Your browser is old and dusty. Try Google Chrome!

Details for sll0401

ORF sll0401
Accession NP_442192.1
Symbol
Category TCA cycle
Definition citrate synthase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -396 -382 -0.885388 0.242
NP_440557.1_1 Forward -390 -371 0.196116 0.265
NP_440795.1_7 Reverse -389 -396 10.2655 0.154
NP_440561.1_4 Forward -387 -368 15.4476 0.198
NP_441818.1_1 Forward -65 -54 9.79292 0.232
NP_441098.1_3 Forward -57 -38 -6.78896 0.285
NP_440150.1_6 Forward -213 -194 0.58944 0.297
NP_440996.1_3 Reverse -381 -399 13.5888 0.221
NP_441976.1_1 Forward -218 -199 11.6025 0.233
NP_440061.1_9 Reverse -55 -69 12.0937 0.102
NP_440061.1_9 Reverse -61 -75 6.78381 0.232
NP_440061.1_9 Forward -257 -243 5.1122 0.294
NP_440110.1_4 Reverse -69 -88 7.07928 0.145
NP_441476.1_5 Forward -396 -377 -5.70374 0.267
NP_440878.1_4 Reverse -360 -378 16.4404 0.181
NP_442062.1_3 Forward -306 -287 -1.96717 0.265
NP_440304.1_4 Reverse -374 -384 3.22496 0.299
NP_440304.1_4 Forward -236 -226 2.04498 0.299
NP_441594.1_6 Reverse -373 -392 1.86774 0.261
NP_442367.1_1 Reverse -62 -81 -13.1769 0.264
NP_441925.1_4 Reverse -64 -83 -17.0125 0.287
NP_441925.1_4 Reverse -65 -84 -17.6025 0.297
NP_441083.1_3 Forward -73 -63 13.9425 0.195
NP_441083.1_3 Reverse -62 -72 12.0743 0.287
NP_441558.1_5 Forward -243 -224 4.12936 0.29
NP_441955.1_8 Forward -216 -199 12.5269 0.199
NP_442889.1_1 Forward -151 -132 -12.1936 0.224
NP_441025.1_10 Reverse -175 -191 18.5448 0.101
NP_441792.1_1 Forward -386 -367 4.62101 0.286
NP_441716.1_1 Reverse -63 -77 5.89945 0.211
NP_441327.1_1 Forward -122 -103 3.25228 0.277
NP_440403.1_4 Reverse -202 -221 -6.98204 0.236
NP_441012.1_4 Forward -395 -382 13.1956 0.224
NP_441012.1_4 Forward -27 -14 9.55739 0.272
NP_441012.1_4 Forward -70 -57 7.98409 0.272
NP_443018.1_3 Reverse -389 -396 4.36568 0.254
NP_443018.1_3 Forward -396 -389 4.07068 0.299
NP_441634.1_8 Forward -74 -60 -3.83532 0.295
NP_441634.1_9 Forward -77 -58 11.6017 0.244
NP_440376.1_1 Forward -83 -74 9.04618 0.0407
NP_442687.1_7 Forward -235 -225 4.20827 0.262
NP_442687.1_7 Forward -365 -355 4.0116 0.271
NP_442191.1_4 Reverse -202 -216 13.417 0.15
NP_442485.1_3 Reverse -377 -396 1.27776 0.23
NP_441846.1_10 Reverse -201 -220 -12.9802 0.197
NP_440642.1_10 Reverse -302 -316 1.5723 0.29
NP_441422.1_7 Forward -213 -196 -5.86102 0.247
NP_440533.1_6 Forward -148 -129 11.7992 0.244
NP_442658.1_1 Reverse -7 -17 5.97777 0.242
NP_440141.1_8 Reverse -379 -398 3.93269 0.296
NP_442782.1_2 Forward -234 -220 0.491246 0.289
NP_442782.1_2 Forward -83 -69 0.294584 0.291
NP_442205.1_9 Reverse -209 -225 -0.236458 0.264
NP_441414.1_6 Reverse -294 -313 -3.93378 0.25
NP_442816.1_9 Forward -82 -63 19.8614 0.121
NP_439905.1_2 Forward -390 -376 14.3559 0.188
NP_441097.1_2 Reverse -203 -220 23.245 0.0261
NP_442536.1_8 Reverse -376 -395 16.9124 0.135
NP_443044.1_4 Reverse -253 -267 20.9441 0.247
NP_441129.1_3 Reverse -197 -216 -16.8151 0.281
NP_441099.1_5 Forward -220 -201 -10.6203 0.258
NP_442002.1_1 Reverse -199 -217 -1.84914 0.2
NP_442438.1_10 Reverse -159 -173 -0.590395 0.269
NP_441000.1_6 Forward -211 -197 3.14618 0.118
NP_440147.1_4 Forward -366 -353 4.24752 0.167
NP_441550.1_8 Forward -366 -356 5.58445 0.242
NP_441916.1_10 Reverse -368 -387 3.83436 0.225
NP_440206.1_4 Reverse -64 -83 3.24359 0.282
NP_440206.1_4 Reverse -59 -78 -0.29631 0.29
NP_440983.1_5 Forward -400 -381 -0.295539 0.227
NP_440983.1_5 Reverse -358 -377 -6.88371 0.28
NP_441514.1_1 Forward -308 -298 16.4459 0.274
NP_441514.1_6 Reverse -369 -376 12.7238 0.29
NP_440018.1_3 Reverse -57 -76 14.3558 0.13
NP_442847.1_3 Reverse -59 -78 4.42355 0.281
NP_442575.1_8 Forward -252 -233 -6.68705 0.286
NP_442215.1_2 Reverse -120 -136 -6.33298 0.268
NP_442029.1_10 Forward -218 -199 15.2408 0.145
NP_442142.1_4 Forward -388 -375 2.57534 0.286
NP_440919.1_1 Forward -136 -117 -6.39206 0.258
NP_443009.1_5 Reverse -246 -257 4.77807 0.23
NP_441468.1_1 Reverse -389 -396 4.46401 0.224
NP_441876.1_9 Reverse -126 -136 12.8609 0.267
NP_441826.1_2 Reverse -376 -390 -0.885388 0.228
NP_442868.1_6 Forward -399 -389 0.57002 0.217
NP_442719.1_2 Reverse -265 -283 -9.91296 0.268
NP_442677.1_3 Reverse -119 -138 -5.11376 0.287
NP_441612.1_2 Reverse -218 -228 11.8409 0.21
NP_442227.1_2 Forward -395 -376 -3.73712 0.295
NP_441101.1_3 Forward -210 -191 13.5691 0.251
NP_442775.1_6 Forward -396 -377 15.3391 0.236
NP_441882.1_6 Forward -272 -253 8.45592 0.111
NP_442542.1_9 Reverse -381 -395 5.60385 0.26
NP_440558.1_2 Forward -75 -56 -0.787193 0.204
NP_440558.1_2 Forward -81 -62 -6.39206 0.274
NP_442789.1_4 Reverse -377 -396 -3.14714 0.246
NP_441878.1_6 Forward -73 -63 0.275027 0.146
NP_441878.1_6 Reverse -62 -72 0.275027 0.146
NP_441878.1_6 Forward -242 -232 -7.78811 0.266
NP_441445.1_1 Forward -373 -354 8.25926 0.122
NP_442267.1_4 Forward -74 -55 8.94757 0.143
NP_442777.1_1 Forward -392 -373 4.03023 0.3
NP_442192.1_1 Forward -367 -348 29.9904 0.000598
NP_442192.1_2 Forward -294 -275 25.5655 0.00559
NP_442192.1_3 Forward -346 -327 22.8122 0.0568
NP_442192.1_4 Forward -229 -210 27.5312 0.00121
NP_442192.1_5 Forward -319 -300 20.2556 0.044
NP_442192.1_6 Forward -383 -369 19.4691 0.248
NP_442192.1_8 Forward -82 -63 19.764 0.0812
NP_442183.1_3 Reverse -338 -357 16.0265 0.241
NP_442347.1_2 Reverse -138 -147 4.71961 0.266
NP_442645.1_2 Forward -80 -61 -22.0267 0.29
NP_440547.1_1 Reverse -374 -393 16.6165 0.109
NP_441037.1_4 Forward -133 -123 5.85583 0.296
NP_440151.1_2 Forward -379 -361 19.5862 0.138
NP_441633.1_3 Forward -324 -311 -6.86388 0.277
NP_442590.1_9 Forward -355 -336 4.03102 0.277
NP_442590.1_10 Reverse -358 -377 3.73603 0.286
NP_442998.1_5 Reverse -343 -353 13.1564 0.158
NP_442998.1_5 Reverse -185 -195 8.73149 0.261
NP_440731.1_2 Reverse -370 -389 9.43923 0.275
NP_440899.1_8 Forward -280 -261 -11.1119 0.296
NP_441007.1_10 Reverse -383 -396 1.39592 0.203
NP_442201.1_10 Forward -77 -58 -14.3569 0.281
NP_440256.1_1 Reverse -11 -30 -7.4737 0.238
NP_440164.1_2 Forward -300 -281 6.39097 0.237
NP_441464.1_10 Reverse -302 -316 8.06273 0.287
NP_442386.1_9 Forward -314 -305 8.2591 0.205
NP_442386.1_9 Forward -398 -389 5.11253 0.266
NP_441750.1_1 Forward -95 -76 -13.1769 0.3
NP_441340.1_5 Forward -396 -389 3.97235 0.274
NP_442791.1_5 Forward -392 -373 -7.4737 0.279
NP_440327.1_3 Reverse -335 -354 15.6341 0.286
NP_441232.1_2 Forward -244 -225 6.78429 0.273
NP_439937.1_8 Reverse -380 -399 -0.0988766 0.237
NP_439937.1_8 Forward -399 -380 -1.57384 0.249
NP_440408.1_3 Reverse -376 -395 -4.13045 0.264
NP_440408.1_7 Reverse -370 -389 6.78429 0.299
NP_441803.1_2 Forward -396 -377 6.58763 0.151
NP_440139.1_1 Reverse -195 -214 2.75194 0.224
NP_442384.1_10 Reverse -355 -368 2.37923 0.228
NP_440344.1_10 Forward -398 -381 -9.59759 0.15
NP_442693.1_7 Reverse -56 -75 7.96426 0.276
NP_440297.1_9 Forward -396 -386 0.471689 0.282
NP_442280.1_10 Forward -383 -365 5.64923 0.283
NP_440894.1_10 Forward -225 -206 6.19431 0.221
NP_440894.1_10 Forward -396 -377 5.60432 0.228
NP_440208.1_1 Reverse -66 -85 -9.63698 0.257
NP_441469.1_8 Reverse -387 -396 13.5694 0.073
NP_441469.1_8 Forward -392 -383 7.86621 0.227
NP_443064.1_8 Reverse -337 -347 15.4175 0.286
NP_440220.1_4 Reverse -291 -310 -2.75457 0.282
NP_442428.1_5 Reverse -389 -396 4.759 0.223
NP_440783.1_2 Reverse -276 -295 -6.1954 0.281
NP_441443.1_1 Forward -83 -64 -4.91709 0.297
NP_442120.1_10 Reverse -376 -395 -3.54046 0.199
NP_441867.1_2 Forward -355 -336 -6.29373 0.189
NP_441867.1_2 Reverse -373 -392 -20.3551 0.291
NP_440673.1_3 Forward -383 -376 6.23397 0.283
NP_442219.1_8 Forward -357 -338 6.71761 0.291
NP_441884.1_4 Forward -361 -342 6.58763 0.171
NP_441004.1_1 Reverse -376 -395 -7.96535 0.2
NP_442813.1_4 Forward -272 -253 -7.76869 0.299
NP_441115.1_4 Reverse -171 -189 9.45814 0.213
NP_442308.1_8 Reverse -57 -76 8.65258 0.254
NP_442208.1_5 Reverse -55 -74 -9.93197 0.295
NP_442208.1_5 Forward -75 -56 -10.6203 0.299
NP_441349.1_10 Reverse -64 -83 -6.98204 0.239
NP_440389.1_2 Forward -83 -64 11.3075 0.287
NP_441107.1_10 Forward -398 -384 17.8958 0.231
NP_440474.1_8 Forward -396 -382 6.39049 0.227
NP_440943.1_5 Forward -272 -258 13.2743 0.24
NP_442006.1_2 Reverse -370 -387 -15.5958 0.228
NP_442006.1_3 Forward -76 -58 -6.86402 0.298
NP_442729.1_4 Reverse -246 -265 16.5182 0.181
NP_442729.1_8 Reverse -307 -320 5.82081 0.228
NP_441432.1_8 Forward -18 -9 2.65466 0.292
NP_440497.1_2 Reverse -377 -396 5.40766 0.287
NP_441057.1_3 Forward -361 -342 -11.0136 0.214
NP_440913.1_1 Reverse -374 -392 9.45892 0.178
NP_442489.1_2 Forward -324 -305 1.57275 0.285
NP_442749.1_5 Forward -133 -116 12.7548 0.159
NP_442008.1_2 Forward -370 -351 5.89931 0.223
NP_440708.1_6 Reverse -125 -144 -10.3253 0.278
NP_442346.1_5 Forward -398 -388 6.56821 0.198
NP_441629.1_1 Forward -242 -223 6.88262 0.253
NP_440555.1_4 Forward -84 -65 9.83255 0.207
NP_440010.1_4 Reverse -375 -394 0.293673 0.25
NP_440010.1_4 Forward -395 -376 -2.06626 0.273
NP_440847.1_3 Reverse -233 -247 11.012 0.275
NP_441948.1_4 Reverse -240 -258 -3.42244 0.193
NP_442060.1_10 Forward -257 -238 13.1758 0.244
NP_442060.1_10 Reverse -194 -213 9.53756 0.25
NP_440671.1_4 Reverse -376 -390 13.8643 0.0748
NP_440671.1_5 Reverse -124 -138 13.4703 0.293
NP_442404.1_9 Forward -400 -386 10.1271 0.263
NP_441973.1_1 Forward -376 -361 -7.98491 0.293
NP_441044.1_4 Reverse -6 -24 0.314141 0.296
NP_441609.1_1 Reverse -179 -198 -1.27885 0.265
NP_441671.1_10 Reverse -240 -259 7.57094 0.205
NP_440875.1_9 Forward -208 -198 9.05339 0.233
NP_440875.1_9 Forward -171 -161 7.88535 0.255
NP_441259.1_4 Reverse -346 -365 16.6174 0.104
NP_440821.1_4 Reverse -386 -396 -0.708283 0.287
NP_441239.1_9 Reverse -61 -73 3.87389 0.272
NP_441239.1_9 Forward -80 -68 3.57889 0.283
NP_441951.1_9 Reverse -64 -83 -0.983855 0.283
NP_441892.1_1 Forward -75 -58 -3.5994 0.244
NP_441892.1_1 Reverse -202 -219 -6.15601 0.298
NP_440665.1_2 Reverse -362 -381 0.687771 0.188
NP_440833.1_6 Reverse -113 -127 11.1104 0.231
NP_442041.1_5 Forward -390 -371 1.27776 0.257
NP_440675.1_4 Forward -350 -331 22.6156 0.0356
NP_442402.1_10 Forward -217 -207 11.2876 0.264
NP_442402.1_10 Forward -121 -111 10.5993 0.287
NP_441848.1_4 Forward -300 -284 7.35968 0.29
NP_441084.1_6 Reverse -258 -272 10.2167 0.25
NP_440696.1_3 Forward -82 -64 -1.16082 0.251
NP_442409.1_5 Reverse -56 -75 12.1925 0.3
NP_441053.1_3 Reverse -198 -217 2.3594 0.244
NP_440505.1_7 Forward -326 -307 1.96607 0.24
NP_442255.1_5 Forward -205 -186 10.5209 0.227
NP_442532.1_4 Forward -123 -105 7.96493 0.289
NP_442533.1_6 Forward -72 -63 4.52295 0.179
NP_442533.1_6 Reverse -63 -72 4.52295 0.179
NP_442533.1_6 Forward -66 -57 2.85133 0.236
NP_442533.1_6 Reverse -232 -241 2.65466 0.246
NP_442533.1_6 Reverse -74 -83 2.26134 0.266
NP_442541.1_10 Reverse -63 -77 20.8451 0.182
NP_442541.1_10 Forward -72 -58 5.1122 0.248
NP_442541.1_10 Reverse -344 -358 1.67063 0.282
NP_443050.1_2 Reverse -242 -261 11.7008 0.147
NP_441482.1_7 Forward -72 -58 -10.4235 0.209
NP_439944.1_9 Reverse -285 -295 5.87989 0.214
NP_441028.1_6 Forward -216 -206 4.30615 0.278
NP_441972.1_5 Reverse -377 -396 -4.72043 0.211
NP_441972.1_5 Forward -219 -200 -7.86702 0.254
NP_440886.1_7 Forward -392 -382 5.19112 0.194
NP_442213.1_6 Reverse -125 -144 9.3409 0.246
NP_440823.1_3 Reverse -232 -251 10.9142 0.237
NP_440028.1_6 Reverse -377 -395 13.7855 0.218
NP_441962.1_4 Forward -22 -3 -11.0136 0.236
NP_440855.1_5 Forward -74 -55 6.48849 0.285
NP_440855.1_5 Reverse -55 -74 1.96529 0.295
NP_441431.1_2 Forward -316 -302 7.17714 0.247
NP_441993.1_1 Forward -89 -70 0.972113 0.288
NP_441993.1_1 Forward -353 -334 0.777198 0.292
NP_442352.1_1 Forward -319 -306 14.9747 0.249
NP_440935.1_1 Forward -281 -262 15.9291 0.257
NP_442090.1_2 Reverse -38 -57 7.4002 0.281
NP_441272.1_4 Forward -92 -73 -0.39387 0.291
NP_440293.1_3 Forward -79 -60 -1.67217 0.239
NP_442867.1_8 Forward -218 -199 3.93269 0.295
NP_440801.1_8 Reverse -337 -356 1.37609 0.246
NP_441332.1_6 Forward -392 -382 11.1627 0.269
NP_440473.1_3 Forward -396 -377 14.3558 0.287
NP_440473.1_9 Reverse -368 -387 -8.85033 0.259
NP_441253.1_7 Reverse -59 -77 9.75391 0.203
NP_440554.1_4 Forward -396 -386 3.42162 0.23
NP_442341.1_9 Forward -86 -72 9.24208 0.155
NP_441173.1_9 Reverse -332 -340 9.75379 0.284
NP_443059.1_2 Forward -235 -216 18.2882 0.271
NP_440091.1_1 Reverse -160 -172 -0.551008 0.278
NP_443060.1_1 Reverse -131 -150 13.5683 0.166
NP_440679.1_10 Reverse -381 -400 -12.3902 0.192
NP_443010.1_10 Reverse -222 -239 3.06069 0.265
NP_439962.1_4 Forward -396 -377 -7.17871 0.288
NP_440149.1_8 Forward -353 -334 -6.98204 0.268
NP_440149.1_10 Forward -89 -70 -11.2103 0.285
NP_441105.1_3 Forward -77 -58 6.78429 0.0579
NP_441105.1_3 Reverse -52 -71 6.4893 0.0605
NP_442373.1_1 Forward -387 -368 -10.6203 0.252
NP_440216.1_1 Reverse -232 -246 -6.09693 0.138
NP_440216.1_1 Reverse -344 -358 -12.5868 0.288
NP_440216.1_9 Forward -311 -302 16.5193 0.128
NP_440678.1_5 Forward -400 -381 12.0942 0.214
NP_442371.1_1 Reverse -102 -112 12.6642 0.245
NP_441852.1_7 Reverse -182 -201 15.2408 0.297
NP_442015.1_10 Reverse -351 -364 1.69091 0.204
NP_441226.1_7 Reverse -202 -209 9.47853 0.147
NP_440416.1_9 Forward -398 -379 -21.6334 0.295
NP_443052.1_8 Reverse -369 -388 -12.4886 0.256
NP_441940.1_4 Reverse -67 -86 8.25926 0.266
NP_442154.1_1 Reverse -380 -398 -4.50408 0.125
NP_442154.1_1 Reverse -377 -395 -8.04399 0.155
NP_442564.1_10 Forward -346 -332 8.25939 0.296
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TATCGCCACCGCAGTCACCGTTGCCTTGCCCTAGTGGGTCATCAGCCGGATTTGGCCAACTGGGCTGAATATCTCACTTTTGGTAGCCCCCAAGGCAAATTAATTGTTAAGAAAGCTGGCATTATTGGTTTAACGTTGCCTTCCTGGGACTGTCCACCGGGTGAAGGGCAACTGTTTTTGCTCACTCCCCCCCGTTGGCTGGTCTAGATCTAGCCCACAATTGATCGAATGATCGAAGCTCGTCGGACCAGTACTGGGCTCAATCCAGGGGTGAAGGTAAATTTCCAGAATTCCTTCAGATTCCCTAATATGGATATGGGGACAGGCTGGCCCGGGCCGGCGCAATTTTTTGTTAATCCAAATCTCTAAGCAACAACAGTAGTGGCATTGTCCGTTATAG

CDS

GTGAATTATATGATGACTGATAACGAAGTGTTTAAAGAAGGCCTAGCCGGAGTCCCCGCCGCTAAATCGAGGGTGAGCCATGTGGATGGCACCGACGGTATTTTGGAGTACCGGGGCATTCGCATCGAAGAATTAGCCAAATCCAGTAGTTTTATCGAAGTAGCCTATCTGCTCATCTGGGGTAAATTGCCCACCCAGGCAGAGATCGAAGAGTTTGAGTACGAAATTCGCACCCATCGACGCATTAAGTACCACATCCGGGACATGATGAAATGTTTTCCCGAAACAGGGCACCCCATGGATGCCTTGCAAACTTCAGCGGCGGCCTTGGGATTGTTCTATGCTCGACGGGCCTTGGATGACCCCAAATATATCCGGGCGGCGGTGGTGCGTCTGTTAGCCAAAATCCCCACCATGGTGGCAGCTTTCCACATGATCCGGGAGGGTAACGATCCCATTCAGCCCAATGATAAATTGGATTACGCTTCCAACTTCCTTTACATGCTGACGGAGAAGGAGCCAGACCCCTTTGCCGCCAAAGTGTTTGATGTGTGTTTGACCCTCCATGCTGAGCACACCATGAATGCGTCCACCTTTTCGGCCCGGGTAACGGCTTCTACTCTCACGGATCCCTATGCAGTGGTTGCCTCGGCGGTGGGGACTTTGGCGGGGCCGCTCCACGGGGGAGCCAACGAAGAAGTGCTAAATATGCTTGAAGAAATTGGCTCAGTGGAAAATGTCCGCCCCTACGTGGAAAAATGCCTGGCCAACAAACAGCGCATCATGGGCTTTGGCCACCGAGTTTATAAAGTCAAAGACCCCCGGGCAATTATTTTGCAGGATTTGGCTGAACAGTTATTTGCCAAAATGGGCCACGACGAATATTACGAAATCGCAGTGGAGTTGGAAAAAGTAGTGGAAGAATACGTGGGTCAAAAGGGCATTTACCCCAATGTGGACTTCTATTCCGGTTTGGTTTACCGCAAGCTAGACATCCCCGCCGATCTGTTTACGCCCCTATTTGCGATCGCCAGGGTGGCGGGTTGGTTGGCCCACTGGAAGGAACAATTATCAGTCAATAAAATTTACCGTCCTACCCAAATTTACATCGGTGACCATAATTTATCTTATGTTCCCATGACAGAACGGGTAGTTTCCGTGGCCCGCAATGAAGACCCCAATGCGATTATTTAA

Protein

MNYMMTDNEVFKEGLAGVPAAKSRVSHVDGTDGILEYRGIRIEELAKSSSFIEVAYLLIWGKLPTQAEIEEFEYEIRTHRRIKYHIRDMMKCFPETGHPMDALQTSAAALGLFYARRALDDPKYIRAAVVRLLAKIPTMVAAFHMIREGNDPIQPNDKLDYASNFLYMLTEKEPDPFAAKVFDVCLTLHAEHTMNASTFSARVTASTLTDPYAVVASAVGTLAGPLHGGANEEVLNMLEEIGSVENVRPYVEKCLANKQRIMGFGHRVYKVKDPRAIILQDLAEQLFAKMGHDEYYEIAVELEKVVEEYVGQKGIYPNVDFYSGLVYRKLDIPADLFTPLFAIARVAGWLAHWKEQLSVNKIYRPTQIYIGDHNLSYVPMTERVVSVARNEDPNAII