Your browser is old and dusty. Try Google Chrome!

Details for sll0423

ORF sll0423
Accession NP_441801.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -252 -238 -0.688726 0.237
NP_440795.1_7 Reverse -46 -53 7.51227 0.24
NP_441453.1_4 Forward -252 -244 5.23096 0.157
NP_442151.1_6 Reverse -96 -110 5.40779 0.278
NP_442655.1_1 Reverse -219 -238 -1.47551 0.272
NP_442173.1_1 Reverse -244 -252 8.86921 0.0882
NP_442173.1_1 Reverse -259 -267 7.8859 0.134
NP_443027.1_4 Reverse -43 -53 6.66654 0.274
NP_441200.1_4 Reverse -105 -124 11.5042 0.172
NP_442276.1_2 Reverse -92 -111 10.6192 0.273
NP_441083.1_5 Reverse -24 -34 0.373358 0.231
NP_441434.1_1 Forward -160 -146 9.56081 0.24
NP_441434.1_1 Reverse -146 -160 7.17351 0.288
NP_441387.1_8 Forward -161 -142 13.7982 0.26
NP_441209.1_8 Reverse -139 -157 10.1838 0.217
NP_441130.1_7 Forward -59 -45 15.1419 0.287
NP_441265.1_1 Forward -284 -265 -8.45701 0.155
NP_440403.1_4 Reverse -123 -142 -8.55534 0.257
NP_440842.1_10 Forward -116 -102 5.1128 0.251
NP_441014.1_8 Reverse -91 -110 7.66927 0.158
NP_441014.1_8 Forward -105 -86 -9.047 0.289
NP_440376.1_1 Reverse -132 -141 1.1797 0.255
NP_441077.1_6 Forward -161 -145 6.17611 0.244
NP_441077.1_6 Forward -383 -367 4.82641 0.255
NP_440642.1_10 Forward -23 -9 1.96562 0.284
NP_440642.1_10 Forward -28 -14 1.76896 0.289
NP_441080.1_7 Forward -160 -142 23.4211 0.0154
NP_442782.1_2 Forward -252 -238 1.76955 0.281
NP_441414.1_9 Reverse -104 -123 -8.06369 0.229
NP_441487.1_9 Reverse -242 -261 7.96426 0.114
NP_441317.1_4 Reverse -354 -368 10.1324 0.29
NP_441958.1_5 Forward -253 -243 0.57002 0.139
NP_441958.1_5 Reverse -242 -252 -0.904945 0.222
NP_441127.1_1 Reverse -104 -118 16.4209 0.1
NP_440450.1_10 Forward -162 -143 12.4613 0.234
NP_440203.1_5 Forward -337 -327 11.6809 0.182
NP_440269.1_2 Reverse -14 -28 19.1741 0.201
NP_442816.1_7 Reverse -367 -386 7.49569 0.238
NP_442816.1_7 Reverse -379 -398 4.91741 0.26
NP_439990.1_8 Forward -174 -155 -0.4922 0.283
NP_440858.1_1 Reverse -70 -89 -6.49039 0.298
NP_443044.1_1 Forward -349 -330 4.62101 0.279
NP_441348.1_3 Forward -110 -91 7.57094 0.256
NP_440484.1_6 Reverse -265 -284 17.5024 0.0409
NP_441674.1_10 Reverse -89 -107 -0.865831 0.29
NP_441550.1_8 Forward -254 -244 5.28945 0.255
NP_441916.1_7 Forward -252 -242 3.71661 0.203
NP_442996.1_1 Forward -162 -143 18.7637 0.095
NP_442941.1_3 Reverse -244 -254 0.0783647 0.231
NP_440260.1_7 Reverse -107 -126 -1.86883 0.241
NP_441514.1_6 Reverse -329 -336 12.8221 0.252
NP_442281.1_1 Forward -272 -258 1.76896 0.29
NP_441079.1_7 Forward -162 -143 17.2065 0.037
NP_441079.1_7 Reverse -143 -162 -3.73788 0.238
NP_001035871.2_7 Reverse -166 -176 12.0747 0.272
NP_442012.1_5 Reverse -231 -250 7.07928 0.252
NP_441087.1_6 Reverse -75 -93 -0.0799167 0.258
NP_441087.1_6 Reverse -90 -108 -3.71814 0.296
NP_441556.1_10 Forward -59 -45 9.44312 0.298
NP_441644.1_6 Reverse -243 -253 4.40448 0.239
NP_440652.1_1 Forward -327 -308 3.44104 0.298
NP_442215.1_2 Reverse -87 -103 0.648521 0.148
NP_442215.1_2 Forward -301 -285 -7.61128 0.3
NP_442247.1_8 Forward -254 -240 13.2743 0.247
NP_442933.1_2 Forward -380 -362 9.64667 0.257
NP_442933.1_2 Forward -368 -350 6.59093 0.269
NP_442933.1_2 Forward -374 -356 6.01798 0.279
NP_442554.1_8 Reverse -244 -254 5.48657 0.146
NP_442970.1_3 Reverse -363 -381 15.9721 0.156
NP_441762.1_7 Forward -234 -222 -6.5492 0.284
NP_442292.1_5 Reverse -213 -232 0.0977854 0.257
NP_440122.1_2 Forward -107 -88 -1.08219 0.286
NP_441264.1_3 Forward -284 -265 -2.45882 0.293
NP_442406.1_9 Reverse -89 -108 -0.000545616 0.291
NP_441865.1_3 Reverse -353 -371 15.0638 0.235
NP_440379.1_8 Forward -99 -80 12.1925 0.249
NP_441673.1_1 Reverse -243 -252 -8.06341 0.254
NP_441731.1_3 Reverse -88 -107 1.67108 0.215
NP_441876.1_9 Reverse -119 -129 12.9592 0.267
NP_441637.1_8 Forward -96 -79 14.9851 0.197
NP_441637.1_9 Forward -131 -113 -4.40575 0.296
NP_442868.1_6 Forward -254 -244 1.16001 0.205
NP_442719.1_2 Forward -186 -168 -11.8796 0.297
NP_441911.1_10 Forward -375 -356 8.36618 0.257
NP_441101.1_4 Reverse -351 -370 13.8641 0.15
NP_442903.1_2 Forward -390 -371 10.265 0.165
NP_440342.1_1 Reverse -8 -27 12.1925 0.263
NP_440558.1_2 Forward -127 -108 -4.91709 0.249
NP_440111.2_4 Reverse -85 -104 12.5858 0.175
NP_441878.1_6 Reverse -103 -113 0.0783647 0.152
NP_441878.1_6 Reverse -132 -142 -7.88644 0.278
NP_441036.1_8 Reverse -242 -252 5.38824 0.287
NP_441557.1_5 Forward -252 -243 -0.68859 0.229
NP_440084.1_8 Forward -158 -144 13.5715 0.223
NP_441739.1_2 Reverse -114 -130 2.22115 0.288
NP_441458.1_8 Reverse -143 -162 7.77039 0.229
NP_440440.1_10 Forward -104 -90 13.8643 0.265
NP_442347.1_2 Forward -117 -108 4.52295 0.282
NP_440899.1_8 Reverse -343 -362 -7.17871 0.244
NP_441449.1_8 Forward -365 -346 15.0503 0.21
NP_440456.1_7 Forward -128 -114 12.0943 0.281
NP_440915.1_6 Reverse -239 -253 0.392915 0.165
NP_441866.1_6 Forward -56 -37 10.2251 0.224
NP_442993.1_1 Reverse -244 -260 -1.90808 0.103
NP_442993.1_1 Reverse -243 -259 -11.4462 0.247
NP_441340.1_5 Reverse -97 -104 8.8889 0.084
NP_441340.1_5 Reverse -244 -251 4.07068 0.239
NP_440168.1_9 Forward -124 -105 -5.80207 0.296
NP_441134.1_10 Reverse -94 -112 22.0453 0.0424
NP_443051.1_1 Forward -253 -244 0.196389 0.213
NP_440408.1_7 Reverse -45 -64 7.47261 0.288
NP_440439.1_1 Forward -255 -242 2.37923 0.135
NP_440372.1_2 Reverse -244 -251 4.36568 0.205
NP_440819.1_5 Forward -352 -344 7.98423 0.228
NP_440316.1_10 Reverse -103 -113 8.73149 0.239
NP_442488.1_4 Reverse -121 -140 9.0459 0.297
NP_440693.1_8 Reverse -127 -146 11.3075 0.283
NP_442123.1_3 Forward -226 -207 12.6841 0.196
NP_440189.1_10 Forward -29 -10 2.75272 0.289
NP_440297.1_9 Forward -112 -102 -0.118297 0.282
NP_440350.1_1 Reverse -116 -135 -0.295539 0.228
NP_440350.1_5 Reverse -343 -362 -3.14714 0.255
NP_442277.1_7 Forward -371 -355 8.02812 0.196
NP_442277.1_7 Forward -164 -148 -0.279674 0.221
NP_440575.1_1 Forward -30 -11 -2.45958 0.294
NP_442710.1_7 Forward -161 -142 -7.89551 0.299
NP_441548.1_1 Forward -90 -71 17.5024 0.0684
NP_441548.1_1 Forward -132 -113 11.5042 0.289
NP_441462.1_2 Forward -252 -242 7.84651 0.0498
NP_441462.1_2 Reverse -243 -253 -0.708283 0.245
NP_443062.1_4 Reverse -272 -291 20.1573 0.217
NP_440936.1_10 Reverse -372 -391 1.76618 0.241
NP_440255.1_3 Reverse -154 -164 14.6315 0.298
NP_440255.1_9 Forward -399 -380 16.3764 0.219
NP_440454.1_2 Forward -322 -308 15.1948 0.188
NP_442823.1_8 Reverse -79 -98 12.9791 0.259
NP_440314.1_9 Forward -347 -328 -8.752 0.253
NP_441733.1_10 Reverse -128 -141 7.29578 0.156
NP_442813.1_4 Reverse -345 -364 -7.96535 0.299
NP_441851.1_9 Reverse -6 -25 8.84924 0.257
NP_441542.1_4 Forward -128 -114 4.52282 0.264
NP_441273.1_8 Forward -99 -80 -1.18052 0.214
NP_442515.1_1 Reverse -131 -145 0.491246 0.19
NP_441409.1_8 Forward -373 -354 7.78774 0.277
NP_442843.1_1 Forward -130 -111 -9.53865 0.266
NP_440431.1_2 Forward -133 -114 14.9458 0.0281
NP_440431.1_3 Forward -174 -155 11.0125 0.0495
NP_440588.1_2 Reverse -87 -106 -3.54046 0.189
NP_442006.1_2 Forward -114 -97 -17.3657 0.274
NP_440483.1_1 Forward -105 -86 0.0977854 0.199
NP_440793.1_1 Forward -30 -16 10.0287 0.293
NP_441432.1_9 Reverse -370 -383 14.5127 0.143
NP_441432.1_9 Reverse -148 -161 10.3436 0.252
NP_441432.1_9 Reverse -356 -369 9.18011 0.28
NP_441732.1_5 Reverse -268 -282 12.4876 0.192
NP_440629.1_1 Forward -386 -368 5.82068 0.158
NP_442797.1_9 Forward -177 -159 8.96727 0.265
NP_441659.2_8 Forward -252 -242 3.61828 0.154
NP_441659.2_8 Reverse -243 -253 -0.314959 0.298
NP_441040.1_2 Reverse -88 -107 -14.6519 0.286
NP_440779.1_5 Reverse -96 -113 -14.4158 0.246
NP_440352.1_5 Reverse -100 -119 11.3903 0.261
NP_440025.1_3 Reverse -336 -350 10.3203 0.29
NP_440831.1_3 Forward -108 -89 5.80468 0.28
NP_441786.1_10 Forward -306 -287 9.53756 0.222
NP_441126.1_1 Reverse -1 -20 13.4409 0.223
NP_443040.1_1 Forward -394 -380 9.70076 0.299
NP_441329.1_6 Forward -372 -353 13.7982 0.106
NP_441329.1_6 Forward -386 -367 10.7424 0.109
NP_441329.1_6 Forward -384 -365 5.20389 0.191
NP_441329.1_6 Forward -374 -355 5.20389 0.191
NP_441329.1_6 Forward -396 -377 3.19856 0.217
NP_441329.1_6 Forward -360 -341 -3.29489 0.3
NP_442162.1_9 Reverse -259 -266 5.93897 0.214
NP_442162.1_9 Reverse -244 -251 3.4807 0.246
NP_442162.1_9 Forward -251 -244 3.38237 0.276
NP_441813.1_5 Forward -254 -244 5.48657 0.123
NP_440590.1_4 Reverse -244 -257 -4.9956 0.272
NP_441239.1_9 Forward -115 -103 8.9871 0.117
NP_440604.1_6 Forward -85 -66 -1.67217 0.204
NP_442643.1_1 Reverse -237 -256 -1.86883 0.143
NP_441541.1_1 Reverse -150 -168 -4.48614 0.277
NP_441526.1_8 Reverse -92 -111 -2.75381 0.277
NP_440462.1_6 Forward -254 -244 6.27322 0.121
NP_442402.1_4 Forward -62 -43 -9.14605 0.285
NP_441848.1_4 Forward -381 -365 8.60108 0.288
NP_441848.1_7 Reverse -81 -100 2.85027 0.219
NP_439942.1_7 Reverse -276 -295 4.32602 0.167
NP_442039.1_7 Reverse -106 -116 11.8781 0.257
NP_442039.1_7 Reverse -128 -138 8.33817 0.263
NP_442273.1_4 Forward -96 -77 16.5191 0.12
NP_442679.1_1 Forward -364 -345 3.04771 0.158
NP_442679.1_1 Forward -365 -346 -5.9004 0.298
NP_442786.1_5 Forward -141 -122 8.16093 0.262
NP_440160.1_2 Forward -125 -106 -7.67036 0.286
NP_440160.1_7 Reverse -79 -98 13.9625 0.223
NP_440505.1_3 Reverse -130 -140 4.79825 0.266
NP_440505.1_7 Forward -61 -42 0.491109 0.259
NP_440520.1_1 Forward -109 -90 2.3594 0.208
NP_440914.1_1 Reverse -45 -55 8.12715 0.207
NP_442533.1_6 Forward -252 -243 2.85133 0.236
NP_442533.1_6 Forward -141 -132 1.67135 0.293
NP_441482.1_7 Reverse -325 -339 -11.8985 0.286
NP_441697.1_5 Reverse -143 -162 7.49569 0.155
NP_441697.1_5 Forward -162 -143 -3.1994 0.217
NP_441697.1_5 Forward -163 -144 -9.2154 0.268
NP_441697.1_5 Reverse -144 -163 -9.40638 0.268
NP_441749.1_7 Reverse -74 -93 9.63589 0.25
NP_441028.1_6 Reverse -343 -353 5.48612 0.255
NP_441527.1_4 Forward -384 -365 1.4797 0.133
NP_441527.1_4 Forward -373 -354 0.90675 0.134
NP_441527.1_4 Forward -382 -363 -1.09858 0.146
NP_441527.1_4 Forward -383 -364 -3.29489 0.164
NP_441527.1_4 Forward -357 -338 -7.974 0.24
NP_441527.1_4 Forward -386 -367 -8.73794 0.25
NP_441527.1_4 Forward -372 -353 -9.78835 0.262
NP_441527.1_4 Forward -393 -374 -10.5523 0.272
NP_441527.1_4 Forward -356 -337 -11.0297 0.278
NP_441527.1_4 Forward -374 -355 -11.9847 0.285
NP_441527.1_4 Forward -359 -340 -12.2711 0.285
NP_440007.1_7 Forward -247 -228 4.52268 0.278
NP_441106.1_1 Forward -253 -244 6.09625 0.101
NP_442306.1_10 Forward -257 -238 -21.4367 0.27
NP_442674.1_3 Reverse -282 -301 3.83357 0.294
NP_442614.1_2 Reverse -45 -59 9.63603 0.242
NP_442614.1_2 Forward -351 -337 7.07942 0.275
NP_440404.1_9 Forward -351 -332 15.899 0.142
NP_442401.1_2 Reverse -123 -142 7.76679 0.255
NP_441753.1_10 Forward -100 -81 1.67108 0.257
NP_440030.1_3 Forward -103 -84 9.63589 0.0344
NP_441463.1_2 Reverse -365 -383 3.54228 0.198
NP_440814.1_8 Reverse -12 -31 3.34271 0.269
NP_440114.1_10 Reverse -258 -272 7.66941 0.229
NP_440114.1_10 Reverse -243 -257 7.47274 0.235
NP_441500.1_2 Reverse -162 -181 11.6025 0.292
NP_439988.1_3 Reverse -92 -106 5.99778 0.278
NP_439988.1_3 Forward -136 -122 5.1128 0.289
NP_439988.1_3 Forward -104 -90 4.91614 0.292
NP_441246.1_7 Reverse -133 -152 6.98095 0.199
NP_442867.1_8 Forward -140 -121 5.60432 0.276
NP_440457.1_1 Reverse -239 -251 9.87208 0.092
NP_441801.1_1 Forward -261 -242 40.8068 0.00000126
NP_441801.1_2 Forward -282 -263 39.9218 0.00000228
NP_441801.1_3 Forward -241 -222 38.2502 0.00000415
NP_441801.1_4 Forward -295 -285 20.9245 0.142
NP_441801.1_5 Forward -213 -194 23.598 0.00955
NP_441801.1_6 Forward -181 -162 23.598 0.0185
NP_441436.1_8 Forward -100 -81 9.83255 0.262
NP_442509.1_9 Reverse -131 -141 6.46942 0.268
NP_442582.1_2 Reverse -231 -250 29.6954 0.0000627
NP_442582.1_5 Reverse -252 -266 26.4506 0.00859
NP_440478.1_4 Reverse -94 -113 10.7175 0.267
NP_442703.1_1 Forward -387 -368 5.96782 0.276
NP_442703.1_9 Forward -385 -367 3.95239 0.266
NP_441173.1_9 Forward -183 -175 10.6388 0.261
NP_441173.1_9 Reverse -344 -352 9.75379 0.284
NP_440409.1_2 Reverse -121 -140 9.53756 0.242
NP_443000.1_7 Forward -254 -244 0.963343 0.278
NP_440275.1_3 Forward -254 -244 5.48657 0.145
NP_442275.1_1 Reverse -87 -106 0.687771 0.285
NP_441635.1_1 Reverse -144 -163 4.15348 0.275
NP_441635.1_2 Forward -375 -356 12.8432 0.241
NP_439962.1_4 Forward -141 -122 -5.9004 0.28
NP_439962.1_4 Forward -113 -94 -6.09707 0.28
NP_439962.1_4 Reverse -88 -107 -7.4737 0.289
NP_440172.1_1 Forward -252 -242 6.07655 0.115
NP_441226.1_7 Reverse -244 -251 10.0685 0.103
NP_441111.1_7 Reverse -244 -252 -0.472234 0.131
NP_441766.1_2 Forward -252 -243 4.81794 0.158
NP_440416.1_1 Reverse -243 -262 7.86593 0.0584
NP_440416.1_9 Forward -61 -42 -11.1119 0.148
NP_440416.1_9 Reverse -89 -108 -17.0118 0.229
NP_443052.1_9 Forward -251 -232 -6.29373 0.281
NP_442564.1_10 Reverse -114 -128 8.55439 0.296
NP_440261.1_7 Forward -132 -113 -5.99873 0.256
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCAATATTAAAACTGCAAAAAACAGTTAAAAAAATACAGACAAAAACACGGGGAAAATAAACAGATTCCCCTGGTTTCTAACCGTAAAAAACATCCGAGTTTTAGAACTCCCCGGGTAGGATTCGAACCTACGACCAATCGGTTAACAGCCGACCGCTCTACCACTGAGCTACCGAGGATTGACTCAACGATTCAACATCATAGCAACTAAAAGATCTTTTACACAAGCCCCTTGCTAAAAAAATTACTAAATTCTTAGGCCGGTTCCCAGCTTGGGGCCAATTTGCTCCCAGGGCCCTATGGCAGGGGGCCAATGTTGACCGTTATGCTGAAACAGAATCCTGTTTGTCATCCCCTGGATAGATAGGCTGATTTGCTTTTCCTCACCCGTCAAGTTTTT

CDS

ATGTTGACCCACCACCGTCGTCCGGTTTGCCTATCGCTCATTTCCACCGATTTGCCCATTCTTTCCACCCTGGAGACCGCCGCTACCCTCTACCAAAAGGATTTGCATCGCTTTCACCTCCTACTCCACCAAGAACAGGAGCAAGTTCCCAACGGCGATCAACAGGTATTACCCTCCTCTCAACTATTGTGGTTAGAACTGTCTCCCCGACGCATTGTGCTGACTCGCCAGGGTAATAGTCAATTTTCCTACCGTCATTTTTGGGAACAGGGAGTTTATGGCATTAGCCGCTATTGGCTCAATGAACAGGAAAGACATCTGAGCGACTCCTTCCAGTTACGGAATTACACCAGGGACATTACCTTGCAGGGGTCTCCCTTGCCGGAATTTTTGCGGGTGGAATATGAACTCTGGGCAGCCCAGGAATGTTTGGGTCATTATGTGTTGCATTTGGAAATTTACCATTAA

Protein

MLTHHRRPVCLSLISTDLPILSTLETAATLYQKDLHRFHLLLHQEQEQVPNGDQQVLPSSQLLWLELSPRRIVLTRQGNSQFSYRHFWEQGVYGISRYWLNEQERHLSDSFQLRNYTRDITLQGSPLPEFLRVEYELWAAQECLGHYVLHLEIYH