Your browser is old and dusty. Try Google Chrome!

Details for sll0419

ORF sll0419
Accession NP_441806.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441818.1_9 Forward -324 -305 -4.03212 0.234
NP_440120.1_7 Reverse -336 -355 19.3803 0.225
NP_443002.1_5 Forward -362 -344 11.7197 0.247
NP_442752.1_4 Reverse -264 -271 9.47889 0.109
NP_442975.1_10 Reverse -381 -395 12.8803 0.0459
NP_440110.1_8 Reverse -250 -269 -2.85214 0.282
NP_440761.1_4 Forward -329 -310 -13.3736 0.257
NP_442181.1_3 Forward -110 -91 15.4374 0.24
NP_439918.1_2 Forward -152 -133 -0.4922 0.232
NP_439918.1_2 Forward -324 -305 -2.26216 0.242
NP_439918.1_2 Forward -256 -237 -4.03212 0.265
NP_439918.1_3 Forward -315 -296 3.83436 0.266
NP_441200.1_4 Reverse -220 -239 13.9625 0.156
NP_441208.1_9 Reverse -88 -102 9.2427 0.217
NP_442726.1_7 Reverse -296 -314 5.72234 0.209
NP_441925.1_2 Forward -345 -326 -0.0988766 0.298
NP_441925.1_4 Reverse -299 -318 -3.73788 0.176
NP_441083.1_4 Forward -370 -356 21.3367 0.29
NP_440056.1_9 Reverse -331 -350 12.9943 0.295
NP_441770.1_4 Forward -352 -333 -1.08219 0.186
NP_441624.1_7 Reverse -309 -323 17.4042 0.126
NP_441624.1_7 Forward -368 -354 11.996 0.201
NP_441624.1_7 Forward -152 -138 11.111 0.213
NP_440747.1_10 Reverse -299 -311 -12.3507 0.27
NP_442848.1_4 Forward -148 -134 11.5043 0.267
NP_442848.1_4 Forward -129 -115 5.70279 0.288
NP_441012.1_4 Reverse -311 -324 8.9674 0.272
NP_441950.1_8 Forward -328 -314 5.50613 0.281
NP_442782.1_2 Reverse -354 -368 6.6861 0.22
NP_442782.1_2 Forward -139 -125 5.89945 0.234
NP_442782.1_2 Forward -323 -309 3.73617 0.263
NP_441414.1_6 Reverse -208 -227 0.0977854 0.227
NP_441487.1_9 Reverse -287 -306 4.81767 0.142
NP_441256.1_8 Forward -352 -333 4.81767 0.272
NP_442321.1_4 Forward -249 -230 -5.50708 0.284
NP_443001.1_7 Forward -152 -133 2.26107 0.279
NP_440995.1_2 Forward -223 -204 13.9625 0.213
NP_441097.1_2 Reverse -258 -275 11.0519 0.193
NP_441338.2_5 Forward -345 -326 2.0644 0.299
NP_443055.1_6 Forward -281 -263 6.21323 0.172
NP_443055.1_6 Reverse -189 -207 3.8533 0.192
NP_442002.1_1 Reverse -258 -276 -8.33898 0.264
NP_441938.1_6 Forward -140 -121 8.16093 0.242
NP_441646.1_1 Reverse -224 -243 -1.37718 0.284
NP_440383.1_1 Forward -312 -293 13.5691 0.036
NP_440983.1_5 Reverse -303 -322 8.16093 0.151
NP_440983.1_5 Reverse -131 -150 -0.885524 0.228
NP_440983.1_5 Reverse -132 -151 -6.49039 0.277
NP_440260.1_8 Forward -321 -303 -7.45401 0.295
NP_440395.1_9 Forward -320 -301 23.3039 0.043
NP_442068.1_4 Reverse -297 -316 10.6184 0.171
NP_440587.1_6 Forward -367 -348 14.9458 0.115
NP_440253.1_2 Forward -206 -188 5.23069 0.0955
NP_442926.1_1 Reverse -212 -231 1.67108 0.197
NP_442926.1_1 Forward -235 -216 -6.09707 0.278
NP_442142.1_4 Reverse -194 -207 6.80355 0.154
NP_442142.1_4 Forward -230 -217 5.62358 0.187
NP_440620.1_4 Reverse -328 -342 15.0993 0.261
NP_440379.1_5 Forward -327 -308 -2.55715 0.199
NP_440379.1_5 Reverse -350 -369 -10.6203 0.281
NP_441758.1_4 Forward -151 -132 13.0775 0.254
NP_442719.1_2 Forward -28 -10 -1.9482 0.181
NP_441251.1_8 Reverse -346 -359 15.054 0.254
NP_442227.1_2 Forward -277 -258 -3.93378 0.3
NP_441911.1_7 Reverse -30 -49 -9.83437 0.201
NP_442808.1_1 Reverse -308 -318 9.616 0.0481
NP_442808.1_1 Reverse -196 -206 6.96107 0.0921
NP_442808.1_1 Forward -274 -264 2.5362 0.263
NP_440568.1_8 Reverse -222 -241 9.83255 0.265
NP_441315.1_2 Reverse -344 -362 16.1474 0.217
NP_442050.1_8 Reverse -138 -157 12.0425 0.276
NP_441114.1_3 Forward -18 -9 7.27622 0.247
NP_440558.1_3 Forward -238 -219 3.83436 0.283
NP_442789.1_4 Forward -197 -178 -6.09707 0.285
NP_441878.1_6 Forward -312 -302 -7.78811 0.266
NP_440084.1_8 Forward -38 -24 9.94278 0.271
NP_442830.1_2 Forward -381 -362 22.5164 0.0297
NP_442397.1_6 Forward -324 -310 16.1259 0.272
NP_440276.1_8 Forward -155 -136 6.98095 0.274
NP_442645.1_2 Forward -308 -289 -19.4701 0.288
NP_442590.1_10 Forward -159 -140 17.109 0.113
NP_440299.1_10 Reverse -299 -309 16.6958 0.285
NP_441559.1_4 Forward -315 -296 9.3409 0.102
NP_441559.1_8 Forward -24 -10 -4.32697 0.222
NP_441559.1_8 Reverse -164 -178 -5.31028 0.259
NP_441704.1_8 Reverse -61 -80 13.9616 0.11
NP_442866.1_1 Forward -329 -310 -1.37718 0.203
NP_440787.1_5 Forward -67 -53 15.5359 0.215
NP_442386.1_9 Reverse -353 -362 5.9975 0.23
NP_442386.1_9 Reverse -137 -146 5.9975 0.23
NP_440570.1_5 Forward -150 -131 -2.45882 0.279
NP_440570.1_5 Reverse -133 -152 -3.04881 0.286
NP_440327.1_6 Forward -152 -133 6.19431 0.246
NP_441254.1_1 Reverse -19 -32 11.7201 0.295
NP_442240.1_2 Forward -130 -111 -17.6018 0.269
NP_440161.1_3 Reverse -195 -214 12.0942 0.189
NP_440586.1_1 Reverse -223 -242 2.26107 0.227
NP_441595.1_2 Reverse -35 -48 9.80195 0.277
NP_440378.1_6 Forward -323 -304 17.6007 0.168
NP_440316.1_10 Reverse -217 -227 5.97822 0.275
NP_441572.1_7 Forward -268 -249 -4.91709 0.245
NP_440267.1_2 Reverse -297 -311 5.1122 0.281
NP_442384.1_10 Reverse -231 -244 2.47756 0.224
NP_442790.1_3 Forward -362 -343 7.57094 0.233
NP_440297.1_9 Reverse -231 -241 1.35667 0.282
NP_442280.1_10 Forward -372 -354 5.25962 0.289
NP_440999.1_9 Reverse -287 -301 2.16287 0.154
NP_440722.1_3 Forward -348 -334 9.63603 0.187
NP_442637.1_1 Forward -253 -234 -5.11376 0.2
NP_440519.1_8 Forward -324 -308 5.27008 0.21
NP_441560.1_3 Reverse -257 -275 4.9357 0.298
NP_442428.1_4 Reverse -170 -189 1.47442 0.296
NP_440436.1_4 Forward -272 -263 6.39082 0.162
NP_441893.1_5 Reverse -127 -141 16.9119 0.215
NP_441893.1_10 Reverse -347 -366 8.94757 0.291
NP_441719.1_2 Reverse -96 -110 13.8289 0.286
NP_441004.1_1 Forward -317 -298 -15.1435 0.273
NP_441004.1_2 Forward -390 -371 2.26107 0.215
NP_440296.1_4 Forward -145 -126 18.557 0.183
NP_440288.1_2 Reverse -328 -347 11.0125 0.125
NP_442001.1_1 Forward -52 -33 -3.83621 0.276
NP_442001.1_4 Reverse -129 -148 10.4217 0.264
NP_441501.1_9 Forward -281 -262 15.1416 0.245
NP_442856.1_7 Forward -372 -353 -5.50708 0.281
NP_441668.1_4 Forward -254 -235 -1.37718 0.273
NP_441396.1_5 Forward -314 -305 8.35786 0.224
NP_440593.1_3 Reverse -343 -362 -1.37718 0.211
NP_441349.1_10 Reverse -292 -311 -5.99873 0.217
NP_442314.1_3 Reverse -238 -252 12.1926 0.277
NP_442006.1_2 Reverse -354 -371 -14.4158 0.203
NP_442006.1_2 Forward -324 -307 -15.6941 0.228
NP_440483.1_1 Forward -228 -209 -0.0988766 0.199
NP_442038.1_1 Forward -48 -29 9.73422 0.129
NP_442038.1_1 Forward -344 -325 0.884433 0.278
NP_442729.1_7 Forward -241 -223 7.00065 0.277
NP_442729.1_8 Forward -261 -248 4.54251 0.294
NP_440707.1_9 Reverse -363 -382 -0.39387 0.299
NP_441432.1_8 Reverse -353 -362 5.60459 0.147
NP_443024.1_3 Forward -83 -73 12.9597 0.289
NP_442320.1_8 Reverse -379 -393 -6.39192 0.283
NP_442343.1_8 Forward -108 -92 17.8557 0.293
NP_440313.1_5 Reverse -117 -135 10.7364 0.294
NP_440565.1_7 Forward -185 -166 -1.27885 0.282
NP_441040.1_2 Reverse -210 -229 -9.047 0.236
NP_441047.1_2 Reverse -215 -234 -2.95047 0.284
NP_442796.1_9 Reverse -347 -366 11.8975 0.238
NP_440875.1_9 Forward -225 -215 7.88535 0.255
NP_441239.1_9 Reverse -294 -306 8.9871 0.117
NP_441009.1_4 Forward -152 -133 12.4875 0.232
NP_442193.1_1 Forward -324 -306 12.1139 0.223
NP_442270.1_9 Reverse -343 -362 -6.58872 0.207
NP_442643.1_1 Forward -318 -299 -8.752 0.231
NP_441017.1_8 Forward -243 -228 13.8446 0.174
NP_441617.1_6 Forward -345 -326 -6.68705 0.288
NP_440546.1_4 Reverse -218 -228 9.46426 0.136
NP_443033.1_3 Forward -356 -337 9.73422 0.268
NP_442340.1_3 Forward -361 -342 -11.2103 0.299
NP_441582.1_5 Forward -180 -161 5.11187 0.216
NP_441474.1_1 Reverse -305 -324 -1.77127 0.264
NP_440812.1_10 Forward -397 -384 13.4906 0.259
NP_442402.1_10 Forward -16 -6 11.3859 0.257
NP_442258.1_7 Reverse -167 -186 12.8808 0.274
NP_440653.1_10 Reverse -237 -256 5.11266 0.234
NP_440696.1_3 Forward -373 -355 -2.73412 0.279
NP_440160.1_2 Forward -240 -221 -2.55715 0.245
NP_442360.1_5 Forward -145 -135 12.5664 0.298
NP_440914.1_1 Reverse -310 -320 6.17532 0.293
NP_440914.1_1 Reverse -125 -135 6.07773 0.297
NP_442541.1_10 Forward -363 -349 4.03056 0.252
NP_440263.1_5 Forward -342 -328 7.37441 0.294
NP_442322.1_4 Reverse -307 -324 2.29975 0.21
NP_442322.1_4 Reverse -228 -245 -9.20492 0.29
NP_441219.1_6 Reverse -353 -371 13.3922 0.173
NP_441602.1_9 Forward -292 -274 18.8004 0.166
NP_441170.1_4 Forward -187 -169 2.37909 0.285
NP_442588.1_6 Forward -326 -307 -1.47551 0.268
NP_441930.1_1 Forward -243 -224 7.17762 0.235
NP_442614.1_2 Forward -180 -166 8.65272 0.254
NP_442717.1_1 Reverse -318 -337 5.80098 0.179
NP_440907.2_8 Reverse -249 -259 7.15773 0.127
NP_441463.1_3 Reverse -334 -353 -9.14533 0.277
NP_440107.1_2 Reverse -349 -368 12.9791 0.286
NP_441836.1_2 Forward -330 -311 -4.32711 0.255
NP_441193.1_1 Reverse -124 -143 13.47 0.229
NP_440358.1_8 Forward -340 -321 -0.688862 0.272
NP_441510.2_7 Reverse -111 -125 12.8803 0.28
NP_441272.1_7 Forward -318 -308 15.0247 0.2
NP_440766.1_5 Forward -141 -129 6.79636 0.292
NP_440766.1_5 Forward -340 -328 6.50989 0.299
NP_442743.1_1 Reverse -326 -345 5.50519 0.271
NP_442867.1_8 Forward -370 -351 7.07928 0.247
NP_440457.1_1 Reverse -263 -275 4.75886 0.154
NP_441984.1_3 Forward -239 -221 6.50899 0.269
NP_442509.1_9 Reverse -189 -199 9.321 0.192
NP_442784.1_3 Forward -396 -377 12.3892 0.264
NP_442514.1_5 Reverse -295 -314 -6.3928 0.265
NP_441756.1_5 Forward -231 -212 -2.65548 0.28
NP_442395.2_4 Reverse -229 -248 -0.689632 0.299
NP_442354.1_2 Forward -314 -295 10.2259 0.257
NP_442275.1_1 Reverse -264 -283 4.916 0.269
NP_442451.1_2 Forward -107 -88 -5.31042 0.222
NP_439962.1_4 Reverse -302 -321 -7.76869 0.29
NP_440804.1_7 Reverse -34 -51 17.3443 0.14
NP_440216.1_9 Reverse -140 -149 5.3096 0.298
NP_440416.1_1 Forward -206 -187 -14.2585 0.284
NP_440416.1_9 Forward -370 -351 -14.9469 0.182
NP_443052.1_9 Reverse -343 -362 -1.47551 0.228
NP_441940.1_1 Reverse -299 -318 12.1917 0.212
NP_442154.1_1 Forward -323 -305 -17.1888 0.249
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAGTGATGCGACAACTGTTGGATCAATGGTCCCACCCTGCCTTTGCCAGCATTGAAGGTTTTGCGGAAAATTTGGAAGCCACGGGTTTGGTGGAGGGCCAGGTGACTACTGCTGATTGGACTGTACCGACCCTCCCCGCTTGGTTGGATACCATTTGGCAGGGCATTATCCGGCCCCAGGGCTGGTTACAATACGGCATTCGTGGGTTTATCAAATCCGTGCGGGAAGTACCGACTATTTTATTGATGCGCCTTGCCTTTGGGGTAGGACTTTGTCGCTTCGGTATGTTCAAAGCAGTGCGAAAAAACGCCACTCAAGCTTAAATTGCCACGTAAGAACTCGCTAATTTCTTAATTTAGCTGAATATTTGAGGTTTTTGACTGCATTTCCCAGAACTATT

CDS

ATGTACTTTCTGCTTGTAACTCTGGTAATTTTAGTTTTTCCCCTACTTTCTATTGCTTTGGAGTGGACCACTTCCGGCAATAGCCAAGCTTTGGTGGATGTGCTGGCCCGCTGGTTTGTGTTTTGGGGGGTGGGGGTGAGGCTATTTTTAGCTGGGGTGGTGCAAATCACTAAACCAAGTTTCACTGCCGAGAAAATTCTAGGTGTTCAAAGTCAAGACTCTCTGATTTTGGTCAAAGAGTTGGGCATCGGCAATTTGGCGATCGCCAGTGTGGCTTTGGGGAGTATCTTCGTCAACGCGTGGGTGCTGGGGGCCGCTCTGGCCGGGGGAATTTTTTATCTTTTGGCGGGCATTAACCATATTTTGCAACCCGAACGCAATGCGAAAGAAAACTACGCCATGGCCACGGATCTATTTTTGGGGTTACTGTTGGGGGGTATCTTGTTTTTTGCTTGGCAGCCCTAA

Protein

MYFLLVTLVILVFPLLSIALEWTTSGNSQALVDVLARWFVFWGVGVRLFLAGVVQITKPSFTAEKILGVQSQDSLILVKELGIGNLAIASVALGSIFVNAWVLGAALAGGIFYLLAGINHILQPERNAKENYAMATDLFLGLLLGGILFFAWQP