227
NP_442315.1_1 Reverse -314 -332 12.5072 0.131
NP_443064.1_6 Forward -334 -324 13.8273 0.0796
NP_443064.1_6 Reverse -325 -335 12.5669 0.0796
NP_443064.1_6 Forward -42 -32 10.8217 0.13
NP_443064.1_6 Reverse -33 -43 10.8217 0.13
NP_442578.1_7 Forward -333 -326 14.5921 0.026
NP_442578.1_7 Forward -41 -34 14.5921 0.026
NP_442578.1_7 Reverse -326 -333 14.5921 0.026
NP_442578.1_7 Reverse -34 -41 14.5921 0.026
NP_441462.1_2 Forward -42 -32 20.2362 0.000805
NP_441462.1_2 Reverse -33 -43 20.2362 0.000805
NP_441462.1_2 Forward -334 -324 20.1379 0.000967
NP_441462.1_2 Reverse -325 -335 11.5831 0.00406
NP_441621.1_7 Reverse -323 -337 4.91614 0.0934
NP_441621.1_7 Forward -336 -322 -3.04867 0.188
NP_441621.1_7 Forward -44 -30 -5.11362 0.248
NP_443062.1_1 Reverse -184 -202 15.859 0.0346
NP_443062.1_1 Reverse -33 -51 8.05839 0.16
NP_443062.1_6 Reverse -317 -336 5.60432 0.201
NP_441410.1_3 Forward -51 -32 16.9124 0.121
NP_442204.1_1 Reverse -29 -40 8.51513 0.0919
NP_442204.1_1 Forward -46 -35 2.02529 0.266
NP_442204.1_1 Forward -338 -327 0.648657 0.281
NP_442204.1_1 Forward -197 -186 0.648657 0.281
NP_442204.1_5 Forward -344 -325 4.71934 0.165
NP_442204.1_5 Reverse -315 -334 2.75272 0.206
NP_441560.1_10 Reverse -25 -44 11.6025 0.168
NP_441351.1_8 Forward -274 -255 0.0977854 0.292
NP_440516.1_2 Reverse -319 -337 -0.374176 0.251
NP_440516.1_6 Reverse -184 -198 12.0937 0.197
NP_440516.1_6 Reverse -162 -176 8.65209 0.246
NP_440516.1_8 Forward -334 -325 16.9127 0.00442
NP_440516.1_8 Reverse -325 -334 16.9127 0.00442
NP_440516.1_8 Forward -42 -33 16.9127 0.00442
NP_440516.1_8 Reverse -33 -42 16.9127 0.00442
NP_442428.1_5 Forward -333 -326 15.8704 0.0124
NP_442428.1_5 Reverse -326 -333 15.8704 0.0124
NP_442428.1_5 Forward -41 -34 15.8704 0.0124
NP_442428.1_5 Reverse -34 -41 15.8704 0.0124
NP_441443.1_7 Reverse -112 -131 2.0644 0.218
NP_442120.1_10 Forward -304 -285 -11.5053 0.262
NP_440673.1_2 Forward -344 -325 17.0231 0.0543
NP_440673.1_3 Forward -332 -325 12.4288 0.0426
NP_440673.1_3 Forward -40 -33 12.4288 0.0426
NP_440673.1_3 Reverse -327 -334 12.4288 0.0426
NP_440673.1_3 Reverse -35 -42 12.4288 0.0426
NP_440673.1_3 Reverse -391 -398 10.5605 0.123
NP_440673.1_3 Forward -26 -19 8.98723 0.203
NP_440673.1_3 Reverse -24 -31 6.3323 0.283
NP_440865.1_9 Reverse -319 -338 0.0977854 0.145
NP_441052.1_2 Reverse -325 -335 19.9412 0.00106
NP_441052.1_2 Forward -334 -324 10.4031 0.0285
NP_441052.1_2 Forward -42 -32 10.4031 0.0285
NP_441052.1_2 Reverse -33 -43 10.4031 0.0285
NP_442219.1_8 Reverse -321 -340 18.8934 0.0434
NP_442219.1_9 Reverse -326 -335 17.7976 0.00718
NP_442219.1_9 Forward -333 -324 8.25953 0.0681
NP_442219.1_9 Forward -41 -32 8.25953 0.0681
NP_442219.1_9 Reverse -34 -43 8.25953 0.0681
NP_440436.1_4 Reverse -326 -335 17.2072 0.00233
NP_440436.1_4 Forward -333 -324 15.9289 0.00508
NP_440436.1_4 Forward -41 -32 9.24241 0.0871
NP_440436.1_4 Reverse -34 -43 9.24241 0.0871
NP_440436.1_4 Forward -27 -18 7.76745 0.124
NP_441884.1_9 Reverse -322 -341 24.7789 0.0019
NP_441884.1_9 Forward -337 -318 -23.01 0.284
NP_442086.1_3 Forward -41 -22 12.4875 0.166
NP_441321.1_5 Reverse -114 -133 6.29264 0.265
NP_441336.1_3 Reverse -318 -332 13.9626 0.298
NP_440314.1_9 Forward -333 -314 -6.68705 0.231
NP_440314.1_9 Forward -41 -22 -7.27704 0.238
NP_441719.1_4 Forward -333 -326 16.3621 0.0124
NP_441719.1_4 Reverse -326 -333 16.3621 0.0124
NP_441719.1_4 Forward -41 -34 16.3621 0.0124
NP_441719.1_4 Reverse -34 -41 16.3621 0.0124
NP_441733.1_10 Forward -337 -324 8.86907 0.132
NP_441004.1_1 Reverse -319 -338 -18.0934 0.297
NP_442366.1_3 Reverse -32 -50 -5.38906 0.287
NP_442366.1_3 Reverse -324 -342 -5.48739 0.288
NP_442366.1_5 Reverse -30 -40 14.0409 0.0497
NP_440129.1_4 Reverse -328 -346 13.293 0.291
NP_442873.1_3 Forward -342 -323 3.44025 0.287
NP_440296.1_10 Reverse -322 -341 -3.3438 0.209
NP_441115.1_4 Reverse -32 -50 11.1298 0.151
NP_441115.1_4 Forward -335 -317 8.3765 0.25
NP_442206.1_1 Forward -334 -315 -11.3086 0.219
NP_442206.1_10 Forward -227 -212 1.84819 0.215
NP_442854.1_6 Reverse -248 -267 4.916 0.249
NP_440328.1_4 Forward -340 -321 14.3558 0.0367
NP_440328.1_4 Forward -48 -29 6.4893 0.129
NP_443054.1_2 Forward -336 -322 0.786239 0.254
NP_443054.1_2 Reverse -17 -31 0.786239 0.254
NP_443054.1_2 Forward -44 -30 -0.492064 0.295
NP_441851.1_10 Reverse -324 -334 17.4829 0.0027
NP_441851.1_10 Forward -335 -325 15.8113 0.00552
NP_441851.1_10 Forward -43 -33 8.53483 0.114
NP_441851.1_10 Reverse -32 -42 8.53483 0.114
NP_442011.1_1 Forward -335 -316 8.55425 0.167
NP_441668.1_4 Reverse -114 -133 7.07928 0.151
NP_441668.1_4 Reverse -115 -134 4.71934 0.173
NP_442515.1_1 Forward -335 -321 23.2057 0.00534
NP_442515.1_1 Reverse -324 -338 11.3077 0.0416
NP_441396.1_5 Reverse -122 -131 8.55452 0.21
NP_440593.1_3 Forward -339 -320 9.43923 0.107
NP_441046.1_2 Forward -181 -162 -0.590531 0.282
NP_441349.1_10 Forward -52 -33 6.39097 0.0364
NP_441349.1_10 Reverse -23 -42 5.99764 0.0388
NP_441409.1_6 Reverse -27 -46 12.3892 0.0209
NP_441409.1_6 Reverse -319 -338 -8.94866 0.178
NP_440389.1_5 Reverse -318 -337 11.8368 0.277
NP_440432.1_9 Reverse -34 -49 12.6646 0.0232
NP_440432.1_9 Reverse -326 -341 0.471552 0.159
NP_442843.1_1 Forward -397 -378 3.44104 0.154
NP_442843.1_1 Forward -188 -169 -10.4236 0.278
NP_439960.1_10 Forward -341 -323 -4.11075 0.292
NP_440474.1_8 Forward -333 -319 7.17714 0.207
NP_440474.1_8 Reverse -34 -48 5.01387 0.26
NP_440474.1_8 Reverse -214 -228 4.62054 0.271
NP_440431.1_4 Forward -104 -85 -9.88384 0.294
NP_442450.1_5 Reverse -323 -333 10.1081 0.115
NP_442450.1_5 Reverse -31 -41 7.64985 0.13
NP_442168.1_5 Forward -41 -22 -2.36049 0.264
NP_440588.1_2 Reverse -24 -43 6.78429 0.0535
NP_440588.1_2 Forward -343 -324 -0.39387 0.15
NP_442006.1_2 Forward -313 -296 0.333834 0.128
NP_442243.1_1 Forward -340 -322 -2.43985 0.292
NP_441570.1_1 Reverse -325 -343 0.314141 0.0395
NP_441570.1_1 Reverse -253 -271 -16.5005 0.247
NP_441078.1_4 Forward -334 -325 19.6659 0.0007
NP_441078.1_4 Reverse -325 -334 19.6659 0.0007
NP_441078.1_4 Forward -42 -33 19.6659 0.0007
NP_441078.1_4 Reverse -33 -42 19.6659 0.0007
NP_442729.1_8 Reverse -321 -334 10.344 0.125
NP_442729.1_8 Forward -384 -371 10.049 0.125
NP_442729.1_8 Forward -338 -325 8.77074 0.125
NP_442443.1_2 Forward -28 -9 18.0924 0.0843
NP_440526.1_3 Forward -333 -322 11.3662 0.0646
NP_440526.1_3 Reverse -326 -337 10.6779 0.0646
NP_440526.1_3 Reverse -76 -87 2.02482 0.267
NP_440526.1_3 Reverse -34 -45 1.92649 0.267
NP_441432.1_8 Reverse -32 -41 16.8143 0.00595
NP_441432.1_8 Forward -335 -326 16.8143 0.00595
NP_441432.1_8 Forward -43 -34 16.8143 0.00595
NP_441432.1_8 Reverse -324 -333 8.35786 0.0755
NP_441432.1_8 Reverse -18 -27 5.40793 0.158
NP_441432.1_8 Forward -399 -390 2.55633 0.298
NP_442320.1_8 Forward -48 -34 5.60446 0.0334
NP_442320.1_8 Forward -340 -326 5.01447 0.0442
NP_442344.1_7 Forward -333 -314 -8.752 0.226
NP_441732.1_2 Forward -338 -322 3.50012 0.0141
NP_441732.1_2 Reverse -321 -337 3.30346 0.0141
NP_441732.1_2 Reverse -29 -45 -7.80794 0.0935
NP_440629.1_5 Forward -380 -361 7.17762 0.29
NP_440760.1_1 Reverse -325 -344 -17.8968 0.205
NP_440760.1_1 Forward -334 -315 -21.6334 0.24
NP_442797.1_7 Forward -341 -323 14.8671 0.11
NP_441072.1_2 Reverse -314 -333 7.86593 0.248
NP_441072.1_2 Forward -53 -34 7.57094 0.256
NP_440713.1_4 Reverse -243 -262 12.0942 0.11
NP_440713.1_4 Reverse -315 -334 4.71934 0.223
NP_440713.1_4 Forward -344 -325 3.6377 0.24
NP_442489.1_7 Forward -334 -325 20.1576 0.000695
NP_442489.1_7 Reverse -325 -334 20.1576 0.000695
NP_442489.1_7 Forward -42 -33 20.1576 0.000695
NP_442489.1_7 Reverse -33 -42 20.1576 0.000695
NP_440559.1_1 Reverse -326 -335 17.4043 0.00658
NP_440559.1_1 Forward -333 -324 17.306 0.00658
NP_440559.1_1 Reverse -34 -43 8.65285 0.0586
NP_440559.1_1 Forward -41 -32 8.65285 0.0586
NP_441659.2_8 Forward -42 -32 20.9245 0.000805
NP_441659.2_8 Reverse -33 -43 20.9245 0.000805
NP_441659.2_8 Forward -334 -324 19.3512 0.000966
NP_441659.2_8 Reverse -325 -335 18.1713 0.00133
NP_441659.2_8 Forward -133 -123 0.471689 0.264
NP_442913.1_10 Forward -51 -32 2.85105 0.12
NP_442913.1_10 Forward -343 -324 2.26107 0.129
NP_442913.1_10 Reverse -316 -335 -3.54046 0.212
NP_441040.1_2 Forward -342 -323 -4.91709 0.174
NP_441040.1_5 Forward -209 -190 15.2408 0.127
NP_442008.1_2 Reverse -30 -49 4.42435 0.24
NP_442008.1_2 Reverse -322 -341 4.03102 0.245
NP_440708.1_6 Reverse -164 -183 -10.4236 0.278
NP_441800.1_3 Reverse -64 -82 13.3922 0.255
NP_442776.1_1 Reverse -242 -261 13.0775 0.127
NP_440779.1_5 Reverse -325 -342 -5.27103 0.14
NP_440779.1_5 Reverse -33 -50 -6.15601 0.164
NP_442346.1_5 Reverse -324 -334 17.9746 0.00128
NP_442346.1_5 Forward -335 -325 16.6963 0.00248
NP_442346.1_5 Forward -43 -33 16.303 0.00248
NP_442346.1_5 Reverse -32 -42 16.303 0.00248
NP_442346.1_5 Reverse -18 -28 11.2881 0.0706
NP_440352.1_5 Reverse -104 -123 18.9826 0.0454
NP_440545.1_3 Forward -338 -321 25.8016 0.00301
NP_440545.1_3 Reverse -321 -338 12.3302 0.0212
NP_440545.1_3 Reverse -29 -46 5.74204 0.0597
NP_440545.1_3 Forward -46 -29 -3.10775 0.199
NP_441856.1_3 Forward -45 -26 8.16093 0.101
NP_441856.1_3 Forward -69 -50 -0.983855 0.228
NP_440025.1_4 Forward -150 -131 13.1758 0.222
NP_440831.1_3 Forward -343 -324 12.2118 0.146
NP_440831.1_3 Forward -275 -256 9.29946 0.202
NP_440831.1_3 Reverse -322 -341 7.8433 0.24
NP_441629.1_1 Reverse -25 -44 7.47261 0.253
NP_440555.1_1 Reverse -22 -41 13.5691 0.0901
NP_441923.1_6 Reverse -76 -90 9.04604 0.278
NP_440459.1_2 Forward -313 -296 9.87194 0.215
NP_440459.1_2 Reverse -10 -27 7.61033 0.285
NP_440010.1_10 Reverse -313 -332 9.93088 0.209
NP_440010.1_10 Forward -346 -327 4.03102 0.248
NP_440010.1_10 Forward -145 -126 1.67108 0.295
NP_442551.1_4 Forward -336 -321 -0.216765 0.245
NP_442603.1_7 Reverse -325 -339 22.025 0.00436
NP_442603.1_7 Forward -334 -320 16.5185 0.0304
NP_440449.1_6 Forward -342 -324 7.2832 0.227
NP_440449.1_6 Forward -50 -32 6.69963 0.241
NP_441358.1_2 Forward -262 -243 8.94757 0.246
NP_441833.1_4 Forward -333 -326 15.9687 0.0124
NP_441833.1_4 Reverse -326 -333 15.9687 0.0124
NP_441833.1_4 Forward -41 -34 15.9687 0.0124
NP_441833.1_4 Reverse -34 -41 15.9687 0.0124
NP_442162.1_9 Forward -333 -326 16.2637 0.0124
NP_442162.1_9 Reverse -326 -333 16.2637 0.0124
NP_442162.1_9 Forward -41 -34 16.2637 0.0124
NP_442162.1_9 Reverse -34 -41 16.2637 0.0124
NP_440671.1_4 Reverse -27 -41 5.50613 0.281
NP_442404.1_9 Forward -331 -317 18.7801 0.192
NP_440224.1_1 Forward -345 -326 1.96607 0.132
NP_442199.1_5 Forward -50 -31 7.47261 0.0719
NP_442140.1_3 Forward -333 -323 14.828 0.0433
NP_442140.1_3 Reverse -326 -336 13.5497 0.0542
NP_442140.1_3 Forward -41 -31 6.66654 0.159
NP_442140.1_3 Reverse -20 -30 5.09324 0.227
NP_442140.1_3 Reverse -34 -44 4.69992 0.238
NP_442723.1_1 Reverse -232 -251 22.123 0.0357
NP_440875.1_9 Reverse -35 -45 15.867 0.0233
NP_440875.1_9 Forward -40 -30 8.37203 0.233
NP_441813.1_5 Forward -44 -34 18.1713 0.00743
NP_441813.1_5 Reverse -323 -333 8.92815 0.0347
NP_441813.1_5 Forward -336 -326 8.73149 0.0367
NP_441813.1_5 Reverse -31 -41 8.63316 0.0367
NP_440594.1_8 Forward -333 -320 18.8982 0.0537
NP_441227.1_7 Forward -41 -22 11.4019 0.283
NP_441259.1_8 Forward -47 -28 14.6499 0.236
NP_440590.1_4 Reverse -326 -339 21.3571 0.00401
NP_440590.1_4 Forward -333 -320 5.23083 0.0585
NP_440590.1_4 Reverse -34 -47 2.87088 0.0788
NP_440590.1_4 Forward -41 -28 -5.29059 0.277
NP_440567.1_1 Reverse -326 -340 17.6008 0.0153
NP_440567.1_1 Forward -41 -27 9.63603 0.0422
NP_440567.1_1 Forward -333 -319 8.65272 0.0554
NP_440567.1_1 Reverse -34 -48 1.67122 0.196
NP_442497.1_10 Forward -333 -324 19.8626 0.00532
NP_442497.1_10 Forward -41 -32 17.601 0.00813
NP_442497.1_10 Reverse -34 -43 17.601 0.00813
NP_442497.1_10 Reverse -326 -335 10.4228 0.0087
NP_440821.1_4 Reverse -323 -333 19.5479 0.00399
NP_440821.1_4 Forward -336 -326 17.9746 0.00497
NP_440821.1_4 Reverse -31 -41 2.24165 0.131
NP_440821.1_4 Forward -44 -34 2.24165 0.131
NP_441239.1_9 Reverse -323 -335 14.4936 0.0272
NP_441239.1_9 Forward -44 -32 13.0187 0.0389
NP_441239.1_9 Reverse -31 -43 11.1504 0.0648
NP_441239.1_9 Forward -336 -324 10.6587 0.0742
NP_441239.1_9 Reverse -182 -194 4.66053 0.248
NP_441951.1_9 Forward -342 -323 4.32602 0.254
NP_441951.1_9 Forward -132 -113 1.47442 0.254
NP_441727.1_3 Reverse -318 -337 6.58763 0.244
NP_441892.1_1 Reverse -316 -333 2.39878 0.14
NP_441892.1_1 Forward -343 -326 -2.41943 0.221
NP_442044.1_1 Forward -339 -320 4.03102 0.131
NP_442044.1_1 Forward -42 -23 -7.4737 0.224
NP_442193.1_1 Reverse -310 -328 8.7706 0.261
NP_442270.1_9 Forward -345 -326 -8.85033 0.226
NP_442772.1_4 Forward -215 -196 -5.31042 0.295
NP_441874.1_1 Forward -255 -241 11.8976 0.24
NP_443012.1_7 Forward -274 -255 11.3075 0.277
NP_442216.1_4 Reverse -238 -246 8.08217 0.255
NP_440876.1_5 Forward -26 -7 5.40766 0.283
NP_443035.1_1 Reverse -24 -43 19.469 0.242
NP_440354.1_5 Forward -337 -318 18.7807 0.0721
NP_440500.1_1 Forward -30 -11 7.86593 0.266
NP_442052.1_3 Reverse -12 -31 13.2741 0.153
NP_440546.1_4 Reverse -33 -43 13.5365 0.0459
NP_440546.1_4 Forward -42 -32 13.5365 0.0459
NP_440546.1_4 Forward -334 -324 12.8578 0.0572
NP_440546.1_4 Reverse -325 -335 10.046 0.109
NP_441230.1_5 Forward -47 -28 3.93269 0.189
NP_440462.1_6 Forward -44 -34 18.7612 0.00454
NP_440462.1_6 Reverse -31 -41 10.5014 0.0396
NP_440462.1_6 Reverse -323 -333 10.4031 0.0396
NP_440462.1_6 Forward -336 -326 10.3048 0.0396
NP_440462.1_6 Reverse -251 -261 6.8632 0.0967
NP_442340.1_3 Reverse -327 -346 5.40766 0.113
NP_442340.1_3 Forward -26 -7 -6.49039 0.223
NP_440868.1_4 Reverse -29 -41 13.2153 0.022
NP_440868.1_4 Reverse -321 -333 12.3303 0.0242
NP_440868.1_4 Forward -338 -326 9.97041 0.0405
NP_440868.1_4 Forward -46 -34 7.80712 0.0637
NP_440868.1_4 Reverse -180 -192 -0.256015 0.255
NP_440868.1_8 Reverse -321 -340 -4.42544 0.263
NP_442499.1_1 Forward -333 -314 5.01433 0.226
NP_442499.1_1 Forward -339 -320 4.22769 0.244
NP_441582.1_5 Forward -382 -363 8.06178 0.164
NP_440270.1_6 Forward -262 -243 7.7676 0.282
NP_441868.1_4 Reverse -12 -26 13.1759 0.282
NP_441474.1_1 Reverse -165 -184 3.04693 0.244
NP_441474.1_1 Forward -329 -310 0.686995 0.255
NP_441474.1_1 Forward -132 -113 -1.67294 0.262
NP_442402.1_4 Forward -355 -336 -1.77127 0.194
NP_441848.1_7 Reverse -170 -189 18.3865 0.0531
NP_442258.1_2 Forward -82 -63 3.93269 0.0976
NP_441084.1_6 Reverse -341 -355 11.2833 0.208
NP_441084.1_6 Reverse -323 -337 9.15021 0.292
NP_440696.1_6 Reverse -313 -332 4.81767 0.285
NP_440696.1_9 Forward -260 -241 13.175 0.296
NP_442039.1_4 Forward -333 -326 15.1821 0.0124
NP_442039.1_4 Reverse -326 -333 15.1821 0.0124
NP_442039.1_4 Forward -41 -34 15.1821 0.0124
NP_442039.1_4 Reverse -34 -41 15.1821 0.0124
NP_441811.1_1 Forward -142 -123 9.93088 0.26
NP_441811.1_8 Reverse -319 -333 19.7641 0.0413
NP_441811.1_8 Forward -340 -326 6.98109 0.259
NP_441926.1_3 Reverse -33 -49 6.35172 0.17
NP_440825.1_6 Forward -259 -240 8.25926 0.285
NP_442837.1_3 Forward -333 -326 15.7721 0.0124
NP_442837.1_3 Reverse -326 -333 15.7721 0.0124
NP_442837.1_3 Forward -41 -34 15.7721 0.0124
NP_442837.1_3 Reverse -34 -41 15.7721 0.0124
NP_439994.1_3 Reverse -324 -343 17.5109 0.0645
NP_442053.1_1 Forward -334 -325 18.3876 0.0007
NP_442053.1_1 Reverse -325 -334 18.3876 0.0007
NP_442053.1_1 Forward -42 -33 18.3876 0.0007
NP_442053.1_1 Reverse -33 -42 18.3876 0.0007
NP_440505.1_3 Forward -44 -34 17.188 0.00332
NP_440505.1_3 Forward -336 -326 16.598 0.00683
NP_440505.1_3 Reverse -31 -41 8.04317 0.147
NP_440505.1_3 Reverse -323 -333 7.84651 0.147
NP_440505.1_3 Reverse -17 -27 6.37155 0.183
NP_441959.1_5 Forward -382 -363 7.17762 0.26
NP_441203.1_1 Reverse -326 -345 -19.5684 0.297
NP_440914.1_1 Reverse -325 -335 17.5935 0.000537
NP_440914.1_1 Forward -42 -32 16.3248 0.00196
NP_440914.1_1 Reverse -33 -43 16.3248 0.00196
NP_440914.1_1 Forward -334 -324 8.51751 0.186
NP_441011.1_8 Forward -41 -32 16.6177 0.00602
NP_441011.1_8 Reverse -34 -43 16.6177 0.00602
NP_441011.1_8 Forward -333 -324 14.356 0.0249
NP_441011.1_8 Reverse -326 -335 8.25953 0.144
NP_441011.1_8 Forward -261 -252 4.91628 0.296
NP_442101.1_10 Reverse -25 -44 -7.37537 0.211
NP_442533.1_6 Forward -334 -325 17.2076 0.00137
NP_442533.1_6 Reverse -325 -334 17.2076 0.00137
NP_442533.1_6 Forward -42 -33 17.2076 0.00137
NP_442533.1_6 Reverse -33 -42 17.2076 0.00137
NP_442533.1_6 Reverse -389 -398 3.24465 0.219
NP_442541.1_10 Forward -28 -14 2.8506 0.254
NP_440263.1_2 Forward -44 -25 11.7983 0.298
NP_440263.1_6 Forward -83 -64 15.3391 0.131
NP_442232.1_3 Reverse -317 -336 -5.60541 0.165
NP_442232.1_3 Forward -253 -234 -9.73531 0.257
NP_441482.1_7 Reverse -27 -41 -10.7185 0.213
NP_441482.1_7 Forward -268 -254 -11.8001 0.284
NP_441482.1_7 Forward -48 -34 -12.1934 0.29
NP_439944.1_9 Reverse -326 -336 19.1546 0.00329
NP_439944.1_9 Forward -333 -323 17.4829 0.00423
NP_439944.1_9 Forward -41 -31 9.12481 0.1
NP_439944.1_9 Reverse -34 -44 9.12481 0.1
NP_439944.1_10 Reverse -63 -82 13.1758 0.223
NP_441028.1_6 Forward -294 -284 6.0761 0.232
NP_441028.1_6 Forward -120 -110 5.19112 0.265
NP_441028.1_6 Forward -295 -285 3.42118 0.296
NP_442202.1_4 Forward -336 -322 16.0349 0.159
NP_440116.1_8 Forward -41 -22 -4.22878 0.164
NP_440115.1_6 Reverse -322 -332 18.2696 0.0139
NP_440115.1_6 Forward -337 -327 17.9746 0.0163
NP_440115.1_6 Reverse -30 -40 7.35486 0.147
NP_440115.1_6 Forward -34 -24 7.15819 0.158
NP_440115.1_6 Forward -45 -35 4.89658 0.28
NP_440007.1_4 Forward -53 -34 9.3409 0.274
NP_440007.1_9 Forward -46 -32 1.67122 0.285
NP_441680.1_4 Forward -320 -301 3.04771 0.224
NP_441059.1_2 Reverse -339 -358 0.0977854 0.242
NP_441059.1_2 Forward -262 -243 -8.06369 0.297
NP_440608.1_6 Reverse -326 -345 8.65176 0.238
NP_443045.1_2 Forward -340 -321 17.2074 0.181
NP_441602.1_3 Reverse -320 -339 3.04771 0.184
NP_441602.1_3 Forward -339 -320 -1.86883 0.231
NP_441972.1_5 Reverse -326 -345 8.16093 0.0748
NP_441106.1_1 Reverse -32 -41 18.486 0.0028
NP_441106.1_1 Forward -43 -34 18.486 0.0028
NP_441106.1_1 Reverse -324 -333 9.73449 0.0311
NP_441106.1_1 Forward -335 -326 9.63616 0.0311
NP_441106.1_1 Forward -263 -254 5.01461 0.191
NP_442306.1_10 Reverse -320 -339 -19.1751 0.197
NP_442306.1_10 Reverse -28 -47 -20.7484 0.226
NP_441286.1_1 Forward -335 -323 24.2284 0.000758
NP_441286.1_1 Reverse -324 -336 12.232 0.00999
NP_441286.1_1 Forward -43 -31 -3.50094 0.145
NP_441286.1_1 Reverse -32 -44 -3.50094 0.145
NP_440670.1_8 Forward -334 -325 18.3876 0.000699
NP_440670.1_8 Reverse -325 -334 18.3876 0.000699
NP_440670.1_8 Forward -42 -33 18.3876 0.000699
NP_440670.1_8 Reverse -33 -42 18.3876 0.000699
NP_441705.1_3 Reverse -110 -129 -6.49039 0.291
NP_440886.1_7 Reverse -324 -334 8.04271 0.0805
NP_440886.1_7 Forward -43 -33 8.04271 0.0805
NP_440886.1_7 Reverse -32 -42 8.04271 0.0805
NP_440886.1_7 Forward -335 -325 7.94438 0.0805
NP_440886.1_8 Reverse -364 -382 16.7346 0.261
NP_440828.1_1 Forward -26 -7 2.35861 0.231
NP_440828.1_1 Reverse -327 -346 -0.591301 0.274
NP_442614.1_2 Forward -334 -320 16.8142 0.0658
NP_442614.1_2 Forward -42 -28 7.47274 0.273
NP_442614.1_2 Reverse -325 -339 6.48943 0.291
NP_442072.1_9 Reverse -324 -342 -11.3872 0.0789
NP_442072.1_9 Reverse -25 -43 -15.4188 0.18
NP_442072.1_9 Forward -335 -317 -20.6304 0.204
NP_442072.1_9 Reverse -32 -50 -20.7287 0.204
NP_440513.1_6 Forward -52 -33 10.9134 0.222
NP_440223.1_7 Reverse -283 -297 13.5693 0.218
NP_442022.1_4 Reverse -310 -329 8.45592 0.268
NP_440907.2_8 Forward -333 -323 19.449 0.00351
NP_440907.2_8 Forward -41 -31 15.9091 0.0161
NP_440907.2_8 Reverse -326 -336 10.8943 0.0969
NP_440907.2_8 Reverse -34 -44 9.616 0.103
NP_442264.1_2 Reverse -315 -332 14.0018 0.135
NP_442264.1_2 Reverse -321 -338 10.8552 0.185
NP_441021.1_1 Reverse -326 -345 -2.16383 0.133
NP_441021.1_1 Forward -27 -8 -12.2919 0.283
NP_440841.1_4 Reverse -31 -50 -6.88371 0.215
NP_441463.1_3 Reverse -211 -230 -1.96717 0.147
NP_441463.1_3 Reverse -315 -334 -7.57203 0.259
NP_441463.1_6 Forward -336 -322 7.09237 0.265
NP_441626.1_2 Forward -333 -326 15.7721 0.0124
NP_441626.1_2 Reverse -326 -333 15.7721 0.0124
NP_441626.1_2 Forward -41 -34 15.7721 0.0124
NP_441626.1_2 Reverse -34 -41 15.7721 0.0124
NP_442365.1_5 Forward -333 -314 22.2223 0.0159
NP_442365.1_7 Reverse -321 -340 -6.09707 0.285
NP_442794.1_1 Forward -338 -326 3.48056 0.286
NP_442794.1_1 Reverse -29 -41 2.79224 0.286
NP_442615.1_1 Reverse -24 -42 14.6705 0.00938
NP_442615.1_1 Reverse -316 -334 13.6872 0.0112
NP_442615.1_1 Forward -51 -33 5.13236 0.0406
NP_442615.1_1 Forward -343 -325 -3.52077 0.163
NP_441962.1_4 Forward -339 -320 -3.83545 0.152
NP_441962.1_4 Reverse -320 -339 -11.8003 0.245
NP_441962.1_4 Reverse -70 -89 -12.8819 0.265
NP_441962.1_4 Reverse -14 -33 -13.4719 0.273
NP_440387.1_1 Forward -42 -26 7.33503 0.0282
NP_440387.1_1 Reverse -325 -341 6.25339 0.0282
NP_440387.1_1 Forward -334 -318 -1.41643 0.142
NP_441431.1_2 Reverse -322 -336 14.5519 0.0636
NP_441431.1_2 Forward -45 -31 14.1586 0.0714
NP_441431.1_2 Forward -337 -323 8.06211 0.226
NP_441431.1_2 Forward -261 -247 5.80051 0.288
NP_441488.1_7 Reverse -319 -338 17.994 0.0543
NP_441488.1_8 Reverse -297 -311 8.45543 0.19
NP_441836.1_2 Reverse -319 -338 6.68596 0.112
NP_440814.1_4 Reverse -316 -335 -3.24547 0.144
NP_440467.1_3 Forward -83 -64 10.7679 0.296
NP_440467.1_8 Reverse -127 -146 16.6174 0.0964
NP_440467.1_8 Forward -205 -186 11.1109 0.249
NP_440114.1_10 Reverse -33 -47 19.3708 0.00349
NP_440114.1_10 Forward -398 -384 15.7325 0.0234
NP_440114.1_10 Forward -334 -320 12.9793 0.0681
NP_440114.1_10 Forward -42 -28 6.58777 0.263
NP_442323.1_7 Forward -339 -320 7.76679 0.172
NP_441500.1_8 Reverse -212 -226 14.05 0.297
NP_440293.1_3 Forward -80 -61 -4.22878 0.26
NP_440766.1_4 Forward -338 -324 14.8476 0.0283
NP_440766.1_4 Reverse -327 -341 2.2612 0.191
NP_441237.1_9 Forward -333 -323 17.2863 0.00348
NP_441237.1_9 Reverse -326 -336 14.9263 0.0242
NP_442743.1_4 Reverse -326 -345 4.12936 0.139
NP_441311.1_2 Reverse -169 -183 12.5853 0.23
NP_440643.1_6 Forward -83 -64 1.17943 0.274
NP_439910.1_2 Reverse -49 -66 -13.2358 0.153
NP_439910.1_2 Forward -50 -33 -22.2823 0.22
NP_440457.1_1 Reverse -321 -333 9.97041 0.092
NP_440457.1_1 Forward -338 -326 7.21714 0.105
NP_440457.1_1 Reverse -29 -41 2.20226 0.216
NP_440457.1_1 Forward -46 -34 -0.551008 0.268
NP_442940.1_2 Forward -334 -315 19.6656 0.0816
NP_440798.1_6 Forward -41 -28 10.2457 0.0785
NP_440798.1_6 Reverse -326 -339 4.64084 0.144
NP_440798.1_6 Reverse -34 -47 3.26421 0.151
NP_440798.1_6 Forward -333 -320 3.06754 0.153
NP_442680.1_5 Reverse -127 -146 11.8928 0.124
NP_440801.1_9 Reverse -150 -164 15.1623 0.227
NP_442561.1_9 Reverse -326 -345 17.3048 0.252
NP_441984.1_3 Forward -204 -186 8.86894 0.218
NP_441984.1_3 Reverse -321 -339 7.78729 0.239
NP_441984.1_3 Reverse -53 -71 6.70565 0.267
NP_441436.1_2 Reverse -353 -372 0.294447 0.277
NP_440473.1_9 Reverse -314 -333 -5.99873 0.222
NP_442509.1_9 Forward -334 -324 17.3841 0.00128
NP_442509.1_9 Reverse -371 -381 12.5659 0.0871
NP_442509.1_9 Reverse -325 -335 8.14104 0.192
NP_442509.1_9 Reverse -33 -43 8.04271 0.192
NP_442509.1_9 Forward -42 -32 8.04271 0.192
NP_442514.1_5 Reverse -240 -259 -6.49113 0.267
NP_440554.1_4 Reverse -34 -44 17.9746 0.0131
NP_440554.1_4 Forward -41 -31 8.82982 0.0646
NP_440554.1_4 Reverse -326 -336 6.37155 0.123
NP_440554.1_4 Forward -333 -323 6.27322 0.123
NP_440554.1_4 Reverse -390 -400 2.43831 0.265
NP_441885.1_5 Reverse -325 -335 20.9245 0.000538
NP_441885.1_5 Forward -334 -324 11.3864 0.00668
NP_441885.1_5 Forward -42 -32 11.3864 0.00668
NP_441885.1_5 Reverse -33 -43 11.3864 0.00668
NP_440478.1_4 Reverse -270 -289 9.83255 0.299
NP_441428.1_8 Reverse -317 -336 6.19431 0.226
NP_442341.1_7 Reverse -324 -338 17.6992 0.0111
NP_442341.1_7 Forward -335 -321 14.9459 0.0256
NP_442341.1_9 Forward -44 -30 19.6651 0.00907
NP_442341.1_9 Reverse -31 -45 7.3738 0.2
NP_441173.1_9 Forward -373 -365 11.3271 0.226
NP_440409.1_1 Forward -342 -323 10.9142 0.13
NP_443000.1_3 Forward -112 -93 14.1404 0.228
NP_443000.1_3 Forward -319 -300 11.1347 0.255
NP_443000.1_7 Forward -44 -34 20.3345 0.00223
NP_443000.1_7 Reverse -31 -41 10.6981 0.0345
NP_443000.1_7 Forward -336 -326 10.4031 0.0345
NP_443000.1_7 Reverse -323 -333 2.14332 0.226
NP_443000.1_7 Reverse -251 -261 0.865012 0.285
NP_441842.1_1 Forward -332 -319 19.4882 0.0142
NP_441842.1_1 Reverse -327 -340 15.9483 0.0521
NP_441842.1_1 Forward -378 -365 12.8017 0.185
NP_441842.1_3 Reverse -305 -323 14.2771 0.265
NP_441842.1_10 Forward -341 -327 17.7975 0.0203
NP_441842.1_10 Forward -73 -59 7.9644 0.238
NP_441842.1_10 Forward -49 -35 6.88276 0.271
NP_440275.1_3 Reverse -323 -333 19.5479 0.00756
NP_440275.1_3 Forward -336 -326 17.6796 0.0102
NP_440275.1_3 Forward -44 -34 16.1063 0.0155
NP_440275.1_3 Reverse -31 -41 9.02648 0.0563
NP_440091.1_1 Forward -338 -326 8.29878 0.0653
NP_440091.1_1 Forward -46 -34 1.41561 0.197
NP_440091.1_1 Reverse -321 -333 0.825626 0.227
NP_443010.1_10 Forward -337 -320 14.1736 0.0612
NP_442451.1_2 Forward -342 -323 17.8957 0.0317
NP_441122.1_1 Forward -219 -204 2.73316 0.298
NP_439962.1_4 Forward -342 -323 0.884433 0.197
NP_439962.1_4 Forward -290 -271 -2.16383 0.224
NP_439962.1_4 Reverse -323 -342 -8.65367 0.298
NP_440175.1_4 Reverse -323 -342 -12.9802 0.238
NP_442495.1_4 Forward -194 -184 11.0914 0.29
NP_440149.1_8 Reverse -325 -344 5.211 0.076
NP_441105.1_3 Forward -53 -34 -2.85214 0.169
NP_441105.1_3 Reverse -314 -333 -3.83545 0.185
NP_440216.1_1 Reverse -33 -47 25.664 0.000481
NP_440216.1_1 Forward -42 -28 6.78443 0.0124
NP_440216.1_1 Reverse -325 -339 0.392915 0.0284
NP_440216.1_1 Forward -334 -320 -1.18038 0.0301
NP_440216.1_9 Reverse -111 -120 6.29291 0.289
NP_440172.1_1 Forward -42 -32 17.5813 0.00421
NP_440172.1_1 Reverse -33 -43 17.5813 0.00421
NP_440172.1_1 Forward -334 -324 16.303 0.00854
NP_440172.1_1 Reverse -325 -335 15.0247 0.00945
NP_440172.1_1 Reverse -389 -399 4.20827 0.2
NP_440167.1_3 Forward -344 -325 11.0125 0.231
NP_442015.1_10 Forward -338 -325 12.6056 0.0365
NP_442015.1_10 Reverse -321 -334 3.65753 0.178
NP_442015.1_10 Reverse -29 -42 2.47756 0.191
NP_441226.1_7 Forward -333 -326 14.4934 0.0123
NP_441226.1_7 Reverse -326 -333 14.4934 0.0123
NP_441226.1_7 Forward -41 -34 14.4934 0.0123
NP_441226.1_7 Reverse -34 -41 14.4934 0.0123
NP_441226.1_7 Reverse -303 -310 9.47853 0.147
NP_441111.1_7 Forward -333 -325 18.7023 0.00294
NP_441111.1_7 Forward -41 -33 18.7023 0.00294
NP_441111.1_7 Reverse -326 -334 18.7023 0.00294
NP_441111.1_7 Reverse -34 -42 18.7023 0.00294
NP_442379.1_10 Forward -341 -324 8.20031 0.102
NP_441766.1_2 Forward -334 -325 17.5026 0.00297
NP_441766.1_2 Reverse -325 -334 17.5026 0.00297
NP_441766.1_2 Forward -42 -33 17.5026 0.00297
NP_441766.1_2 Reverse -33 -42 17.5026 0.00297
NP_440416.1_1 Reverse -33 -52 -11.6036 0.272
NP_440416.1_9 Forward -341 -322 -5.80207 0.083
NP_440416.1_9 Forward -144 -125 -16.6185 0.218
NP_443052.1_8 Forward -344 -325 -5.70374 0.134
NP_443052.1_8 Reverse -315 -334 -7.37537 0.158
NP_441135.1_5 Reverse -359 -378 11.1109 0.177
NP_440261.1_5 Forward -333 -320 24.1104 0.00402
NP_440261.1_5 Reverse -326 -339 6.80412 0.0316
NP_440261.1_5 Reverse -34 -47 -2.83231 0.0932
NP_440261.1_5 Forward -41 -28 -3.02898 0.108
NP_440988.1_10 Reverse -323 -337 10.514 0.187
NP_440988.1_10 Forward -336 -322 10.4172 0.187
NP_440988.1_10 Reverse -240 -254 6.2542 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAAGCAATGGGCCGTACTACGGGGATCTTCCCCCAACAGTAGCCCTTCGATAATGGTTTCCCCGGTGGCGATCGCCCCCAACATCAAGGCCCGATGGGAAATGGATTTATCCCCCGGCACCCTTAGGCGGCCAGTCAAAGCGACCCCTTGGGCAGGGGGATTAACAGTTAAGCGTTGATGGGATTGATGATTGTTGAGGGAAAGCAAGGCCATGGAGGGGACAAATTAGGGGCAGGGAAGACCAAGCTAAATTGTATTGGCATTTCTGCCCCCCGCCAAATTTTCCTCGGTTAGTCAAGGAAGTAAAAAACATCGTTACCATGGTCAGTGGAAGGGCGACAGTTTGTTAATTTCAACAGGCGATCGCCTAGCAACCATTGCCAGACCAGAGGCCAAACCA

CDS

ATGAAATACCATTATTCCCCATGGAAATTAGTTCTGCTTGCCGGCACCGCTTTTGTGCTCGGGACCCCTACTACCGTTACAGCCCAATCCTATAACCCAGTGGAACCTTTCCCAGAAGACTTACCGGCCACGGGCAATATCAACGACCTCGATGGCCTCCAGGAACGTCAAGTGGAAGATTGGTTCCCCCAACAAAATATGGGGACTAATTCCCAAACCCTATTGGAAATTAACACTACCAATACCCCTCCCCTCAGTATCAATGACCGTAGTAGCCAGATCAAAGAAGAAAATGATTGGCAACGCAGTTCTTCGGGGGAACCCAAACAAACAGGTTCCGGTTTTCCCCTGGGTACTTTTTAG

Protein

MKYHYSPWKLVLLAGTAFVLGTPTTVTAQSYNPVEPFPEDLPATGNINDLDGLQERQVEDWFPQQNMGTNSQTLLEINTTNTPPLSINDRSSQIKEENDWQRSSSGEPKQTGSGFPLGTF