Your browser is old and dusty. Try Google Chrome!

Details for sll0397

ORF sll0397
Accession NP_442304.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -305 -319 10.521 0.278
NP_441061.1_2 Reverse -383 -397 4.03116 0.157
NP_441061.1_2 Reverse -236 -250 -0.0987402 0.221
NP_441061.1_2 Reverse -27 -41 -0.0987402 0.221
NP_440795.1_7 Forward -243 -236 14.6904 0.0123
NP_440795.1_7 Reverse -236 -243 14.6904 0.0123
NP_441418.1_6 Reverse -235 -254 5.40766 0.00809
NP_441418.1_6 Forward -244 -225 -19.1751 0.0854
NP_442538.1_1 Reverse -65 -84 18.5831 0.25
NP_441453.1_1 Forward -251 -233 12.1131 0.0985
NP_441453.1_1 Reverse -258 -276 3.65664 0.263
NP_441453.1_4 Reverse -235 -243 16.539 0.00633
NP_441453.1_4 Forward -244 -236 16.539 0.00633
NP_442151.1_6 Reverse -235 -249 6.88276 0.217
NP_442151.1_6 Reverse -382 -396 5.01447 0.298
NP_441818.1_9 Forward -83 -64 -2.0655 0.201
NP_441818.1_9 Reverse -305 -324 -5.31042 0.253
NP_441818.1_9 Reverse -299 -318 -8.752 0.281
NP_441818.1_9 Reverse -302 -321 -10.1286 0.292
NP_440226.1_1 Forward -244 -225 17.7974 0.0175
NP_440226.1_1 Reverse -235 -254 10.5209 0.0617
NP_441465.1_8 Reverse -254 -272 12.7038 0.174
NP_442655.1_2 Forward -42 -23 0.687771 0.291
NP_443002.1_5 Forward -397 -379 7.88485 0.299
NP_442173.1_1 Forward -243 -235 15.4574 0.00633
NP_442173.1_1 Reverse -236 -244 15.4574 0.00633
NP_442752.1_4 Forward -244 -237 13.8055 0.0199
NP_442752.1_4 Reverse -235 -242 13.8055 0.0199
NP_443027.1_4 Reverse -233 -243 13.2547 0.0521
NP_443027.1_4 Forward -246 -236 6.46988 0.275
NP_442975.1_10 Forward -248 -234 3.73557 0.252
NP_442975.1_10 Reverse -231 -245 2.94893 0.266
NP_440784.1_7 Forward -243 -236 15.9687 0.0123
NP_440784.1_7 Reverse -236 -243 15.9687 0.0123
NP_440061.1_9 Reverse -233 -247 20.1568 0.00431
NP_440061.1_9 Reverse -21 -35 10.717 0.123
NP_440061.1_9 Reverse -132 -146 7.66879 0.198
NP_440110.1_8 Forward -276 -257 7.17762 0.115
NP_441054.1_2 Forward -41 -22 9.53756 0.292
NP_442062.1_8 Reverse -235 -245 17.6796 0.00193
NP_442062.1_8 Forward -244 -234 10.3048 0.0493
NP_442062.1_8 Reverse -367 -377 4.10993 0.232
NP_442062.1_8 Reverse -265 -275 3.02829 0.289
NP_442062.1_10 Reverse -51 -70 13.4708 0.236
NP_441859.1_3 Reverse -234 -253 18.2882 0.0348
NP_441859.1_3 Reverse -264 -283 13.175 0.0826
NP_440304.1_4 Forward -246 -236 17.9746 0.00654
NP_440304.1_4 Reverse -233 -243 10.8948 0.051
NP_440304.1_4 Forward -335 -325 4.0116 0.281
NP_440304.1_4 Reverse -322 -332 4.0116 0.281
NP_442242.1_4 Forward -243 -236 14.3954 0.0124
NP_442242.1_4 Reverse -236 -243 14.3954 0.0124
NP_440044.1_8 Forward -243 -224 0.58944 0.195
NP_441208.1_9 Forward -247 -233 17.2075 0.0647
NP_441925.1_4 Forward -324 -305 -0.984623 0.155
NP_441925.1_4 Forward -327 -308 -5.60616 0.179
NP_441925.1_4 Reverse -16 -35 -16.4225 0.282
NP_440856.1_4 Reverse -228 -247 10.2259 0.0536
NP_441083.1_5 Reverse -235 -245 19.3512 0.000718
NP_441083.1_5 Forward -244 -234 11.2881 0.0159
NP_442827.1_8 Forward -252 -233 -2.26292 0.272
NP_441738.1_2 Forward -242 -235 15.28 0.0102
NP_441738.1_2 Reverse -237 -244 15.28 0.0102
NP_441738.1_2 Forward -272 -265 10.0685 0.125
NP_441738.1_2 Forward -291 -284 8.29857 0.176
NP_440209.1_1 Reverse -235 -243 18.1123 0.00295
NP_440209.1_1 Forward -244 -236 18.1123 0.00295
NP_440447.1_6 Forward -252 -234 0.904127 0.274
NP_441713.1_1 Forward -250 -231 -11.8003 0.236
NP_441713.1_8 Reverse -160 -178 8.47561 0.282
NP_441716.1_1 Reverse -235 -249 12.8809 0.0689
NP_442111.1_4 Reverse -234 -248 9.93102 0.0575
NP_442111.1_4 Forward -245 -231 9.73436 0.0587
NP_440343.1_3 Reverse -52 -70 9.55647 0.184
NP_440906.1_5 Forward -243 -236 15.8704 0.0124
NP_440906.1_5 Reverse -236 -243 15.8704 0.0124
NP_440747.1_10 Forward -247 -235 7.80712 0.00223
NP_440747.1_10 Reverse -232 -244 7.31547 0.00577
NP_441130.1_10 Forward -246 -232 7.27608 0.164
NP_442634.1_4 Reverse -233 -247 15.5359 0.0115
NP_442634.1_4 Forward -246 -232 4.71948 0.0751
NP_441265.1_3 Forward -250 -236 13.6676 0.0731
NP_441265.1_3 Forward -280 -266 4.12949 0.181
NP_441265.1_3 Reverse -217 -231 1.27789 0.212
NP_441014.1_8 Forward -324 -305 -8.26035 0.283
NP_443018.1_3 Forward -243 -236 14.8871 0.0123
NP_443018.1_3 Reverse -236 -243 14.8871 0.0123
NP_443018.1_3 Reverse -266 -273 9.77388 0.118
NP_441634.1_8 Reverse -233 -247 -2.95034 0.295
NP_440376.1_1 Forward -244 -235 19.4693 0.000692
NP_440376.1_1 Reverse -235 -244 19.4693 0.000692
NP_440376.1_1 Forward -32 -23 0.786375 0.26
NP_442687.1_6 Reverse -224 -242 4.44404 0.214
NP_442687.1_7 Forward -245 -235 18.5646 0.0028
NP_442687.1_7 Reverse -234 -244 9.02648 0.0994
NP_441846.1_10 Forward -43 -24 4.52268 0.11
NP_441846.1_10 Forward -41 -22 -12.8819 0.197
NP_441846.1_10 Forward -77 -58 -21.9284 0.257
NP_441846.1_10 Forward -78 -59 -22.0267 0.257
NP_442530.1_2 Reverse -344 -354 15.123 0.203
NP_440642.1_10 Forward -189 -175 1.67063 0.29
NP_441950.1_7 Forward -80 -61 -9.53865 0.297
NP_442296.1_5 Forward -272 -253 12.4875 0.146
NP_442296.1_5 Forward -309 -290 4.71934 0.251
NP_442720.1_8 Forward -380 -362 8.86894 0.297
NP_442658.1_1 Forward -246 -236 17.6791 0.00565
NP_442658.1_1 Reverse -233 -243 14.2375 0.0237
NP_442658.1_1 Forward -335 -325 4.99446 0.288
NP_442198.1_3 Forward -355 -336 2.85105 0.297
NP_441855.2_4 Forward -252 -233 19.453 0.0224
NP_441414.1_9 Forward -244 -225 -9.53865 0.262
NP_441487.1_9 Forward -245 -226 -2.95047 0.298
NP_442300.1_4 Reverse -156 -175 14.1583 0.297
NP_442937.1_5 Reverse -377 -396 7.47261 0.251
NP_441958.1_5 Reverse -234 -244 21.2195 0.000805
NP_441958.1_5 Forward -245 -235 20.5312 0.000966
NP_440651.1_1 Forward -77 -58 4.52268 0.294
NP_442486.1_4 Reverse -225 -244 12.9791 0.167
NP_442685.1_2 Reverse -149 -159 15.8113 0.164
NP_439905.1_1 Forward -186 -173 8.37742 0.234
NP_440984.1_7 Reverse -230 -244 8.25939 0.152
NP_440984.1_7 Forward -249 -235 6.58777 0.209
NP_442376.1_2 Forward -249 -230 -12.7836 0.286
NP_442911.1_2 Forward -254 -235 6.29264 0.0295
NP_442911.1_2 Reverse -225 -244 -9.63698 0.26
NP_441580.1_6 Reverse -64 -83 -0.983855 0.181
NP_440153.1_5 Reverse -383 -397 10.3243 0.0989
NP_440153.1_5 Forward -243 -229 1.76955 0.245
NP_440153.1_8 Reverse -382 -395 4.05085 0.21
NP_440993.1_2 Reverse -230 -246 11.6616 0.0799
NP_440993.1_2 Forward -249 -233 1.5335 0.279
NP_440993.1_3 Reverse -225 -244 2.35861 0.208
NP_442995.1_5 Reverse -230 -249 13.3725 0.183
NP_441099.1_5 Forward -254 -235 -11.8986 0.291
NP_442002.1_9 Forward -245 -238 14.1004 0.074
NP_442002.1_9 Reverse -283 -290 9.47889 0.282
NP_440809.1_9 Reverse -226 -244 1.88744 0.118
NP_442431.1_10 Reverse -302 -320 11.1305 0.103
NP_442431.1_10 Forward -77 -59 4.54237 0.206
NP_442431.1_10 Reverse -305 -323 1.78911 0.247
NP_442431.1_10 Reverse -308 -326 0.609134 0.269
NP_441000.1_6 Forward -245 -231 5.40779 0.0933
NP_440147.1_4 Reverse -233 -246 19.9805 0.00251
NP_440147.1_4 Forward -246 -233 11.0324 0.0341
NP_440147.1_4 Forward -201 -188 5.91914 0.109
NP_441550.1_8 Forward -246 -236 19.8424 0.00352
NP_441550.1_8 Reverse -233 -243 15.8108 0.0132
NP_441550.1_8 Reverse -380 -390 4.99446 0.274
NP_441916.1_2 Forward -240 -221 19.68 0.147
NP_441916.1_7 Forward -244 -234 18.9579 0.00144
NP_441916.1_7 Reverse -235 -245 16.893 0.00407
NP_441041.1_4 Forward -286 -267 -13.0786 0.28
NP_441041.1_7 Forward -247 -235 18.593 0.00508
NP_441041.1_7 Reverse -232 -244 7.22324 0.171
NP_441725.1_4 Reverse -230 -244 11.7003 0.078
NP_441725.1_5 Reverse -236 -246 18.7612 0.0119
NP_441725.1_5 Reverse -325 -335 6.37155 0.115
NP_441725.1_5 Forward -332 -322 5.68323 0.115
NP_441725.1_5 Forward -243 -233 1.94665 0.115
NP_439966.1_7 Reverse -233 -243 14.3359 0.0203
NP_439966.1_7 Forward -246 -236 8.14104 0.14
NP_439966.1_7 Forward -276 -266 6.17443 0.191
NP_439966.1_9 Reverse -263 -272 6.39124 0.253
NP_439966.1_9 Forward -246 -237 0.983037 0.253
NP_442941.1_3 Forward -243 -233 19.2529 0.00262
NP_442941.1_3 Reverse -236 -246 2.43831 0.14
NP_440289.1_2 Reverse -232 -245 6.01747 0.0605
NP_440289.1_2 Forward -247 -234 4.64084 0.0657
NP_440289.1_2 Reverse -88 -101 -1.06236 0.221
NP_440260.1_7 Forward -67 -48 0.687771 0.241
NP_442281.1_1 Forward -249 -235 19.4684 0.00282
NP_442281.1_1 Reverse -230 -244 8.84875 0.075
NP_442281.1_1 Forward -291 -277 5.40719 0.159
NP_441334.1_7 Reverse -233 -252 -18.5851 0.275
NP_442847.1_3 Forward -192 -173 4.22689 0.281
NP_440177.1_9 Forward -41 -22 10.7175 0.299
NP_442256.1_2 Forward -246 -228 7.59063 0.107
NP_440437.1_1 Reverse -50 -69 -5.70374 0.292
NP_442012.1_1 Reverse -217 -236 0.58944 0.235
NP_441644.1_6 Forward -244 -234 19.0557 0.000803
NP_441644.1_6 Reverse -235 -245 15.7125 0.0048
NP_442029.1_1 Forward -37 -18 -20.4534 0.298
NP_442029.1_6 Forward -77 -58 6.4893 0.238
NP_442029.1_6 Forward -47 -28 3.14605 0.283
NP_442029.1_10 Reverse -161 -180 4.71934 0.29
NP_440253.1_2 Forward -244 -226 6.80398 0.0772
NP_440253.1_2 Forward -391 -373 2.87075 0.128
NP_440253.1_2 Reverse -235 -253 -0.669169 0.218
NP_440253.1_2 Reverse -359 -377 -3.12744 0.286
NP_440929.1_8 Forward -244 -235 19.2726 0.000701
NP_440929.1_8 Reverse -235 -244 19.2726 0.000701
NP_440929.1_8 Forward -324 -315 0.786375 0.299
NP_442933.1_10 Forward -244 -235 17.601 0.00325
NP_442933.1_10 Reverse -235 -244 17.601 0.00325
NP_441751.2_8 Reverse -236 -250 5.70279 0.0416
NP_441751.2_8 Forward -243 -229 -2.95034 0.134
NP_441751.2_8 Forward -332 -318 -5.90027 0.244
NP_442554.1_8 Forward -243 -233 17.2863 0.00543
NP_442554.1_8 Reverse -236 -246 16.9913 0.0065
NP_442554.1_8 Reverse -383 -393 5.09324 0.161
NP_441762.1_7 Reverse -234 -246 2.69391 0.0676
NP_441762.1_7 Forward -245 -233 1.7106 0.0735
NP_442142.1_4 Forward -314 -301 15.6533 0.0264
NP_442142.1_4 Forward -247 -234 13.785 0.0334
NP_442292.1_1 Forward -243 -234 17.5026 0.00435
NP_442292.1_1 Reverse -236 -245 9.53783 0.0183
NP_442476.1_6 Reverse -236 -250 0.294584 0.267
NP_442381.1_8 Forward -247 -228 -4.22878 0.134
NP_442381.1_8 Reverse -232 -251 -6.49039 0.16
NP_443009.1_5 Reverse -234 -245 17.0694 0.00659
NP_443009.1_5 Forward -245 -234 16.7744 0.00677
NP_442408.2_1 Reverse -235 -254 3.24438 0.157
NP_441715.1_4 Forward -243 -233 16.7946 0.0106
NP_441198.1_8 Forward -246 -236 15.2245 0.0427
NP_441198.1_8 Forward -335 -325 11.0251 0.228
NP_441758.1_3 Forward -322 -304 23.3227 0.0264
NP_441468.1_1 Forward -243 -236 15.8704 0.0124
NP_441468.1_1 Reverse -236 -243 15.8704 0.0124
NP_441618.1_8 Forward -70 -51 15.3391 0.247
NP_441020.2_6 Forward -246 -229 17.1484 0.0211
NP_441020.2_6 Reverse -233 -250 13.3135 0.0755
NP_441015.1_10 Reverse -303 -322 -3.14714 0.185
NP_441015.1_10 Forward -73 -54 -3.93378 0.195
NP_441015.1_10 Forward -76 -57 -8.45701 0.273
NP_441015.1_10 Reverse -306 -325 -8.94866 0.278
NP_441015.1_10 Reverse -377 -396 -9.047 0.278
NP_441015.1_10 Forward -83 -64 -9.73531 0.282
NP_441015.1_10 Forward -79 -60 -11.3086 0.294
NP_441673.1_1 Forward -244 -235 20.8459 0.000698
NP_441673.1_1 Reverse -235 -244 20.8459 0.000698
NP_441826.1_2 Forward -250 -236 2.45787 0.127
NP_441826.1_2 Reverse -318 -332 -0.295402 0.208
NP_441826.1_5 Forward -83 -64 0.491109 0.3
NP_441330.1_1 Reverse -230 -249 -13.7669 0.202
NP_442490.1_10 Forward -188 -170 12.1139 0.192
NP_442490.1_10 Forward -321 -303 9.0656 0.25
NP_442868.1_6 Forward -246 -236 16.7946 0.0131
NP_442868.1_6 Reverse -233 -243 10.4031 0.038
NP_442868.1_6 Reverse -322 -332 3.42162 0.199
NP_442808.1_1 Reverse -234 -244 8.73102 0.0481
NP_442808.1_1 Forward -245 -235 8.73102 0.0481
NP_442808.1_1 Reverse -51 -61 2.5362 0.263
NP_441101.1_7 Reverse -303 -322 12.8808 0.29
NP_440145.1_3 Reverse -225 -244 -6.09707 0.288
NP_442542.1_2 Forward -246 -233 11.9173 0.114
NP_442050.1_5 Reverse -233 -243 15.9091 0.0091
NP_442050.1_5 Forward -246 -236 14.9258 0.0175
NP_442050.1_5 Forward -276 -266 8.53436 0.23
NP_440342.1_1 Forward -75 -56 19.3707 0.164
NP_440558.1_2 Forward -336 -317 -6.39206 0.274
NP_442789.1_4 Forward -138 -119 2.75272 0.168
NP_441518.1_3 Forward -254 -235 -9.83364 0.231
NP_441518.1_3 Reverse -225 -244 -15.2418 0.288
NP_441518.1_4 Reverse -375 -394 1.27698 0.299
NP_441878.1_6 Forward -245 -235 20.2362 0.0046
NP_441878.1_6 Reverse -234 -244 10.5014 0.0176
NP_441878.1_6 Forward -33 -23 -7.0998 0.204
NP_441036.1_8 Reverse -234 -244 15.713 0.00724
NP_441036.1_8 Forward -245 -235 8.4365 0.174
NP_441036.1_8 Reverse -276 -286 5.68323 0.265
NP_441557.1_5 Forward -244 -235 19.9609 0.000699
NP_441557.1_5 Reverse -235 -244 19.9609 0.000699
NP_441445.1_1 Forward -253 -234 0.687771 0.27
NP_441445.1_10 Reverse -167 -186 22.9106 0.047
NP_441590.1_4 Forward -318 -299 10.2251 0.249
NP_442066.2_4 Reverse -324 -343 0.884433 0.157
NP_442066.2_9 Reverse -231 -244 12.409 0.154
NP_442962.1_1 Reverse -299 -318 11.7992 0.239
NP_440101.1_3 Forward -178 -159 8.16093 0.169
NP_440101.1_3 Reverse -218 -237 1.67108 0.269
NP_442183.1_1 Reverse -235 -249 15.7325 0.0187
NP_442183.1_1 Forward -244 -230 10.226 0.0869
NP_442183.1_1 Forward -121 -107 7.76774 0.131
NP_442183.1_9 Reverse -305 -315 11.6814 0.206
NP_442183.1_9 Forward -35 -25 9.12481 0.296
NP_441574.1_1 Reverse -370 -389 -3.83545 0.245
NP_442444.1_1 Forward -360 -341 19.9078 0.22
NP_442347.1_2 Forward -243 -234 3.34298 0.284
NP_442347.1_2 Reverse -236 -245 3.34298 0.284
NP_442645.1_2 Forward -301 -282 -12.4886 0.144
NP_441037.1_4 Forward -246 -236 18.9151 0.00351
NP_441037.1_4 Reverse -233 -243 7.22024 0.237
NP_442594.1_8 Reverse -306 -325 5.11266 0.254
NP_442317.1_6 Reverse -230 -249 9.83255 0.211
NP_441633.1_3 Reverse -233 -246 15.4572 0.0103
NP_442764.1_3 Forward -122 -112 16.4013 0.295
NP_440136.1_2 Forward -243 -236 15.9687 0.0123
NP_440136.1_2 Reverse -236 -243 15.9687 0.0123
NP_442590.1_10 Forward -38 -19 5.30933 0.264
NP_442998.1_10 Forward -242 -235 15.5754 0.0102
NP_442998.1_10 Reverse -237 -244 15.5754 0.0102
NP_440299.1_1 Forward -248 -235 8.96682 0.0819
NP_441799.1_1 Forward -248 -234 14.1586 0.0264
NP_441799.1_1 Forward -297 -283 7.07881 0.153
NP_441799.1_1 Reverse -231 -245 5.89884 0.19
NP_440640.1_6 Forward -80 -61 2.75272 0.23
NP_441007.1_10 Forward -249 -236 9.2624 0.104
NP_441007.1_10 Reverse -230 -243 0.805932 0.216
NP_442201.1_10 Reverse -224 -243 1.27776 0.113
NP_440256.1_1 Forward -247 -228 4.62101 0.0429
NP_440256.1_1 Reverse -295 -314 -4.03212 0.145
NP_440256.1_1 Reverse -232 -251 -8.752 0.266
NP_440521.1_4 Forward -373 -354 17.2074 0.056
NP_441559.1_8 Reverse -230 -244 -7.2769 0.289
NP_441270.1_5 Reverse -298 -317 21.192 0.0248
NP_440915.1_6 Forward -248 -234 14.7492 0.0183
NP_440915.1_6 Reverse -231 -245 8.55439 0.0533
NP_440915.1_6 Forward -311 -297 -0.197071 0.186
NP_440915.1_6 Forward -148 -134 -3.44199 0.296
NP_440717.1_3 Reverse -23 -37 8.75042 0.258
NP_441464.1_1 Reverse -19 -38 14.9458 0.147
NP_441464.1_8 Reverse -235 -249 10.226 0.182
NP_440695.1_5 Forward -244 -225 -0.787193 0.284
NP_441939.1_3 Reverse -236 -255 10.8159 0.12
NP_441199.1_6 Reverse -231 -250 1.47442 0.218
NP_441199.1_6 Forward -248 -229 1.27776 0.223
NP_441494.1_6 Forward -338 -325 10.344 0.227
NP_442386.1_9 Forward -245 -236 6.39082 0.219
NP_442386.1_9 Reverse -234 -243 6.39082 0.219
NP_442386.1_9 Reverse -111 -120 4.52254 0.297
NP_441750.1_7 Forward -68 -58 13.8447 0.254
NP_441340.1_5 Forward -243 -236 15.6737 0.0124
NP_441340.1_5 Reverse -236 -243 15.6737 0.0124
NP_441947.1_4 Forward -117 -98 12.4875 0.234
NP_442484.1_2 Forward -318 -299 2.0644 0.226
NP_442484.1_2 Reverse -207 -226 -1.47551 0.292
NP_440168.1_9 Reverse -233 -252 -2.16383 0.28
NP_442474.1_10 Forward -136 -117 20.4523 0.0828
NP_440161.1_3 Forward -246 -227 14.8474 0.118
NP_440161.1_3 Reverse -233 -252 10.9142 0.221
NP_441134.1_6 Reverse -56 -74 6.70489 0.28
NP_440586.1_1 Reverse -306 -325 -1.86883 0.244
NP_440586.1_8 Forward -243 -236 13.2151 0.026
NP_440586.1_8 Reverse -236 -243 13.2151 0.026
NP_440586.1_8 Forward -306 -299 8.88855 0.205
NP_442251.1_6 Forward -243 -236 15.2804 0.0124
NP_442251.1_6 Reverse -236 -243 15.2804 0.0124
NP_441262.1_3 Reverse -235 -242 14.7888 0.0223
NP_441262.1_3 Forward -244 -237 14.7888 0.0223
NP_441262.1_3 Reverse -265 -272 11.6422 0.0477
NP_440027.1_3 Reverse -324 -342 4.93494 0.249
NP_440027.1_3 Reverse -49 -67 2.18168 0.292
NP_443051.1_1 Reverse -234 -243 19.5676 0.00335
NP_443051.1_1 Forward -245 -236 18.0926 0.00402
NP_439937.1_9 Reverse -323 -340 -10.0899 0.221
NP_440439.1_1 Reverse -232 -245 12.8023 0.0231
NP_440439.1_1 Forward -247 -234 8.37742 0.0537
NP_442239.1_8 Reverse -304 -323 11.8975 0.239
NP_442239.1_8 Forward -81 -62 5.70265 0.266
NP_440372.1_2 Forward -243 -236 16.3621 0.0124
NP_440372.1_2 Reverse -236 -243 16.3621 0.0124
NP_440316.1_10 Forward -145 -135 6.07655 0.271
NP_440316.1_10 Forward -69 -59 5.5849 0.291
NP_440139.1_1 Reverse -229 -248 2.06362 0.24
NP_440210.1_8 Reverse -26 -42 14.0215 0.17
NP_440267.1_2 Reverse -230 -244 12.8803 0.125
NP_440267.1_2 Forward -249 -235 9.73373 0.156
NP_442384.1_10 Forward -244 -231 10.2457 0.0465
NP_442384.1_10 Reverse -235 -248 2.96921 0.206
NP_442790.1_4 Forward -253 -234 1.27776 0.0836
NP_442790.1_4 Reverse -226 -245 -15.5368 0.294
NP_442262.1_10 Forward -243 -236 14.1988 0.0123
NP_442262.1_10 Reverse -236 -243 14.1988 0.0123
NP_442262.1_10 Reverse -266 -273 11.1505 0.115
NP_441689.1_5 Reverse -233 -243 8.3377 0.132
NP_440344.1_10 Forward -251 -234 -5.27103 0.105
NP_440344.1_10 Forward -128 -111 -7.72931 0.119
NP_440344.1_10 Reverse -270 -287 -9.00761 0.137
NP_441060.1_4 Forward -226 -208 2.47742 0.252
NP_441060.1_9 Reverse -235 -254 12.5858 0.205
NP_442910.1_1 Forward -251 -232 -4.52377 0.254
NP_442750.1_3 Forward -139 -120 -2.26216 0.184
NP_442693.1_6 Forward -320 -301 -0.197208 0.282
NP_440297.1_9 Reverse -236 -246 9.51814 0.0917
NP_440297.1_9 Forward -243 -233 -0.216628 0.282
NP_440990.1_10 Forward -80 -61 14.6508 0.285
NP_440999.1_1 Forward -322 -303 11.7983 0.101
NP_440999.1_9 Reverse -58 -72 5.50613 0.111
NP_440999.1_9 Forward -248 -234 0.88457 0.174
NP_440888.1_2 Forward -244 -230 13.2736 0.0307
NP_440888.1_2 Reverse -382 -396 7.07881 0.208
NP_440888.1_2 Reverse -235 -249 5.50552 0.276
NP_440600.1_4 Reverse -227 -245 0.805796 0.135
NP_442147.1_7 Forward -70 -51 9.0459 0.272
NP_439969.1_1 Reverse -163 -182 -3.73712 0.288
NP_442277.1_4 Forward -253 -234 3.53858 0.223
NP_442277.1_4 Reverse -226 -245 0.785326 0.299
NP_442033.1_10 Reverse -322 -341 -7.96535 0.188
NP_440575.1_8 Reverse -149 -168 1.37609 0.177
NP_441543.1_2 Forward -243 -234 15.9293 0.00518
NP_441543.1_2 Reverse -236 -245 9.34117 0.0818
NP_442845.1_4 Reverse -233 -252 8.94757 0.185
NP_441551.1_5 Reverse -240 -256 7.62932 0.243
NP_441551.1_5 Forward -248 -232 7.03934 0.249
NP_441178.1_6 Reverse -13 -32 4.52188 0.268
NP_441319.1_5 Forward -332 -313 15.0441 0.236
NP_441469.1_8 Forward -245 -236 13.3727 0.073
NP_441469.1_8 Reverse -234 -243 6.5879 0.227
NP_443064.1_6 Reverse -235 -245 13.8273 0.0796
NP_443064.1_6 Reverse -52 -62 11.2095 0.13
NP_443064.1_6 Forward -244 -234 10.8217 0.13
NP_442578.1_7 Forward -243 -236 14.5921 0.026
NP_442578.1_7 Reverse -236 -243 14.5921 0.026
NP_440710.1_1 Reverse -227 -245 1.88744 0.135
NP_440710.1_1 Reverse -119 -137 -7.45401 0.238
NP_440071.1_6 Forward -15 -1 14.2897 0.25
NP_440071.1_6 Forward -36 -22 13.8049 0.26
NP_440148.1_2 Reverse -287 -306 20.7304 0.27
NP_441462.1_2 Forward -244 -234 20.2362 0.000805
NP_441462.1_2 Reverse -235 -245 20.1379 0.000967
NP_441621.1_7 Forward -246 -232 2.75286 0.123
NP_441621.1_7 Forward -335 -321 -1.8687 0.188
NP_441621.1_7 Reverse -233 -247 -2.95034 0.188
NP_442736.1_4 Forward -157 -138 22.2223 0.0161
NP_443062.1_1 Forward -244 -226 14.2989 0.0493
NP_441410.1_3 Forward -253 -234 10.9142 0.185
NP_441410.1_3 Reverse -226 -245 10.2259 0.191
NP_442204.1_1 Reverse -231 -242 1.92696 0.266
NP_441560.1_10 Forward -252 -233 5.60432 0.292
NP_440516.1_8 Forward -244 -235 16.9127 0.00442
NP_440516.1_8 Reverse -235 -244 16.9127 0.00442
NP_442428.1_5 Forward -243 -236 15.8704 0.0124
NP_442428.1_5 Reverse -236 -243 15.8704 0.0124
NP_440673.1_3 Forward -242 -235 12.4288 0.0426
NP_440673.1_3 Reverse -237 -244 12.4288 0.0426
NP_440673.1_3 Reverse -300 -307 10.9539 0.106
NP_441052.1_2 Forward -244 -234 10.4031 0.0285
NP_441052.1_2 Reverse -235 -245 10.4031 0.0285
NP_442219.1_9 Forward -243 -234 8.25953 0.0681
NP_442219.1_9 Reverse -236 -245 8.25953 0.0681
NP_440436.1_4 Reverse -236 -245 15.9289 0.00508
NP_440436.1_4 Forward -243 -234 9.24241 0.0871
NP_441884.1_9 Reverse -232 -251 -23.1083 0.284
NP_441884.1_9 Forward -262 -243 -23.305 0.284
NP_441884.1_9 Forward -247 -228 -24.5833 0.288
NP_440314.1_9 Forward -243 -224 2.55606 0.085
NP_441719.1_4 Forward -243 -236 16.3621 0.0124
NP_441719.1_4 Reverse -236 -243 16.3621 0.0124
NP_441719.1_6 Forward -190 -171 10.9134 0.269
NP_441733.1_10 Forward -247 -234 7.49244 0.153
NP_441733.1_10 Reverse -232 -245 3.75586 0.288
NP_441004.1_1 Forward -77 -58 -15.5368 0.275
NP_442366.1_3 Reverse -276 -294 0.707465 0.166
NP_442366.1_5 Reverse -20 -30 9.91099 0.298
NP_442873.1_5 Reverse -25 -44 15.3382 0.175
NP_440296.1_10 Forward -247 -228 3.34271 0.185
NP_441729.1_5 Forward -150 -131 21.1406 0.08
NP_440328.1_4 Reverse -229 -248 2.65439 0.198
NP_443054.1_2 Reverse -233 -247 8.06273 0.13
NP_441851.1_9 Reverse -214 -233 9.14423 0.248
NP_441851.1_10 Forward -245 -235 17.4829 0.0027
NP_441851.1_10 Forward -122 -112 12.4681 0.0501
NP_441851.1_10 Reverse -264 -274 8.63316 0.114
NP_441851.1_10 Reverse -234 -244 8.53483 0.114
NP_442208.1_5 Forward -74 -55 -8.752 0.281
NP_440347.1_3 Forward -388 -369 21.4356 0.00535
NP_442622.1_1 Reverse -234 -253 5.30933 0.157
NP_442622.1_8 Reverse -235 -253 -19.0571 0.296
NP_441668.1_4 Forward -81 -62 2.94938 0.189
NP_442515.1_1 Forward -245 -231 12.1926 0.035
NP_442515.1_1 Reverse -234 -248 6.29277 0.0993
NP_441396.1_5 Forward -127 -118 16.9127 0.185
NP_440593.1_3 Forward -396 -377 -3.14714 0.233
NP_440165.1_5 Forward -245 -226 -5.11376 0.22
NP_440940.1_7 Forward -254 -236 7.29487 0.205
NP_441349.1_10 Forward -81 -62 -5.21209 0.194
NP_441349.1_10 Reverse -225 -244 -8.55534 0.278
NP_441409.1_6 Forward -250 -231 -14.3569 0.255
NP_440432.1_9 Reverse -236 -251 19.8428 0.00961
NP_440432.1_9 Forward -243 -228 15.6145 0.0125
NP_440474.1_8 Forward -273 -259 11.602 0.103
NP_440474.1_8 Forward -243 -229 5.21053 0.254
NP_440474.1_8 Reverse -76 -90 4.52221 0.276
NP_441477.1_10 Forward -398 -380 -0.0791831 0.286
NP_442450.1_5 Forward -246 -236 10.1081 0.115
NP_442168.1_5 Reverse -52 -71 1.27776 0.241
NP_442006.1_2 Forward -74 -57 -13.8258 0.197
NP_442006.1_2 Forward -253 -236 -17.5624 0.279
NP_441570.1_1 Reverse -235 -253 -8.92897 0.124
NP_441570.1_1 Forward -244 -226 -10.0106 0.156
NP_441078.1_4 Forward -244 -235 19.6659 0.0007
NP_441078.1_4 Reverse -235 -244 19.6659 0.0007
NP_441663.1_8 Reverse -229 -248 6.29264 0.126
NP_442443.1_1 Reverse -309 -328 0.196116 0.219
NP_440526.1_3 Reverse -236 -247 18.446 0.0306
NP_441432.1_8 Reverse -234 -243 16.8143 0.00595
NP_441432.1_8 Forward -245 -236 8.35786 0.0755
NP_443024.1_3 Forward -335 -325 16.7946 0.251
NP_442320.1_8 Forward -250 -236 -3.54032 0.124
NP_442320.1_8 Reverse -229 -243 -4.22864 0.151
NP_442320.1_8 Reverse -271 -285 -4.62196 0.177
NP_441732.1_2 Reverse -231 -247 -15.3794 0.145
NP_440629.1_6 Reverse -229 -248 12.2126 0.289
NP_440760.1_1 Reverse -235 -254 -14.8485 0.137
NP_440760.1_1 Forward -294 -275 -22.42 0.257
NP_441057.1_4 Reverse -234 -252 -4.20908 0.299
NP_440913.1_1 Reverse -233 -251 16.1454 0.0953
NP_442489.1_7 Forward -244 -235 20.1576 0.000695
NP_442489.1_7 Reverse -235 -244 20.1576 0.000695
NP_442489.1_7 Reverse -277 -286 -2.16355 0.295
NP_442079.1_7 Forward -243 -224 10.2259 0.111
NP_440559.1_1 Reverse -236 -245 17.306 0.00658
NP_440559.1_1 Forward -243 -234 8.65285 0.0586
NP_441659.2_8 Forward -244 -234 20.9245 0.000805
NP_441659.2_8 Reverse -235 -245 19.3512 0.000966
NP_441659.2_8 Reverse -23 -33 1.35667 0.242
NP_440426.1_7 Forward -183 -164 0.786102 0.256
NP_441040.1_2 Forward -73 -54 -14.2585 0.285
NP_442008.1_2 Forward -247 -228 14.4541 0.0806
NP_440779.1_5 Reverse -235 -252 13.7068 0.0186
NP_442346.1_5 Forward -245 -235 17.9746 0.00128
NP_442346.1_5 Reverse -234 -244 16.303 0.00248
NP_442346.1_5 Forward -137 -127 5.78156 0.229
NP_440545.1_3 Forward -248 -231 6.72535 0.0541
NP_440545.1_3 Reverse -320 -337 0.333834 0.141
NP_440545.1_3 Reverse -231 -248 -0.747806 0.157
NP_440545.1_3 Reverse -19 -36 -2.22277 0.181
NP_440545.1_3 Forward -337 -320 -4.09106 0.218
NP_441923.1_6 Reverse -179 -193 10.9143 0.25
NP_441126.1_8 Forward -71 -58 6.60746 0.291
NP_442934.1_9 Forward -256 -238 16.5388 0.194
NP_440459.1_2 Reverse -380 -397 12.9202 0.133
NP_440459.1_2 Reverse -170 -187 8.88863 0.246
NP_441653.1_2 Reverse -224 -243 13.8694 0.0959
NP_440010.1_10 Forward -80 -61 3.6377 0.25
NP_442603.1_7 Reverse -382 -396 12.3887 0.1
NP_442603.1_7 Reverse -235 -249 5.70218 0.277
NP_441233.1_6 Forward -220 -201 10.0284 0.211
NP_441888.1_7 Reverse -28 -42 3.34284 0.225
NP_441888.1_7 Reverse -230 -244 2.94952 0.225
NP_441948.1_4 Forward -194 -176 -1.94747 0.156
NP_441948.1_4 Forward -251 -233 -2.0458 0.158
NP_441948.1_4 Reverse -228 -246 -3.6191 0.201
NP_441833.1_4 Forward -243 -236 15.9687 0.0124
NP_441833.1_4 Reverse -236 -243 15.9687 0.0124
NP_442162.1_9 Forward -243 -236 16.2637 0.0124
NP_442162.1_9 Reverse -236 -243 16.2637 0.0124
NP_440671.1_2 Reverse -385 -399 15.5359 0.174
NP_440671.1_5 Reverse -54 -68 14.8469 0.246
NP_442199.1_5 Reverse -227 -246 10.9142 0.0558
NP_442199.1_5 Reverse -269 -288 -3.73712 0.211
NP_442140.1_3 Reverse -236 -246 14.828 0.0433
NP_442140.1_3 Forward -243 -233 4.69992 0.238
NP_442021.1_6 Forward -154 -135 8.55425 0.262
NP_440875.1_9 Reverse -237 -247 9.24806 0.233
NP_440875.1_9 Forward -242 -232 7.69067 0.255
NP_440875.1_9 Forward -185 -175 7.59334 0.255
NP_441813.1_3 Forward -74 -55 14.8191 0.238
NP_441813.1_5 Reverse -233 -243 18.1713 0.00743
NP_441813.1_5 Forward -246 -236 8.92815 0.0347
NP_440590.1_4 Reverse -383 -396 1.78924 0.111
NP_440590.1_4 Forward -243 -230 -5.78224 0.289
NP_440567.1_1 Reverse -236 -250 8.16106 0.0609
NP_442497.1_10 Reverse -236 -245 19.8626 0.00532
NP_442497.1_10 Forward -243 -234 17.601 0.00813
NP_440821.1_4 Forward -246 -236 19.5479 0.00399
NP_440821.1_4 Reverse -233 -243 2.24165 0.131
NP_440821.1_4 Forward -335 -325 -0.609952 0.279
NP_441239.1_9 Reverse -233 -245 16.5586 0.0166
NP_441239.1_9 Forward -246 -234 14.4936 0.0272
NP_441239.1_9 Forward -189 -177 3.87389 0.272
NP_441951.1_4 Forward -186 -167 9.43923 0.244
NP_441727.1_3 Forward -251 -232 6.78429 0.24
NP_441892.1_1 Forward -253 -236 11.6419 0.055
NP_440354.1_5 Reverse -379 -398 3.14605 0.239
NP_442138.1_10 Forward -244 -225 13.6675 0.0359
NP_442138.1_10 Reverse -235 -254 -6.29373 0.282
NP_440546.1_4 Forward -244 -234 13.5365 0.0459
NP_440546.1_4 Reverse -235 -245 12.8578 0.0572
NP_440462.1_6 Reverse -233 -243 18.7612 0.00454
NP_440462.1_6 Forward -246 -236 10.4031 0.0396
NP_440868.1_4 Reverse -231 -243 7.70879 0.0648
NP_440868.1_4 Forward -248 -236 7.51213 0.0691
NP_441204.1_1 Reverse -226 -245 9.14423 0.25
NP_440374.1_8 Forward -400 -386 22.1241 0.0886
NP_440402.1_6 Forward -256 -237 18.6823 0.135
NP_440843.1_1 Forward -106 -87 31.2687 0.0000696
NP_440843.1_2 Forward -52 -33 20.944 0.171
NP_440843.1_3 Forward -155 -136 12.7825 0.187
NP_442039.1_4 Forward -243 -236 15.1821 0.0124
NP_442039.1_4 Reverse -236 -243 15.1821 0.0124
NP_442039.1_10 Reverse -155 -173 11.2281 0.289
NP_442679.1_1 Forward -259 -240 -4.81876 0.286
NP_441926.1_3 Forward -244 -228 6.35172 0.17
NP_442837.1_3 Forward -243 -236 15.7721 0.0124
NP_442837.1_3 Reverse -236 -243 15.7721 0.0124
NP_442837.1_3 Forward -348 -341 6.82395 0.184
NP_442053.1_1 Forward -244 -235 18.3876 0.0007
NP_442053.1_1 Reverse -235 -244 18.3876 0.0007
NP_440505.1_3 Reverse -233 -243 17.188 0.00332
NP_440505.1_3 Forward -246 -236 7.84651 0.147
NP_441701.1_3 Forward -177 -160 11.1502 0.213
NP_440520.1_5 Forward -386 -367 18.879 0.0124
NP_440308.1_4 Forward -373 -354 13.6666 0.113
NP_442532.1_7 Forward -244 -230 2.06454 0.254
NP_440914.1_1 Forward -244 -234 16.3248 0.00196
NP_440914.1_1 Reverse -235 -245 8.51751 0.186
NP_441011.1_8 Forward -243 -234 16.6177 0.00602
NP_441011.1_8 Reverse -236 -245 14.356 0.0249
NP_442533.1_1 Forward -77 -58 -2.36049 0.14
NP_442533.1_1 Reverse -305 -324 -4.03212 0.14
NP_442533.1_1 Forward -41 -22 -10.9153 0.235
NP_442533.1_6 Forward -244 -235 17.2076 0.00137
NP_442533.1_6 Reverse -235 -244 17.2076 0.00137
NP_442533.1_6 Forward -391 -382 8.65285 0.0727
NP_442533.1_6 Reverse -23 -32 4.52295 0.179
NP_442533.1_6 Forward -187 -178 3.04799 0.228
NP_442541.1_10 Reverse -134 -148 8.3571 0.219
NP_442232.1_3 Forward -252 -233 -13.2752 0.282
NP_441326.1_2 Forward -316 -297 8.75091 0.288
NP_442322.1_4 Reverse -21 -38 -7.04165 0.279
NP_443016.1_1 Reverse -229 -248 4.12936 0.134
NP_443016.1_1 Forward -193 -174 -6.58872 0.263
NP_441482.1_7 Reverse -229 -243 2.85119 0.0554
NP_441482.1_7 Forward -250 -236 -1.18038 0.0637
NP_439944.1_9 Reverse -236 -246 17.4829 0.00423
NP_439944.1_9 Forward -243 -233 9.12481 0.1
NP_441028.1_6 Reverse -155 -165 10.1076 0.21
NP_442202.1_10 Forward -188 -174 4.52282 0.258
NP_440115.1_6 Forward -247 -237 19.2529 0.0106
NP_440115.1_6 Reverse -232 -242 4.79825 0.282
NP_440007.1_4 Reverse -224 -243 9.0459 0.278
NP_439965.1_1 Reverse -268 -287 -8.85033 0.278
NP_441680.1_4 Forward -318 -299 -2.65548 0.27
NP_441961.1_4 Reverse -305 -324 2.75272 0.281
NP_441602.1_3 Reverse -305 -324 -2.36049 0.233
NP_441602.1_3 Forward -37 -18 -5.70374 0.295
NP_441602.1_4 Forward -255 -236 8.94757 0.279
NP_441170.1_4 Reverse -103 -121 7.19731 0.194
NP_442890.1_1 Reverse -226 -245 14.0608 0.202
NP_441972.1_5 Reverse -224 -243 -9.34199 0.283
NP_441106.1_1 Reverse -234 -243 18.486 0.0028
NP_441106.1_1 Forward -245 -236 9.73449 0.0311
NP_439903.1_6 Reverse -232 -251 -0.591301 0.283
NP_442306.1_10 Reverse -230 -249 -10.522 0.11
NP_441286.1_1 Reverse -234 -246 14.7886 0.00418
NP_441286.1_1 Forward -245 -233 -3.50094 0.145
NP_441286.1_1 Forward -334 -322 -7.04085 0.3
NP_440670.1_8 Forward -244 -235 18.3876 0.000699
NP_440670.1_8 Reverse -235 -244 18.3876 0.000699
NP_440670.1_8 Forward -286 -277 3.7363 0.23
NP_440670.1_8 Forward -199 -190 3.14632 0.296
NP_440886.1_7 Forward -245 -235 8.04271 0.0805
NP_440886.1_7 Reverse -234 -244 8.04271 0.0805
NP_440886.1_7 Reverse -58 -68 5.78111 0.163
NP_440886.1_7 Reverse -61 -71 5.19112 0.194
NP_440886.1_7 Forward -287 -277 4.99446 0.205
NP_440886.1_7 Forward -318 -308 4.89613 0.213
NP_442717.1_3 Forward -388 -369 14.3558 0.0186
NP_442072.1_9 Forward -200 -182 -13.6489 0.118
NP_442072.1_9 Forward -245 -227 -20.827 0.204
NP_441808.1_8 Forward -80 -61 12.4875 0.213
NP_440907.2_8 Reverse -236 -246 19.449 0.00351
NP_440907.2_8 Forward -243 -233 9.616 0.103
NP_441021.1_1 Forward -243 -224 -10.6203 0.242
NP_440841.1_4 Forward -246 -227 -6.78538 0.215
NP_441463.1_3 Reverse -225 -244 10.0292 0.0481
NP_441463.1_3 Reverse -267 -286 -2.16383 0.151
NP_441463.1_3 Forward -284 -265 -10.0303 0.288
NP_441463.1_3 Reverse -102 -121 -10.3253 0.293
NP_441463.1_6 Reverse -233 -247 8.73514 0.25
NP_441626.1_2 Forward -243 -236 15.7721 0.0124
NP_441626.1_2 Reverse -236 -243 15.7721 0.0124
NP_439958.1_2 Forward -161 -147 15.5359 0.18
NP_442365.1_5 Forward -332 -313 9.14423 0.209
NP_442794.1_5 Forward -247 -233 12.1926 0.275
NP_442615.1_1 Reverse -226 -244 10.2456 0.0216
NP_442615.1_1 Forward -253 -235 -1.55415 0.13
NP_440387.1_1 Forward -244 -228 0.648521 0.122
NP_440387.1_1 Reverse -235 -251 -1.21977 0.142
NP_441431.1_2 Forward -247 -233 9.53707 0.183
NP_441836.1_2 Reverse -376 -395 -6.1954 0.292
NP_441993.1_1 Forward -250 -231 1.16703 0.284
NP_440114.1_10 Forward -244 -230 15.3392 0.0264
NP_440114.1_10 Reverse -235 -249 7.9644 0.219
NP_442437.1_8 Forward -243 -224 4.22769 0.264
NP_441206.1_2 Reverse -305 -324 10.3242 0.298
NP_440293.1_10 Reverse -302 -321 -2.75381 0.274
NP_440766.1_4 Reverse -273 -287 6.48943 0.101
NP_441237.1_9 Reverse -236 -246 17.2863 0.00348
NP_441237.1_9 Reverse -266 -276 9.51814 0.287
NP_439910.1_2 Reverse -269 -286 -22.6756 0.285
NP_440457.1_1 Forward -248 -236 9.47875 0.0927
NP_440457.1_1 Forward -36 -24 5.84051 0.135
NP_440457.1_1 Reverse -231 -243 -0.551008 0.268
NP_440798.1_6 Reverse -236 -249 9.16406 0.103
NP_441332.1_6 Reverse -58 -68 13.6798 0.184
NP_442130.1_8 Forward -398 -379 10.4217 0.135
NP_442509.1_9 Reverse -235 -245 17.3841 0.00128
NP_442509.1_9 Reverse -112 -122 8.04271 0.192
NP_442509.1_9 Forward -244 -234 8.04271 0.192
NP_440554.1_4 Forward -243 -233 17.9746 0.0131
NP_440554.1_4 Reverse -236 -246 6.27322 0.123
NP_441885.1_5 Forward -244 -234 11.3864 0.00668
NP_441885.1_5 Reverse -235 -245 11.3864 0.00668
NP_442341.1_7 Forward -101 -87 7.27608 0.109
NP_442341.1_9 Reverse -233 -247 14.0603 0.0713
NP_441756.1_5 Forward -248 -229 -1.7705 0.264
NP_440423.1_6 Forward -252 -233 -11.5053 0.178
NP_443000.1_3 Forward -30 -11 13.9464 0.23
NP_443000.1_7 Reverse -233 -243 20.3345 0.00223
NP_443000.1_7 Forward -175 -165 2.33998 0.226
NP_443000.1_7 Forward -246 -236 2.14332 0.226
NP_441842.1_10 Reverse -228 -242 6.48943 0.286
NP_441842.1_10 Forward -251 -237 6.3911 0.291
NP_440275.1_3 Forward -246 -236 19.5479 0.00756
NP_440275.1_3 Reverse -233 -243 16.1063 0.0155
NP_442932.1_9 Reverse -172 -191 8.16093 0.241
NP_440091.1_1 Forward -248 -236 1.51394 0.197
NP_442354.1_8 Forward -208 -189 6.19431 0.266
NP_440679.1_10 Reverse -304 -323 -18.8801 0.279
NP_439962.1_4 Forward -327 -308 -5.60541 0.28
NP_441875.1_10 Reverse -332 -346 14.1593 0.227
NP_441105.1_3 Reverse -224 -243 -8.16202 0.267
NP_440216.1_1 Forward -244 -230 14.8476 0.00436
NP_440216.1_1 Reverse -235 -249 5.60446 0.0191
NP_440216.1_1 Reverse -52 -66 -11.0135 0.159
NP_440216.1_8 Reverse -364 -381 16.9518 0.295
NP_440172.1_1 Forward -244 -234 17.5813 0.00421
NP_440172.1_1 Reverse -235 -245 16.303 0.00854
NP_440172.1_1 Forward -391 -381 8.73149 0.0586
NP_440249.1_2 Reverse -146 -156 15.3192 0.268
NP_442788.1_5 Forward -247 -228 15.8307 0.284
NP_442015.1_10 Forward -248 -235 3.36254 0.183
NP_441226.1_7 Forward -243 -236 14.4934 0.0123
NP_441226.1_7 Reverse -236 -243 14.4934 0.0123
NP_441111.1_7 Forward -243 -235 18.7023 0.00294
NP_441111.1_7 Reverse -236 -244 18.7023 0.00294
NP_442379.1_10 Forward -251 -234 -2.91109 0.245
NP_441177.1_7 Forward -321 -302 12.0933 0.199
NP_441766.1_2 Forward -244 -235 17.5026 0.00297
NP_441766.1_2 Reverse -235 -244 17.5026 0.00297
NP_442417.1_5 Forward -244 -230 7.47274 0.188
NP_442417.1_5 Forward -311 -297 5.89945 0.244
NP_440416.1_9 Forward -194 -175 -9.63698 0.133
NP_440416.1_9 Reverse -228 -247 -14.7502 0.18
NP_443052.1_8 Forward -254 -235 -8.85033 0.179
NP_443052.1_8 Reverse -42 -61 -12.3902 0.254
NP_443052.1_9 Reverse -58 -77 1.86774 0.18
NP_443052.1_9 Reverse -28 -47 -2.85214 0.242
NP_443052.1_9 Forward -324 -305 -3.3438 0.249
NP_443052.1_9 Reverse -55 -74 -3.3438 0.249
NP_443052.1_9 Reverse -61 -80 -4.32711 0.257
NP_443052.1_9 Forward -321 -302 -4.52377 0.258
NP_440072.1_5 Reverse -304 -322 4.83737 0.236
NP_441940.1_4 Reverse -233 -252 15.4374 0.266
NP_442154.1_1 Forward -79 -61 -15.6155 0.222
NP_442154.1_1 Reverse -308 -326 -17.3854 0.254
NP_440261.1_5 Reverse -236 -249 8.57408 0.0244
NP_440261.1_5 Forward -243 -230 -12.1738 0.272
NP_440261.1_5 Reverse -325 -338 -12.3704 0.284
NP_440988.1_10 Reverse -380 -394 7.7064 0.215
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GATGCCGGTGCCGATGACTACATTGTCAAACCCTTTAACTCCGATGAATTTTTTGCTCGCATCCGGGTGCAATTGCGCCGCACCCACACCACCAGCGATGAAGTATTGCAATTCGCCGATCTACGTTTCAATCGCAGTACGAGGGAAATCCAACGGGGCGATCGCCTGATTGATCTCACCGCCAAAGAATTCGAGCTGTTGGACTATCTGCTCTCCCATGCCCGCCAGGTGTTGACTAGGGAACAAATTTTAGAGCGGGTCTGGGGCTACGACTTTATGGGGGATTCCAACATCATTGAGGTCTATATCCGTTATCTGCGGTTGAAGTTGGAGGCGGCGGGGGAACCTCGTTTGATTCAGACAGTGCGGGGGGTGGGCTACGTACTAAGGGATTAGGGGT

CDS

ATGGAACTAATCATTTCCTGGCTACGGTTGTCCTGGCAGGTATTGGCCATCAATGGCGATCGCATTGCCTGGAACACTTTTTTGGCTATTATTCCCCTGGTGCTAAGCGTTTGGTTATTCCGTTGGCAGAATTCCCAGCGCCAACCATGGCCCCGATCGCCGTTGTGGTGGGTAATTTTTGCTGTGTTTGTGGCTTTTTTACCCAATGCCCCTTACATTTTGACGGACATTATCCACTACTTCAAGTTAGTACGGCAGGGGATACCGACTAGCGTCATGATTTTCACCGCTACGCCCCAATTTTTTCTCTTTCTAAATGTGGGTTGGCAATGCTATGTCATGTCCTTGCTCAACGCCGGTTATTATCTGGAGCAACGGCAATGGTCCGCGTGGATTTTCCCCATGGAGTTAATGGCCCATTTGTTGTCGGCGATCGGTATTTACCTGGGTCGATTTCTGCGGTTAAACAGTTGGCACGTGGTCACTGATCCCAAAGATGTGGGGCAAAATTTAGCCCAAAGCCTTTCCCATCACCGTCCCCTCTTGGCTATTAGCGTTACCGTGGTGATTCTGAGTGTTTTTTATTGGTTCACTAAACAGATTAACCTCGGGTTAGTACTACGATGGCAACAGGTTCGTCGTGGTGCCCCATAG

Protein

MELIISWLRLSWQVLAINGDRIAWNTFLAIIPLVLSVWLFRWQNSQRQPWPRSPLWWVIFAVFVAFLPNAPYILTDIIHYFKLVRQGIPTSVMIFTATPQFFLFLNVGWQCYVMSLLNAGYYLEQRQWSAWIFPMELMAHLLSAIGIYLGRFLRLNSWHVVTDPKDVGQNLAQSLSHHRPLLAISVTVVILSVFYWFTKQINLGLVLRWQQVRRGAP