Your browser is old and dusty. Try Google Chrome!

Details for sll0410

ORF sll0410
Accession NP_442178.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -91 -105 21.2391 0.0087
NP_441061.1_2 Reverse -149 -163 1.67122 0.183
NP_440795.1_7 Forward -156 -149 14.6904 0.0123
NP_440795.1_7 Reverse -149 -156 14.6904 0.0123
NP_440795.1_7 Reverse -53 -60 6.92228 0.26
NP_441418.1_6 Reverse -316 -335 -28.1232 0.203
NP_441418.1_6 Forward -157 -138 -28.2215 0.203
NP_441418.1_6 Reverse -148 -167 -29.7948 0.238
NP_442291.1_5 Forward -158 -142 6.15506 0.0727
NP_442291.1_7 Reverse -138 -152 10.4227 0.245
NP_440897.1_6 Forward -331 -312 -2.95123 0.227
NP_441453.1_1 Forward -164 -146 4.73828 0.258
NP_441453.1_4 Reverse -148 -156 16.539 0.00633
NP_441453.1_4 Forward -157 -149 16.539 0.00633
NP_442151.1_6 Forward -157 -143 12.291 0.0771
NP_441818.1_1 Forward -156 -145 9.79292 0.232
NP_441818.1_1 Reverse -149 -160 9.69459 0.232
NP_441818.1_9 Reverse -53 -72 -1.57384 0.2
NP_441818.1_9 Reverse -65 -84 -5.9004 0.258
NP_440226.1_1 Reverse -148 -167 6.39097 0.129
NP_442169.1_1 Reverse -172 -191 0.294447 0.261
NP_440259.1_4 Forward -186 -172 10.2748 0.27
NP_442655.1_1 Forward -162 -143 3.44104 0.235
NP_442173.1_1 Forward -156 -148 15.4574 0.00633
NP_442173.1_1 Reverse -149 -157 15.4574 0.00633
NP_442752.1_4 Forward -157 -150 13.8055 0.0199
NP_442752.1_4 Reverse -148 -155 13.8055 0.0199
NP_442752.1_4 Reverse -184 -191 12.1338 0.0546
NP_442752.1_4 Reverse -322 -329 10.8555 0.0846
NP_442752.1_4 Forward -38 -31 5.54565 0.194
NP_443027.1_4 Forward -159 -149 14.828 0.0437
NP_443027.1_4 Reverse -146 -156 11.0914 0.107
NP_441745.1_3 Reverse -93 -112 13.6666 0.282
NP_439997.1_4 Forward -370 -351 7.27595 0.266
NP_441812.1_3 Reverse -147 -161 17.8958 0.0479
NP_442975.1_10 Forward -161 -147 22.32 0.000414
NP_442975.1_10 Reverse -25 -39 7.57046 0.126
NP_441225.1_4 Forward -197 -178 -2.65548 0.239
NP_441225.1_4 Reverse -144 -163 -12.3902 0.284
NP_440784.1_7 Forward -156 -149 15.9687 0.0123
NP_440784.1_7 Reverse -149 -156 15.9687 0.0123
NP_440061.1_9 Forward -159 -145 18.3868 0.00917
NP_440878.1_9 Reverse -138 -157 13.9625 0.0939
NP_442062.1_8 Reverse -148 -158 19.4496 0.000558
NP_442062.1_8 Forward -157 -147 17.3846 0.00193
NP_442974.1_5 Reverse -89 -108 6.98095 0.226
NP_441859.1_3 Reverse -147 -166 1.76863 0.275
NP_440304.1_4 Forward -159 -149 10.8948 0.051
NP_440304.1_4 Reverse -320 -330 7.55152 0.109
NP_440304.1_4 Reverse -89 -99 3.22496 0.299
NP_440304.1_4 Reverse -146 -156 1.84832 0.299
NP_442242.1_4 Forward -156 -149 14.3954 0.0124
NP_442242.1_4 Reverse -149 -156 14.3954 0.0124
NP_440044.1_8 Reverse -149 -168 18.1907 0.0172
NP_441035.1_1 Reverse -162 -181 18.584 0.198
NP_439902.1_8 Reverse -316 -335 22.4189 0.0807
NP_439918.1_2 Reverse -53 -72 -3.63879 0.258
NP_441208.1_9 Reverse -145 -159 5.70279 0.262
NP_442110.1_7 Forward -157 -143 10.6193 0.0644
NP_442110.1_7 Reverse -148 -162 1.57289 0.222
NP_441925.1_2 Reverse -163 -182 1.57275 0.278
NP_440856.1_7 Reverse -52 -71 4.03102 0.153
NP_440856.1_7 Forward -250 -231 -7.86702 0.258
NP_441083.1_3 Forward -134 -124 15.0242 0.138
NP_441083.1_5 Forward -157 -147 20.3345 0.00053
NP_441083.1_5 Reverse -148 -158 11.3864 0.0159
NP_441083.1_5 Reverse -29 -39 7.15819 0.0637
NP_441083.1_5 Forward -331 -321 -1.10161 0.295
NP_441738.1_2 Forward -155 -148 15.28 0.0102
NP_441738.1_2 Reverse -150 -157 15.28 0.0102
NP_440209.1_1 Reverse -148 -156 18.1123 0.00295
NP_440209.1_1 Forward -157 -149 18.1123 0.00295
NP_440209.1_1 Forward -331 -323 2.08437 0.286
NP_442889.1_1 Forward -139 -120 -12.0953 0.218
NP_442889.1_8 Forward -160 -146 13.5686 0.0588
NP_440447.1_1 Reverse -76 -94 8.67227 0.194
NP_440056.1_1 Forward -78 -59 7.37428 0.297
NP_441770.1_5 Forward -165 -146 -0.590531 0.247
NP_440178.1_7 Reverse -147 -166 -22.5183 0.267
NP_440178.1_7 Reverse -123 -142 -22.715 0.272
NP_442570.1_3 Forward -141 -122 -2.85214 0.215
NP_441716.1_1 Forward -157 -143 10.7177 0.0936
NP_442111.1_4 Forward -158 -144 5.21113 0.172
NP_441624.1_7 Forward -105 -91 10.3243 0.217
NP_440343.1_3 Forward -197 -179 3.95163 0.266
NP_440906.1_5 Forward -156 -149 15.8704 0.0124
NP_440906.1_5 Reverse -149 -156 15.8704 0.0124
NP_440747.1_10 Reverse -145 -157 26.5883 0.000317
NP_440747.1_10 Forward -160 -148 -2.02597 0.0196
NP_441130.1_10 Forward -159 -145 11.5043 0.106
NP_441130.1_10 Reverse -146 -160 6.58777 0.183
NP_441854.1_10 Forward -141 -122 0.687771 0.282
NP_441486.1_1 Forward -160 -146 13.2743 0.00871
NP_441486.1_1 Reverse -145 -159 2.5562 0.0812
NP_441486.1_1 Forward -136 -122 2.2612 0.0868
NP_442634.1_4 Reverse -146 -160 -2.06536 0.149
NP_442634.1_4 Forward -141 -127 -5.90027 0.284
NP_440842.1_10 Reverse -121 -135 12.6843 0.251
NP_440842.1_10 Forward -134 -120 1.37622 0.294
NP_441014.1_8 Forward -197 -178 -7.08038 0.276
NP_441014.1_10 Reverse -147 -166 -1.96793 0.269
NP_442848.1_1 Reverse -142 -156 -0.393733 0.263
NP_442848.1_1 Forward -163 -149 -3.63866 0.268
NP_442848.1_4 Forward -135 -121 9.14437 0.282
NP_442848.1_9 Reverse -380 -399 -1.7705 0.299
NP_441012.1_4 Reverse -126 -139 7.6891 0.272
NP_441012.1_4 Forward -191 -178 7.00078 0.272
NP_443018.1_3 Forward -156 -149 14.8871 0.0123
NP_443018.1_3 Reverse -149 -156 14.8871 0.0123
NP_443018.1_3 Reverse -323 -330 11.5438 0.0752
NP_441316.1_7 Forward -159 -144 -2.97003 0.273
NP_441634.1_8 Reverse -146 -160 14.7492 0.0248
NP_441634.1_8 Forward -195 -181 0.589577 0.223
NP_440376.1_1 Forward -157 -148 19.4693 0.000692
NP_440376.1_1 Reverse -148 -157 19.4693 0.000692
NP_440376.1_1 Forward -38 -29 3.44131 0.203
NP_440376.1_1 Reverse -184 -193 0.196389 0.283
NP_441588.1_4 Reverse -150 -160 6.96153 0.178
NP_443065.1_6 Reverse -144 -163 4.03102 0.221
NP_440266.1_6 Forward -204 -185 18.1898 0.0547
NP_442687.1_7 Forward -158 -148 15.8113 0.0125
NP_442687.1_7 Reverse -147 -157 8.92815 0.0994
NP_442687.1_7 Reverse -129 -139 3.71661 0.292
NP_442485.1_3 Forward -168 -149 -5.80207 0.296
NP_442958.1_3 Reverse -137 -156 5.40766 0.22
NP_441013.1_2 Forward -110 -92 -4.60241 0.299
NP_441422.1_7 Forward -159 -142 -0.747806 0.168
NP_442296.1_5 Reverse -115 -134 4.42435 0.251
NP_442658.1_1 Forward -159 -149 15.9091 0.00966
NP_442658.1_1 Reverse -146 -156 7.94438 0.199
NP_442658.1_1 Reverse -83 -93 6.96107 0.214
NP_440141.1_8 Forward -381 -362 4.52268 0.288
NP_442782.1_2 Reverse -91 -105 7.66941 0.202
NP_442782.1_2 Reverse -148 -162 1.37622 0.281
NP_442782.1_2 Forward -145 -131 0.294584 0.291
NP_442205.1_9 Forward -163 -147 -2.79306 0.272
NP_441487.1_7 Reverse -81 -100 12.6841 0.151
NP_442300.1_4 Reverse -122 -141 19.9598 0.152
NP_441478.1_10 Forward -184 -166 7.29487 0.245
NP_441958.1_5 Forward -158 -148 12.2714 0.00183
NP_441958.1_5 Reverse -147 -157 12.2714 0.00183
NP_441127.1_1 Reverse -322 -336 12.4876 0.213
NP_442836.1_5 Reverse -142 -161 11.9958 0.0822
NP_440203.1_5 Reverse -32 -42 10.3043 0.229
NP_440203.1_5 Forward -328 -318 8.63269 0.29
NP_440984.1_7 Reverse -143 -157 9.63603 0.127
NP_440984.1_7 Forward -138 -124 6.3911 0.217
NP_439990.1_5 Reverse -143 -156 13.7856 0.0889
NP_441580.1_6 Forward -168 -149 -6.49039 0.235
NP_440153.1_5 Forward -156 -142 11.406 0.0763
NP_440153.1_8 Forward -67 -54 -3.32397 0.295
NP_440858.1_1 Forward -241 -222 -6.49039 0.298
NP_443055.1_3 Forward -108 -89 11.8865 0.24
NP_443055.1_6 Reverse -134 -152 -2.53818 0.296
NP_440993.1_4 Reverse -1 -18 1.8088 0.3
NP_440496.1_1 Reverse -166 -185 1.57275 0.276
NP_441429.1_4 Reverse -83 -102 10.3234 0.219
NP_441099.1_5 Reverse -138 -157 -6.98204 0.168
NP_442002.1_9 Forward -158 -151 10.7572 0.185
NP_441654.1_6 Reverse -353 -371 13.3709 0.296
NP_440809.1_9 Forward -166 -148 -7.84733 0.225
NP_441294.1_7 Forward -161 -147 16.6418 0.0133
NP_441294.1_7 Reverse -25 -39 9.53859 0.241
NP_441646.1_1 Reverse -141 -160 -0.787193 0.272
NP_442438.1_10 Forward -162 -148 10.9143 0.0478
NP_442438.1_10 Reverse -143 -157 9.04604 0.0692
NP_442431.1_10 Reverse -178 -196 0.117479 0.281
NP_441000.1_6 Reverse -147 -161 5.01447 0.0933
NP_441000.1_6 Forward -158 -144 -3.93365 0.225
NP_440147.1_4 Forward -159 -146 11.0324 0.0341
NP_440147.1_4 Reverse -146 -159 7.39411 0.0695
NP_441295.1_4 Reverse -143 -162 -4.32711 0.29
NP_441550.1_8 Reverse -146 -156 15.1225 0.0132
NP_441550.1_8 Forward -159 -149 6.0761 0.214
NP_441916.1_7 Reverse -148 -158 18.4663 0.00144
NP_441916.1_7 Forward -157 -147 10.3048 0.0261
NP_441916.1_10 Reverse -320 -339 5.99764 0.208
NP_440465.1_4 Reverse -147 -166 14.7491 0.184
NP_441041.1_4 Reverse -148 -167 -1.67217 0.102
NP_441041.1_4 Forward -105 -86 -7.86702 0.194
NP_441041.1_4 Reverse -184 -203 -13.3736 0.285
NP_441041.1_7 Forward -160 -148 10.916 0.0864
NP_441041.1_7 Reverse -145 -157 7.51478 0.162
NP_440715.1_1 Forward -105 -86 16.4207 0.072
NP_442396.1_5 Forward -236 -223 7.09911 0.215
NP_441547.1_2 Reverse -311 -329 6.90232 0.215
NP_440703.1_9 Reverse -124 -137 19.8815 0.0529
NP_441725.1_4 Reverse -143 -157 4.42388 0.278
NP_441725.1_5 Reverse -149 -159 11.2881 0.0247
NP_441725.1_5 Forward -330 -320 8.63316 0.0621
NP_441725.1_5 Forward -156 -146 2.04498 0.115
NP_439966.1_7 Forward -159 -149 18.4657 0.00473
NP_439966.1_7 Reverse -146 -156 15.3192 0.0152
NP_439966.1_7 Forward -333 -323 13.2542 0.0297
NP_439966.1_7 Reverse -27 -37 5.09279 0.243
NP_439966.1_7 Forward -195 -185 4.60114 0.265
NP_439966.1_9 Forward -159 -150 0.983037 0.253
NP_442941.1_3 Forward -156 -146 19.2529 0.00262
NP_442941.1_3 Reverse -149 -159 11.4848 0.0116
NP_440289.1_2 Forward -160 -147 21.3571 0.00262
NP_440289.1_2 Reverse -145 -158 -3.61896 0.267
NP_440983.1_5 Forward -73 -54 -8.16202 0.294
NP_440260.1_8 Reverse -55 -73 -5.29072 0.273
NP_442281.1_1 Forward -162 -148 18.7801 0.00389
NP_442281.1_1 Reverse -143 -157 16.5185 0.00772
NP_442281.1_1 Reverse -24 -38 5.40719 0.159
NP_442281.1_1 Forward -293 -279 2.45727 0.266
NP_441334.1_7 Forward -200 -181 -16.0285 0.275
NP_440437.1_1 Reverse -142 -161 6.88262 0.072
NP_440437.1_1 Reverse -23 -42 -5.50708 0.286
NP_442012.1_9 Forward -298 -280 15.3518 0.258
NP_441087.1_6 Forward -188 -170 -0.473239 0.258
NP_441556.1_4 Forward -253 -234 13.5722 0.195
NP_441556.1_10 Reverse -143 -157 13.0446 0.182
NP_441556.1_10 Reverse -63 -77 11.6819 0.219
NP_442982.1_5 Reverse -138 -157 -0.983855 0.263
NP_441644.1_6 Forward -157 -147 17.3841 0.00127
NP_441644.1_6 Reverse -148 -158 10.1076 0.0628
NP_441644.1_6 Reverse -124 -134 4.50281 0.235
NP_443049.1_6 Reverse -321 -331 17.0085 0.0973
NP_442215.1_2 Forward -159 -143 7.33503 0.0692
NP_442215.1_2 Forward -135 -119 -5.34967 0.249
NP_442247.1_6 Reverse -240 -259 10.4225 0.282
NP_440253.1_2 Reverse -148 -166 -1.35749 0.238
NP_440929.1_8 Forward -157 -148 19.2726 0.000701
NP_440929.1_8 Reverse -148 -157 19.2726 0.000701
NP_440566.1_5 Reverse -267 -286 12.4875 0.194
NP_442933.1_10 Forward -157 -148 17.601 0.00325
NP_442933.1_10 Reverse -148 -157 17.601 0.00325
NP_441751.2_8 Forward -156 -142 -2.26202 0.132
NP_441751.2_8 Reverse -149 -163 -3.93365 0.157
NP_441751.2_8 Forward -330 -316 -6.19526 0.255
NP_442926.1_5 Reverse -143 -162 11.7264 0.198
NP_442554.1_8 Forward -156 -146 16.2046 0.0065
NP_442554.1_8 Reverse -149 -159 13.8447 0.0145
NP_442554.1_8 Forward -330 -320 3.91327 0.203
NP_442554.1_8 Reverse -125 -135 3.71661 0.215
NP_442554.1_8 Reverse -91 -101 3.02829 0.245
NP_442554.1_8 Forward -132 -122 2.53664 0.268
NP_441762.1_7 Reverse -147 -159 2.89058 0.0676
NP_441762.1_7 Forward -158 -146 2.39892 0.0676
NP_441762.1_7 Reverse -321 -333 -5.95921 0.258
NP_442142.1_4 Reverse -145 -158 16.0466 0.0264
NP_442142.1_4 Forward -160 -147 15.85 0.0264
NP_442142.1_4 Reverse -229 -242 6.31189 0.169
NP_442292.1_1 Forward -156 -147 18.486 0.00229
NP_442292.1_1 Reverse -149 -158 9.63616 0.0183
NP_442476.1_6 Forward -156 -142 8.55439 0.0993
NP_442381.1_8 Forward -160 -141 -4.42544 0.137
NP_443009.1_5 Reverse -147 -158 18.3477 0.00265
NP_443009.1_5 Forward -232 -221 5.46638 0.202
NP_443009.1_5 Forward -393 -382 3.5981 0.286
NP_441715.1_4 Forward -156 -146 17.3846 0.0106
NP_441715.1_4 Reverse -149 -159 16.303 0.0117
NP_441448.1_1 Reverse -164 -183 10.6192 0.191
NP_440183.1_9 Reverse -45 -64 -19.9617 0.282
NP_441468.1_1 Forward -156 -149 15.8704 0.0124
NP_441468.1_1 Reverse -149 -156 15.8704 0.0124
NP_441468.1_1 Reverse -323 -330 4.07068 0.263
NP_441020.2_6 Reverse -381 -398 7.31533 0.235
NP_441020.2_6 Forward -375 -358 7.217 0.237
NP_441020.2_6 Forward -159 -142 6.13536 0.275
NP_441015.1_10 Forward -162 -143 -2.95047 0.184
NP_441673.1_1 Forward -157 -148 20.8459 0.000698
NP_441673.1_1 Reverse -148 -157 20.8459 0.000698
NP_441339.1_4 Forward -140 -121 -5.60541 0.28
NP_442253.1_5 Reverse -81 -98 -0.452814 0.225
NP_440286.1_1 Forward -103 -85 6.31233 0.295
NP_440265.1_8 Forward -246 -228 15.4571 0.218
NP_441876.1_9 Reverse -139 -149 10.1076 0.3
NP_441826.1_2 Reverse -142 -156 14.5526 0.0196
NP_441826.1_2 Reverse -23 -37 -3.34366 0.284
NP_441826.1_2 Reverse -124 -138 -4.7203 0.299
NP_441330.1_1 Reverse -143 -162 -12.1936 0.183
NP_441637.1_9 Reverse -356 -374 5.03403 0.245
NP_442490.1_9 Reverse -310 -329 -4.13045 0.258
NP_442868.1_6 Reverse -146 -156 19.2529 0.00563
NP_442868.1_6 Forward -394 -384 2.33998 0.205
NP_442868.1_6 Forward -159 -149 0.963343 0.205
NP_442719.1_2 Reverse -357 -375 -10.7979 0.283
NP_441056.1_1 Forward -157 -138 -4.52377 0.25
NP_441612.1_2 Forward -157 -147 8.54929 0.21
NP_441612.1_2 Reverse -84 -94 7.29072 0.256
NP_442227.1_2 Forward -248 -229 -2.36049 0.272
NP_442808.1_1 Forward -158 -148 18.4657 0.00201
NP_442808.1_1 Forward -332 -322 15.0242 0.0285
NP_442808.1_1 Reverse -147 -157 8.63269 0.0481
NP_442808.1_1 Reverse -28 -38 6.86274 0.0941
NP_441101.1_10 Reverse -144 -163 -8.16202 0.297
NP_440145.1_3 Reverse -138 -157 1.0811 0.131
NP_440145.1_3 Reverse -80 -99 -3.54046 0.202
NP_442542.1_2 Forward -159 -146 9.45906 0.134
NP_442542.1_9 Reverse -373 -387 9.04542 0.141
NP_442050.1_5 Reverse -146 -156 14.3359 0.0206
NP_442050.1_5 Forward -159 -149 9.12434 0.193
NP_442342.1_9 Forward -333 -317 9.10498 0.171
NP_440558.1_2 Reverse -81 -100 4.52268 0.152
NP_440558.1_2 Forward -97 -78 -3.04881 0.232
NP_440558.1_2 Forward -241 -222 -3.14714 0.234
NP_440558.1_2 Reverse -139 -158 -5.40875 0.258
NP_440558.1_5 Forward -99 -85 19.1741 0.19
NP_442789.1_4 Reverse -53 -72 0.786102 0.188
NP_441518.1_4 Forward -200 -181 3.83357 0.288
NP_441878.1_6 Reverse -123 -133 10.7964 0.0176
NP_441878.1_6 Forward -158 -148 10.4031 0.0176
NP_441878.1_6 Reverse -147 -157 10.4031 0.0176
NP_441878.1_6 Forward -134 -124 9.7148 0.0237
NP_441878.1_6 Reverse -321 -331 1.74999 0.0642
NP_441036.1_8 Forward -158 -148 17.7779 0.000554
NP_441036.1_8 Reverse -147 -157 8.33817 0.174
NP_441557.1_5 Forward -157 -148 19.9609 0.000699
NP_441557.1_5 Reverse -148 -157 19.9609 0.000699
NP_441557.1_8 Forward -192 -182 12.3692 0.236
NP_442356.1_1 Reverse -172 -191 10.9142 0.256
NP_441445.1_1 Forward -166 -147 19.469 0.0276
NP_441590.1_4 Forward -329 -310 2.35861 0.296
NP_441433.1_8 Forward -387 -368 1.0811 0.236
NP_441433.1_8 Forward -386 -367 0.58944 0.239
NP_442419.1_2 Reverse -143 -162 16.9124 0.0661
NP_441308.1_8 Reverse -27 -37 12.1731 0.22
NP_441308.1_8 Forward -159 -149 10.1081 0.22
NP_441308.1_8 Reverse -187 -197 8.04317 0.288
NP_440101.1_3 Forward -144 -125 3.93269 0.224
NP_441458.1_10 Reverse -139 -158 7.37428 0.196
NP_441458.1_10 Forward -166 -147 5.80098 0.212
NP_442183.1_1 Reverse -148 -162 17.2075 0.0118
NP_442183.1_1 Forward -38 -24 5.99778 0.193
NP_442183.1_1 Reverse -322 -336 5.60446 0.21
NP_440540.1_8 Forward -163 -144 7.7676 0.271
NP_442347.1_2 Reverse -30 -39 15.831 0.056
NP_442347.1_2 Forward -156 -147 12.4878 0.056
NP_442347.1_2 Reverse -149 -158 11.1111 0.056
NP_442645.1_2 Reverse -140 -159 -13.1769 0.147
NP_442645.1_2 Forward -141 -122 -13.8652 0.165
NP_441037.1_4 Forward -159 -149 7.02532 0.237
NP_441633.1_3 Reverse -146 -159 10.7374 0.0286
NP_441633.1_3 Forward -159 -146 -3.71729 0.177
NP_440136.1_2 Forward -156 -149 15.9687 0.0123
NP_440136.1_2 Reverse -149 -156 15.9687 0.0123
NP_442590.1_10 Forward -157 -138 3.53937 0.29
NP_442998.1_5 Reverse -171 -181 7.64985 0.287
NP_442998.1_10 Forward -155 -148 15.5754 0.0102
NP_442998.1_10 Reverse -150 -157 15.5754 0.0102
NP_442998.1_10 Forward -329 -322 6.13563 0.181
NP_440299.1_1 Reverse -144 -157 20.2748 0.00128
NP_440299.1_1 Forward -161 -148 2.28034 0.292
NP_441799.1_1 Reverse -144 -158 9.14375 0.0988
NP_441799.1_1 Forward -161 -147 8.75042 0.106
NP_441007.1_10 Reverse -143 -156 -0.669033 0.287
NP_442201.1_10 Reverse -70 -89 -13.5702 0.274
NP_442333.2_5 Reverse -311 -330 -13.1769 0.251
NP_440256.1_1 Reverse -145 -164 22.6156 0.00281
NP_440256.1_1 Forward -160 -141 -6.78538 0.22
NP_440256.1_1 Forward -103 -84 -6.88371 0.223
NP_441559.1_8 Reverse -143 -157 2.94952 0.143
NP_441559.1_8 Reverse -379 -393 -0.000409212 0.171
NP_441559.1_8 Reverse -218 -232 -3.34366 0.201
NP_441559.1_8 Reverse -217 -231 -6.49025 0.279
NP_440915.1_6 Reverse -144 -158 10.6193 0.0301
NP_440915.1_6 Forward -161 -147 -3.147 0.29
NP_441179.1_9 Reverse -36 -46 14.3359 0.246
NP_442866.1_1 Reverse -85 -104 -4.32711 0.226
NP_440748.1_5 Reverse -87 -106 3.24438 0.21
NP_440748.1_5 Forward -202 -183 -2.75381 0.281
NP_441464.1_1 Forward -197 -178 10.6192 0.24
NP_441939.1_3 Forward -156 -137 17.2074 0.0322
NP_441199.1_6 Reverse -48 -67 0.884433 0.23
NP_439985.1_7 Reverse -51 -70 8.75091 0.18
NP_442993.1_1 Reverse -148 -164 9.59664 0.0182
NP_442993.1_1 Reverse -189 -205 -2.69473 0.118
NP_442386.1_9 Forward -158 -149 15.7322 0.0144
NP_442386.1_9 Reverse -147 -156 13.8639 0.0289
NP_442386.1_9 Forward -332 -323 6.48915 0.219
NP_442386.1_9 Reverse -51 -60 4.62087 0.294
NP_440570.1_5 Forward -329 -310 1.57275 0.237
NP_440570.1_5 Reverse -138 -157 0.687771 0.254
NP_441750.1_4 Reverse -144 -163 7.17762 0.159
NP_441340.1_5 Forward -156 -149 15.6737 0.0124
NP_441340.1_5 Reverse -149 -156 15.6737 0.0124
NP_442186.1_9 Reverse -82 -101 6.58763 0.228
NP_440168.1_9 Forward -101 -82 -5.40875 0.296
NP_441132.1_1 Forward -35 -16 12.9791 0.203
NP_442240.1_2 Forward -156 -137 -10.0303 0.137
NP_440161.1_3 Reverse -146 -165 7.86593 0.285
NP_440586.1_8 Forward -156 -149 13.2151 0.026
NP_440586.1_8 Reverse -149 -156 13.2151 0.026
NP_440586.1_8 Reverse -323 -330 10.9535 0.119
NP_440586.1_8 Forward -240 -233 7.51192 0.239
NP_440586.1_8 Reverse -131 -138 5.64364 0.297
NP_442251.1_6 Forward -156 -149 15.2804 0.0124
NP_442251.1_6 Reverse -149 -156 15.2804 0.0124
NP_442959.1_4 Forward -271 -252 4.71934 0.268
NP_441912.1_3 Forward -151 -132 6.39097 0.27
NP_441262.1_3 Reverse -148 -155 14.7888 0.0223
NP_441262.1_3 Forward -157 -150 14.7888 0.0223
NP_441262.1_3 Reverse -322 -329 5.25066 0.215
NP_440027.1_3 Forward -67 -49 3.75497 0.267
NP_443051.1_1 Reverse -147 -156 10.4228 0.00754
NP_443051.1_1 Forward -158 -149 10.4228 0.00754
NP_443051.1_1 Reverse -321 -330 -1.18024 0.297
NP_439937.1_8 Reverse -320 -339 2.85105 0.209
NP_439937.1_9 Reverse -147 -164 -16.678 0.287
NP_440408.1_7 Reverse -84 -103 12.0942 0.212
NP_440439.1_1 Reverse -145 -158 9.16406 0.0465
NP_440439.1_1 Forward -160 -147 1.19926 0.159
NP_440439.1_1 Reverse -181 -194 -0.37404 0.215
NP_440439.1_1 Reverse -186 -199 -0.669033 0.229
NP_440439.1_1 Forward -41 -28 -1.45568 0.269
NP_440372.1_2 Forward -156 -149 16.3621 0.0124
NP_440372.1_2 Reverse -149 -156 16.3621 0.0124
NP_440316.1_10 Reverse -321 -331 8.4365 0.239
NP_441803.1_2 Reverse -143 -162 -1.18052 0.294
NP_439977.1_5 Forward -337 -318 9.73422 0.0932
NP_439977.1_5 Forward -163 -144 -1.57384 0.256
NP_440139.1_1 Forward -163 -144 11.7983 0.0797
NP_440139.1_1 Forward -337 -318 2.55527 0.229
NP_441572.1_7 Forward -163 -144 -4.81876 0.244
NP_442384.1_10 Forward -157 -144 20.8655 0.00194
NP_442384.1_10 Reverse -29 -42 10.934 0.0399
NP_442384.1_10 Forward -139 -126 6.1158 0.11
NP_442085.1_3 Forward -122 -103 14.6576 0.208
NP_441018.1_7 Reverse -180 -199 7.96426 0.259
NP_441018.1_7 Forward -42 -23 7.27595 0.273
NP_442262.1_10 Forward -156 -149 14.1988 0.0123
NP_442262.1_10 Reverse -149 -156 14.1988 0.0123
NP_442262.1_10 Reverse -323 -330 11.7405 0.0841
NP_441689.1_5 Forward -159 -149 8.53436 0.132
NP_441689.1_5 Reverse -146 -156 5.78111 0.197
NP_441689.1_5 Forward -200 -190 5.68278 0.215
NP_440163.1_10 Forward -160 -150 15.2213 0.0762
NP_440344.1_10 Forward -164 -147 21.77 0.00159
NP_440344.1_10 Forward -338 -321 -6.35267 0.113
NP_440344.1_10 Reverse -22 -39 -9.49926 0.147
NP_440531.1_6 Forward -141 -122 4.22769 0.129
NP_440531.1_6 Reverse -116 -135 -4.81876 0.287
NP_440189.1_10 Reverse -113 -132 22.0256 0.032
NP_441335.1_8 Forward -376 -357 11.5042 0.204
NP_440562.1_3 Forward -156 -139 7.80699 0.15
NP_441965.1_10 Forward -160 -144 10.4816 0.107
NP_441965.1_10 Reverse -26 -42 2.71347 0.284
NP_440297.1_9 Forward -330 -320 9.51814 0.0917
NP_440297.1_9 Reverse -149 -159 9.32148 0.0917
NP_440297.1_9 Forward -132 -122 0.0783647 0.282
NP_440297.1_9 Forward -156 -146 -0.118297 0.282
NP_440297.1_9 Forward -138 -128 -0.609952 0.292
NP_441592.1_4 Forward -157 -138 0.0977854 0.237
NP_440999.1_9 Forward -161 -147 4.62115 0.116
NP_440999.1_9 Reverse -144 -158 1.08123 0.171
NP_440888.1_2 Forward -157 -143 17.7968 0.00308
NP_440888.1_2 Reverse -148 -162 15.4369 0.0107
NP_440888.1_2 Reverse -29 -43 8.16044 0.171
NP_440822.1_8 Forward -149 -130 8.16093 0.258
NP_440491.1_1 Forward -93 -74 9.4509 0.214
NP_440491.1_1 Forward -160 -141 6.52718 0.296
NP_440052.1_8 Forward -46 -27 8.45592 0.285
NP_439969.1_1 Reverse -42 -61 -6.68705 0.288
NP_442033.1_10 Forward -159 -140 3.04771 0.0873
NP_441123.1_6 Reverse -140 -158 10.5406 0.215
NP_441543.1_2 Reverse -149 -158 18.486 0.00236
NP_441543.1_2 Forward -156 -147 16.9127 0.00359
NP_442845.1_2 Forward -157 -143 7.37441 0.195
NP_442845.1_2 Forward -44 -30 5.1128 0.243
NP_442845.1_2 Forward -163 -149 5.01447 0.247
NP_442845.1_2 Reverse -84 -98 4.81781 0.251
NP_442845.1_2 Forward -139 -125 4.71948 0.254
NP_440208.1_1 Forward -396 -377 -9.73531 0.257
NP_441304.1_10 Reverse -12 -21 14.0611 0.213
NP_441469.1_8 Forward -158 -149 16.126 0.00797
NP_441469.1_8 Reverse -147 -156 6.48957 0.227
NP_443064.1_6 Forward -157 -147 12.5669 0.0796
NP_441306.1_10 Reverse -115 -129 15.7319 0.247
NP_442578.1_7 Forward -156 -149 14.5921 0.026
NP_442578.1_7 Reverse -149 -156 14.5921 0.026
NP_442578.1_7 Reverse -323 -330 5.15232 0.291
NP_441462.1_2 Forward -157 -147 11.5831 0.00406
NP_441462.1_2 Reverse -148 -158 11.5831 0.00406
NP_441621.1_7 Forward -159 -145 -3.147 0.188
NP_441621.1_7 Forward -243 -229 -3.63866 0.192
NP_443062.1_1 Reverse -148 -166 14.7864 0.0439
NP_442204.1_1 Reverse -144 -155 11.5634 0.0565
NP_442204.1_1 Reverse -318 -329 1.33697 0.274
NP_442204.1_5 Forward -167 -148 11.4058 0.0764
NP_440516.1_8 Forward -157 -148 16.9127 0.00442
NP_440516.1_8 Reverse -148 -157 16.9127 0.00442
NP_440516.1_8 Reverse -322 -331 0.786375 0.133
NP_441785.1_1 Reverse -148 -162 12.6414 0.244
NP_441033.1_2 Forward -167 -148 -7.4737 0.293
NP_442428.1_5 Forward -156 -149 15.8704 0.0124
NP_442428.1_5 Reverse -149 -156 15.8704 0.0124
NP_442428.1_5 Reverse -323 -330 4.46401 0.267
NP_440618.1_1 Reverse -168 -187 4.52268 0.103
NP_442120.1_10 Forward -163 -144 -6.78538 0.217
NP_440673.1_3 Forward -155 -148 12.4288 0.0426
NP_440673.1_3 Reverse -150 -157 12.4288 0.0426
NP_440673.1_3 Forward -329 -322 11.6422 0.0724
NP_440865.1_9 Forward -163 -144 11.2092 0.0497
NP_441052.1_2 Forward -157 -147 19.9412 0.00106
NP_441052.1_2 Reverse -148 -158 10.5014 0.0285
NP_441052.1_2 Reverse -29 -39 5.97822 0.0968
NP_441052.1_2 Reverse -124 -134 4.3066 0.161
NP_442219.1_8 Forward -376 -357 8.16711 0.253
NP_442219.1_8 Reverse -12 -31 6.62097 0.292
NP_442219.1_9 Forward -156 -147 17.7976 0.00718
NP_442219.1_9 Reverse -149 -158 8.35786 0.0681
NP_442219.1_9 Reverse -30 -39 1.76968 0.298
NP_440436.1_4 Reverse -149 -158 18.1905 0.00233
NP_440436.1_4 Forward -156 -147 17.2072 0.00233
NP_441884.1_8 Reverse -63 -82 -9.63698 0.268
NP_441884.1_9 Forward -160 -141 -13.6686 0.138
NP_442907.1_5 Forward -48 -29 14.6508 0.262
NP_442907.1_9 Reverse -125 -144 2.85105 0.171
NP_441719.1_4 Forward -156 -149 16.3621 0.0124
NP_441719.1_4 Reverse -149 -156 16.3621 0.0124
NP_441719.1_4 Reverse -323 -330 3.77569 0.285
NP_441733.1_10 Reverse -145 -158 7.39411 0.153
NP_441004.1_1 Reverse -316 -335 0.982764 0.111
NP_441004.1_1 Forward -379 -360 -0.983855 0.124
NP_441004.1_5 Reverse -318 -332 11.996 0.24
NP_442366.1_3 Reverse -147 -165 5.42735 0.0878
NP_442366.1_3 Forward -158 -140 4.73903 0.093
NP_439949.1_7 Reverse -12 -26 19.5675 0.0522
NP_441115.1_4 Forward -158 -140 13.293 0.0827
NP_442206.1_10 Reverse -184 -199 4.60145 0.178
NP_442206.1_10 Forward -157 -142 1.45486 0.229
NP_442854.1_6 Forward -144 -125 2.3594 0.272
NP_443054.1_2 Reverse -146 -160 10.521 0.0761
NP_441851.1_9 Forward -103 -84 6.58763 0.299
NP_441851.1_10 Forward -158 -148 16.008 0.00552
NP_441851.1_10 Reverse -147 -157 15.8113 0.00552
NP_441851.1_10 Forward -233 -223 9.61647 0.114
NP_441851.1_10 Reverse -321 -331 4.60159 0.259
NP_442856.1_7 Reverse -139 -158 -3.54046 0.244
NP_442515.1_1 Reverse -147 -161 2.75286 0.13
NP_440593.1_3 Forward -138 -119 -4.72043 0.251
NP_441982.1_6 Forward -207 -198 13.3448 0.274
NP_440165.1_5 Reverse -1 -20 -7.86702 0.281
NP_440165.1_5 Forward -158 -139 -8.35868 0.298
NP_442689.1_3 Reverse -170 -189 18.1907 0.109
NP_441349.1_10 Forward -167 -148 6.78429 0.0342
NP_441349.1_10 Reverse -138 -157 6.39097 0.0364
NP_441409.1_6 Reverse -142 -161 -9.24366 0.18
NP_441409.1_6 Forward -163 -144 -14.3569 0.255
NP_439960.1_3 Reverse -124 -143 6.29264 0.202
NP_439960.1_10 Reverse -141 -159 -1.55415 0.242
NP_440474.1_8 Reverse -149 -163 15.3386 0.0566
NP_441477.1_10 Reverse -141 -159 4.14905 0.203
NP_441124.1_5 Reverse -333 -343 10.8118 0.283
NP_442450.1_5 Forward -159 -149 9.32148 0.115
NP_442450.1_5 Reverse -320 -330 6.17489 0.197
NP_442168.1_5 Forward -77 -58 4.12936 0.218
NP_440588.1_2 Reverse -139 -158 16.2241 0.0113
NP_440588.1_2 Forward -340 -321 0.392778 0.147
NP_440588.1_2 Reverse -121 -140 -5.40875 0.25
NP_440195.1_5 Forward -163 -144 8.75091 0.17
NP_440195.1_5 Reverse -9 -28 4.81767 0.268
NP_442006.1_2 Reverse -371 -388 -14.3175 0.203
NP_441003.1_9 Reverse -232 -251 4.32602 0.281
NP_442243.1_1 Reverse -142 -160 10.9331 0.121
NP_441570.1_1 Forward -157 -139 -9.12563 0.129
NP_441570.1_1 Reverse -148 -166 -9.91228 0.153
NP_441078.1_4 Forward -157 -148 19.6659 0.0007
NP_441078.1_4 Reverse -148 -157 19.6659 0.0007
NP_441078.1_4 Reverse -124 -133 -1.37691 0.254
NP_441078.1_4 Forward -133 -124 -1.47524 0.266
NP_441078.1_4 Reverse -322 -331 -2.06522 0.295
NP_442729.1_5 Reverse -321 -331 9.32148 0.235
NP_441091.1_5 Forward -109 -90 6.68596 0.208
NP_441094.1_6 Forward -164 -147 10.9528 0.257
NP_440526.1_3 Forward -156 -145 8.02298 0.126
NP_440526.1_3 Reverse -149 -160 1.92649 0.267
NP_441432.1_8 Reverse -147 -156 16.8143 0.00595
NP_441432.1_8 Forward -158 -149 8.25953 0.0755
NP_442320.1_8 Forward -163 -149 24.6807 0.00275
NP_442320.1_8 Forward -337 -323 -3.54032 0.124
NP_442320.1_8 Reverse -142 -156 -4.22864 0.151
NP_442344.1_7 Reverse -149 -168 -4.81876 0.168
NP_441732.1_2 Reverse -144 -160 -16.1661 0.165
NP_441732.1_2 Forward -161 -145 -16.4611 0.167
NP_441732.1_2 Reverse -324 -340 -17.7394 0.292
NP_440760.1_1 Forward -157 -138 -15.4385 0.147
NP_440760.1_1 Reverse -328 -347 -22.9117 0.274
NP_442797.1_7 Reverse -141 -159 -1.55415 0.299
NP_440199.1_10 Forward -160 -150 14.533 0.0861
NP_442178.1_1 Forward -172 -153 18.9773 0.129
NP_442407.1_2 Reverse -361 -380 16.1249 0.105
NP_442489.1_7 Forward -157 -148 20.1576 0.000695
NP_442489.1_7 Reverse -148 -157 20.1576 0.000695
NP_442489.1_7 Reverse -124 -133 -1.37691 0.195
NP_442489.1_7 Forward -133 -124 -1.47524 0.203
NP_442489.1_7 Reverse -322 -331 -1.57357 0.213
NP_440941.1_1 Reverse -182 -192 15.123 0.278
NP_442079.1_6 Reverse -314 -333 14.6508 0.273
NP_442079.1_7 Reverse -317 -336 6.09597 0.166
NP_440559.1_1 Forward -156 -147 17.4043 0.00658
NP_440559.1_1 Reverse -149 -158 8.75118 0.0586
NP_442763.1_10 Reverse -155 -174 1.86774 0.265
NP_441659.2_8 Forward -157 -147 18.1713 0.00133
NP_441659.2_8 Reverse -148 -158 11.9764 0.0147
NP_441659.2_8 Forward -198 -188 0.275027 0.27
NP_440363.1_9 Forward -102 -84 13.5888 0.249
NP_442913.1_10 Reverse -139 -158 -0.590531 0.161
NP_441040.1_5 Reverse -119 -138 7.96426 0.229
NP_439956.1_7 Reverse -178 -197 10.7175 0.252
NP_440779.1_5 Reverse -148 -165 -15.0058 0.3
NP_442346.1_5 Reverse -147 -157 16.6963 0.00248
NP_442346.1_5 Forward -158 -148 9.02648 0.118
NP_442346.1_5 Reverse -123 -133 6.66654 0.195
NP_442346.1_5 Forward -134 -124 5.19158 0.256
NP_440545.1_3 Reverse -144 -161 -5.1727 0.242
NP_440025.1_3 Reverse -360 -374 11.1917 0.29
NP_440025.1_4 Forward -101 -82 13.1758 0.222
NP_441629.1_3 Forward -251 -232 -4.1312 0.29
NP_440486.1_6 Reverse -117 -136 7.7676 0.26
NP_440486.1_9 Reverse -138 -152 12.7826 0.274
NP_440459.1_2 Forward -159 -142 11.7402 0.166
NP_440010.1_4 Forward -109 -90 2.6536 0.222
NP_442551.1_4 Reverse -122 -137 4.40479 0.245
NP_442551.1_4 Forward -135 -120 -2.18338 0.256
NP_442603.1_7 Forward -157 -143 19.7634 0.00895
NP_442603.1_7 Forward -331 -317 10.3237 0.129
NP_442603.1_7 Reverse -29 -43 9.14375 0.155
NP_441888.1_7 Reverse -143 -157 3.73617 0.225
NP_441948.1_4 Forward -164 -146 -3.6191 0.201
NP_440170.1_5 Forward -167 -148 10.4225 0.134
NP_441833.1_4 Forward -156 -149 15.9687 0.0124
NP_441833.1_4 Reverse -149 -156 15.9687 0.0124
NP_441895.1_2 Reverse -166 -185 -17.7001 0.234
NP_441112.1_6 Reverse -370 -389 -3.73712 0.296
NP_442162.1_9 Forward -156 -149 16.2637 0.0124
NP_442162.1_9 Reverse -149 -156 16.2637 0.0124
NP_440671.1_4 Forward -163 -149 16.4209 0.0288
NP_440671.1_4 Reverse -142 -156 9.14437 0.184
NP_440671.1_4 Forward -105 -91 8.94771 0.188
NP_440671.1_4 Reverse -316 -330 5.50613 0.281
NP_440224.1_1 Reverse -137 -156 1.37609 0.132
NP_442199.1_5 Forward -165 -146 4.12936 0.112
NP_442140.1_3 Forward -156 -146 10.3048 0.0902
NP_442140.1_3 Reverse -149 -159 8.33817 0.119
NP_440951.1_6 Forward -341 -322 15.7324 0.282
NP_441671.1_6 Forward -330 -311 8.35759 0.179
NP_440875.1_9 Reverse -150 -160 8.37203 0.233
NP_440875.1_9 Forward -155 -145 8.37203 0.233
NP_440875.1_9 Forward -191 -181 7.78801 0.255
NP_441813.1_5 Reverse -146 -156 18.1713 0.00743
NP_441813.1_5 Forward -159 -149 17.188 0.00979
NP_440590.1_4 Forward -156 -143 12.8023 0.013
NP_440590.1_4 Reverse -149 -162 3.26421 0.0749
NP_440590.1_4 Forward -37 -24 -5.38892 0.277
NP_440567.1_1 Reverse -149 -163 10.226 0.0385
NP_440567.1_1 Forward -156 -142 -0.688726 0.298
NP_442497.1_10 Forward -156 -147 10.4228 0.0087
NP_442497.1_10 Reverse -149 -158 10.4228 0.0087
NP_442497.1_10 Forward -330 -321 0.196389 0.208
NP_440821.1_4 Forward -159 -149 19.0562 0.00399
NP_440821.1_4 Reverse -146 -156 9.41981 0.0286
NP_440821.1_4 Reverse -320 -330 0.373358 0.18
NP_440227.1_10 Reverse -23 -42 13.7649 0.193
NP_441239.1_9 Forward -159 -147 13.3137 0.037
NP_441239.1_9 Forward -297 -285 11.347 0.0627
NP_441239.1_9 Forward -333 -321 7.80712 0.148
NP_441239.1_9 Reverse -146 -158 7.80712 0.148
NP_441239.1_9 Forward -135 -123 6.03717 0.202
NP_441239.1_9 Forward -195 -183 5.05386 0.231
NP_442270.1_9 Reverse -137 -156 -8.94866 0.226
NP_442643.1_1 Forward -163 -144 -0.590531 0.143
NP_441017.1_6 Forward -161 -147 12.487 0.217
NP_441017.1_6 Reverse -318 -332 11.1104 0.279
NP_442216.1_4 Forward -22 -14 8.1805 0.255
NP_440354.1_7 Forward -337 -319 7.29564 0.269
NP_442052.1_8 Reverse -122 -132 12.7631 0.253
NP_442809.1_6 Forward -232 -213 1.67108 0.271
NP_440546.1_4 Reverse -148 -158 11.8882 0.0679
NP_440546.1_4 Forward -157 -147 10.046 0.109
NP_440546.1_4 Forward -133 -123 6.55553 0.291
NP_442041.1_5 Reverse -85 -104 -1.57384 0.286
NP_440462.1_4 Reverse -182 -196 7.86607 0.273
NP_440462.1_6 Forward -159 -149 15.418 0.0142
NP_440462.1_6 Reverse -146 -156 9.61647 0.0429
NP_441184.1_3 Forward -108 -89 2.94938 0.293
NP_440868.1_4 Forward -161 -149 8.49544 0.0602
NP_440868.1_4 Reverse -144 -156 8.00379 0.0602
NP_440868.1_4 Reverse -180 -192 -0.452677 0.269
NP_442402.1_6 Forward -378 -369 15.7327 0.241
NP_442402.1_10 Reverse -367 -377 12.7626 0.204
NP_441084.1_6 Reverse -255 -269 12.5437 0.16
NP_442460.1_7 Forward -169 -150 -0.983855 0.292
NP_440696.1_3 Forward -143 -125 -1.16082 0.251
NP_440696.1_6 Reverse -310 -329 3.24438 0.288
NP_440696.1_9 Forward -390 -371 13.3716 0.296
NP_442039.1_4 Forward -156 -149 15.1821 0.0124
NP_442039.1_4 Reverse -149 -156 15.1821 0.0124
NP_442837.1_3 Forward -156 -149 15.7721 0.0124
NP_442837.1_3 Reverse -149 -156 15.7721 0.0124
NP_441760.1_1 Forward -144 -125 15.4374 0.14
NP_440160.1_2 Reverse -84 -103 -6.29373 0.28
NP_440160.1_2 Reverse -129 -148 -9.047 0.293
NP_439994.1_3 Forward -158 -139 11.9504 0.166
NP_439994.1_4 Forward -135 -116 9.43923 0.28
NP_442053.1_1 Forward -157 -148 18.3876 0.0007
NP_442053.1_1 Reverse -148 -157 18.3876 0.0007
NP_442053.1_1 Forward -331 -322 4.32629 0.254
NP_440505.1_3 Reverse -146 -156 18.3679 0.00213
NP_440505.1_3 Forward -159 -149 13.8447 0.0247
NP_440505.1_3 Forward -40 -30 4.3066 0.3
NP_441203.1_1 Forward -156 -137 -10.227 0.137
NP_441203.1_1 Forward -330 -311 -15.1435 0.214
NP_441203.1_1 Forward -89 -70 -19.3717 0.297
NP_442532.1_7 Reverse -322 -336 4.42448 0.171
NP_441408.2_7 Forward -75 -56 -5.11376 0.291
NP_440914.1_1 Forward -157 -147 17.5935 0.000537
NP_440914.1_1 Reverse -148 -158 8.6151 0.186
NP_440914.1_1 Reverse -85 -95 7.24882 0.242
NP_441011.1_8 Reverse -149 -158 16.9127 0.00602
NP_441011.1_8 Forward -156 -147 8.25953 0.144
NP_441011.1_8 Reverse -65 -74 5.3096 0.271
NP_442931.1_8 Forward -184 -165 3.93269 0.232
NP_442533.1_1 Forward -41 -22 -12.1936 0.236
NP_442533.1_6 Forward -157 -148 17.2076 0.00137
NP_442533.1_6 Reverse -148 -157 17.2076 0.00137
NP_442533.1_6 Reverse -124 -133 13.8644 0.0178
NP_442533.1_6 Forward -133 -124 7.17789 0.0948
NP_442533.1_6 Forward -193 -184 4.0313 0.194
NP_442533.1_6 Reverse -29 -38 3.7363 0.204
NP_442533.1_6 Reverse -130 -139 3.63797 0.206
NP_442533.1_6 Forward -99 -90 1.86802 0.284
NP_442541.1_10 Reverse -124 -138 4.71887 0.248
NP_442322.1_4 Forward -396 -379 -9.40158 0.295
NP_442322.1_4 Forward -196 -179 -9.49991 0.295
NP_443016.1_1 Forward -294 -275 -6.98204 0.265
NP_442535.1_9 Reverse -139 -157 4.6407 0.159
NP_441482.1_7 Reverse -142 -156 8.84938 0.0162
NP_441482.1_7 Forward -199 -185 -7.08024 0.193
NP_441482.1_7 Forward -163 -149 -9.04686 0.193
NP_441482.1_7 Reverse -124 -138 -9.44018 0.202
NP_441482.1_7 Reverse -316 -330 -11.2101 0.245
NP_439944.1_9 Forward -156 -146 10.5014 0.0887
NP_439944.1_9 Reverse -149 -159 10.3048 0.0887
NP_441028.1_6 Forward -177 -167 14.6309 0.158
NP_441028.1_6 Reverse -30 -40 10.6976 0.197
NP_441028.1_6 Reverse -139 -149 8.73102 0.216
NP_442202.1_10 Forward -251 -237 5.89945 0.255
NP_442202.1_10 Forward -194 -180 3.53951 0.278
NP_440116.1_8 Forward -156 -137 0.786102 0.0948
NP_441527.1_7 Forward -195 -176 11.5033 0.282
NP_440115.1_6 Reverse -145 -155 16.008 0.0325
NP_440007.1_4 Forward -168 -149 11.4058 0.251
NP_440007.1_9 Forward -103 -89 7.47274 0.208
NP_440007.1_9 Reverse -87 -101 2.85119 0.277
NP_440007.1_9 Reverse -25 -39 1.76955 0.285
NP_439965.1_1 Forward -166 -147 5.80098 0.076
NP_439965.1_1 Reverse -139 -158 -8.94866 0.28
NP_441602.1_3 Reverse -179 -198 -1.57384 0.229
NP_441106.1_1 Forward -158 -149 18.191 0.0028
NP_441106.1_1 Reverse -147 -156 9.63616 0.0311
NP_439903.1_6 Forward -142 -123 9.53674 0.122
NP_439903.1_6 Forward -108 -89 -0.984623 0.289
NP_439903.1_6 Reverse -87 -106 -1.37794 0.299
NP_442306.1_10 Reverse -143 -162 -19.3717 0.197
NP_441286.1_1 Reverse -147 -159 14.4936 0.00418
NP_441286.1_1 Forward -158 -146 3.38223 0.0467
NP_440670.1_8 Forward -157 -148 18.3876 0.000699
NP_440670.1_8 Reverse -148 -157 18.3876 0.000699
NP_441647.1_8 Forward -302 -283 15.4366 0.248
NP_440886.1_7 Forward -158 -148 17.7774 0.0011
NP_440886.1_7 Forward -242 -232 11.6809 0.0805
NP_440886.1_7 Forward -332 -322 8.14104 0.0805
NP_440886.1_7 Reverse -147 -157 7.94438 0.0805
NP_440886.1_7 Reverse -28 -38 4.01116 0.255
NP_440886.1_7 Forward -387 -377 3.61784 0.272
NP_442614.1_2 Forward -157 -143 9.04604 0.242
NP_442072.1_9 Forward -158 -140 -23.0886 0.277
NP_442401.1_3 Reverse -381 -400 12.9791 0.254
NP_440907.2_8 Reverse -149 -159 7.84605 0.117
NP_440907.2_8 Forward -192 -182 5.09279 0.222
NP_440907.2_8 Forward -197 -187 4.89613 0.235
NP_441021.1_1 Forward -156 -137 -5.31042 0.177
NP_441021.1_1 Forward -330 -311 -8.26035 0.194
NP_441021.1_1 Reverse -131 -150 -10.7186 0.246
NP_441021.1_8 Reverse -143 -161 2.87075 0.238
NP_440841.1_4 Reverse -320 -339 -4.13045 0.185
NP_440841.1_4 Reverse -146 -165 -5.70374 0.208
NP_441463.1_3 Forward -167 -148 17.404 0.0126
NP_441463.1_3 Forward -251 -232 -4.22878 0.198
NP_441626.1_2 Forward -156 -149 15.7721 0.0124
NP_441626.1_2 Reverse -149 -156 15.7721 0.0124
NP_442365.1_7 Reverse -144 -163 -5.50708 0.271
NP_442238.1_1 Forward -105 -86 -0.000545616 0.295
NP_442794.1_1 Reverse -144 -156 20.0002 0.00523
NP_442794.1_1 Forward -103 -91 5.64384 0.212
NP_442615.1_1 Forward -166 -148 15.3588 0.00922
NP_442615.1_1 Reverse -139 -157 3.3624 0.0549
NP_441962.1_5 Forward -336 -317 5.70265 0.29
NP_441796.1_8 Reverse -315 -333 14.0805 0.172
NP_440387.1_1 Forward -157 -141 4.3851 0.0426
NP_440855.1_5 Reverse -146 -165 3.14526 0.287
NP_441488.1_8 Reverse -143 -157 10.717 0.146
NP_441836.1_2 Forward -163 -144 0.196116 0.206
NP_441993.1_1 Forward -163 -144 7.01447 0.176
NP_441993.1_1 Forward -150 -131 4.48058 0.22
NP_441993.1_1 Forward -157 -138 1.06957 0.285
NP_439938.1_4 Reverse -9 -28 12.9791 0.28
NP_440114.1_10 Reverse -148 -162 17.8958 0.00824
NP_442698.1_10 Forward -137 -118 0.196116 0.297
NP_442323.1_7 Reverse -143 -162 8.35677 0.163
NP_442323.1_7 Reverse -229 -248 0.981987 0.293
NP_440293.1_9 Forward -138 -124 9.70148 0.285
NP_440766.1_4 Reverse -144 -158 8.75105 0.0871
NP_439988.1_7 Forward -158 -144 11.7987 0.292
NP_441237.1_6 Forward -133 -116 7.02034 0.166
NP_442743.1_4 Forward -156 -137 -7.96535 0.284
NP_442743.1_5 Reverse -149 -168 8.65258 0.148
NP_439910.1_2 Forward -165 -148 -2.91109 0.0305
NP_440457.1_1 Reverse -318 -330 14.002 0.0753
NP_440457.1_1 Reverse -144 -156 7.61046 0.101
NP_440457.1_1 Reverse -185 -197 4.16888 0.171
NP_440457.1_1 Forward -161 -149 0.0389777 0.25
NP_441801.1_4 Reverse -368 -378 2.53664 0.292
NP_441984.1_3 Forward -392 -374 6.41066 0.269
NP_440054.1_4 Forward -249 -230 14.4541 0.135
NP_441332.1_6 Forward -332 -322 11.3563 0.261
NP_442509.1_9 Reverse -148 -158 16.2041 0.00739
NP_442509.1_9 Forward -157 -147 8.14104 0.192
NP_441253.1_1 Reverse -132 -151 5.211 0.264
NP_443037.1_7 Reverse -274 -293 -4.03212 0.276
NP_440524.1_2 Forward -329 -310 0.491109 0.27
NP_442514.1_5 Forward -389 -370 -5.80282 0.263
NP_442514.1_5 Forward -331 -312 -9.83437 0.298
NP_440554.1_4 Reverse -149 -159 14.6313 0.02
NP_440554.1_4 Forward -156 -146 8.92815 0.0646
NP_441761.1_1 Forward -330 -311 3.44104 0.265
NP_441885.1_5 Forward -157 -147 20.9245 0.000538
NP_441885.1_5 Reverse -148 -158 11.4848 0.00668
NP_441885.1_5 Reverse -29 -39 -1.00328 0.248
NP_440478.1_10 Forward -159 -145 9.14437 0.257
NP_442310.1_1 Forward -141 -122 10.7175 0.284
NP_442341.1_7 Forward -39 -25 13.8643 0.0334
NP_442341.1_7 Reverse -147 -161 10.0294 0.0682
NP_442341.1_7 Forward -158 -144 9.2427 0.0751
NP_442341.1_7 Forward -332 -318 7.66941 0.0994
NP_442341.1_7 Reverse -363 -377 6.88276 0.116
NP_442341.1_9 Forward -159 -145 7.76712 0.187
NP_442341.1_9 Reverse -88 -102 5.60385 0.263
NP_441173.1_9 Reverse -200 -208 12.9004 0.206
NP_440119.1_1 Forward -390 -374 3.40179 0.179
NP_442395.2_4 Forward -158 -139 5.99684 0.152
NP_440191.1_4 Reverse -112 -122 12.7603 0.291
NP_440423.1_6 Forward -165 -146 -15.5368 0.229
NP_443000.1_7 Reverse -146 -156 19.9412 0.00223
NP_443000.1_7 Forward -159 -149 8.73149 0.0437
NP_443000.1_7 Forward -141 -131 4.50326 0.188
NP_441842.1_10 Forward -164 -150 14.1593 0.0636
NP_440275.1_3 Reverse -146 -156 15.123 0.0182
NP_440275.1_3 Forward -159 -149 8.4365 0.0602
NP_440091.1_1 Forward -161 -149 18.3285 0.0114
NP_441902.1_3 Reverse -79 -89 16.1885 0.159
NP_442451.1_2 Reverse -140 -159 -9.73531 0.259
NP_440149.1_8 Forward -157 -138 3.73603 0.0903
NP_441105.1_3 Forward -168 -149 -2.65548 0.165
NP_441105.1_6 Forward -104 -85 18.7807 0.181
NP_440216.1_1 Forward -157 -143 9.2427 0.00589
NP_440216.1_1 Reverse -148 -162 6.29277 0.0156
NP_440172.1_1 Forward -157 -147 15.0247 0.00945
NP_440172.1_1 Reverse -148 -158 8.73149 0.0586
NP_440172.1_1 Forward -99 -89 4.60159 0.178
NP_442371.1_1 Forward -377 -367 13.9425 0.191
NP_442015.1_10 Reverse -144 -157 21.1604 0.00329
NP_442015.1_10 Forward -161 -148 0.904263 0.216
NP_441226.1_7 Forward -156 -149 14.4934 0.0123
NP_441226.1_7 Reverse -149 -156 14.4934 0.0123
NP_441226.1_7 Reverse -91 -98 9.47853 0.147
NP_441226.1_7 Forward -197 -190 8.29857 0.205
NP_441226.1_7 Forward -192 -185 8.29857 0.205
NP_441111.1_7 Forward -156 -148 18.7023 0.00294
NP_441111.1_7 Reverse -149 -157 18.7023 0.00294
NP_441766.1_2 Forward -157 -148 17.5026 0.00297
NP_441766.1_2 Reverse -148 -157 17.5026 0.00297
NP_442417.1_5 Forward -157 -143 7.37441 0.19
NP_442252.1_3 Forward -164 -146 18.5054 0.0602
NP_442252.1_3 Forward -248 -230 13.3922 0.11
NP_442252.1_6 Forward -180 -161 20.2556 0.043
NP_440416.1_1 Reverse -148 -167 -12.1936 0.272
NP_440416.1_1 Reverse -189 -208 -14.4552 0.288
NP_440416.1_9 Forward -164 -145 -4.6221 0.0783
NP_440416.1_9 Reverse -141 -160 -8.94866 0.123
NP_443052.1_8 Forward -167 -148 15.2408 0.00763
NP_443052.1_9 Forward -390 -371 2.3594 0.172
NP_442403.1_8 Reverse -234 -253 9.83255 0.142
NP_442154.1_1 Reverse -53 -71 -17.9754 0.273
NP_442046.1_8 Reverse -223 -242 10.9142 0.293
NP_440261.1_5 Forward -156 -143 6.80412 0.0316
NP_440988.1_10 Reverse -152 -166 8.77134 0.205
NP_440988.1_10 Forward -159 -145 5.38289 0.243
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATACCTGGAGCAACCCCTGCCTCCTGGGGAAATTGACGAGATGTTTCGACTGCAAGAAGATTTTGCTACCTCCATCGCCCTAGACGAAGCGGTATGCAGCTTAGCTCAACTCGCCCAACTCTACGATAAAGGTTGGTCCGGGCTTTACATCCTCAAAGCCGCCATCATGGGGAATCCTAGGGTACTGAACCATTGGTTAAAAACCCATCCCATCCCCGCCATTTTTTCCTCCGTGTTTGAAACGGCGATCGCCAGGGGTCAAGTGTTGGCCCTGGCCCAAAAGTGGAACTTACCAGACCATGCCGTTGGCTTTGCTCCCCTAAGGGAACCCATAACAGAGGCCACCCCGGACTCGGTATGATGGGGATCAGCGTTGTTTAATGCCCCCTTTAGATTGACT

CDS

GTGAGTGATTCCCCCAAGCCCCAATTACCCCCAAGCCCCCAGGGAGACCATTGTCTAGTTCACCAACAGGAACTGGAAGCTGTGACCGAAAAGTGGTTTGAGATTATGGTCCGGGTACAACCCCACCACACTGATTACGGCGGCGTTGTTTGGCATGGCACCTACCTAACCTGGCTGGAAACCGCCCGAGTGGAATGTTTGCGGTCCATTGGAGTGGATTTTGCCGACTTGGTCAAGCTGGGTTGTGATTTACCTGTGGTGAGCCTGGCCCTACGGTACCACCGAGCCATCCGCTTGGGACAAACAGCAGTGATTAAAGTGCAAATGCAAGAAATTCAGAAAGTGCGGCTGGAATGGCAAAATCAAATTGTTTGTCTGGAAACCGGGGAACCCTGTGTAACTGGCAAAATTACCCTAGTGGCGATCGACCCTGCCAAGGGCAAAATTATGCGCCGTTTACCACCGGTGGTACAGGAACATTTACTAAAGCTGAGACAGTGA

Protein

MSDSPKPQLPPSPQGDHCLVHQQELEAVTEKWFEIMVRVQPHHTDYGGVVWHGTYLTWLETARVECLRSIGVDFADLVKLGCDLPVVSLALRYHRAIRLGQTAVIKVQMQEIQKVRLEWQNQIVCLETGEPCVTGKITLVAIDPAKGKIMRRLPPVVQEHLLKLRQ