Your browser is old and dusty. Try Google Chrome!

Details for sll0394

ORF sll0394
Accession NP_442307.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -99 -85 20.3541 0.0125
NP_441061.1_2 Reverse -227 -241 -1.37704 0.258
NP_440795.1_10 Reverse -121 -140 11.3067 0.279
NP_441418.1_6 Reverse -61 -80 -28.7132 0.208
NP_442291.1_5 Reverse -60 -76 0.0585348 0.174
NP_441453.1_4 Reverse -61 -69 6.80426 0.121
NP_441453.1_4 Forward -70 -62 6.11594 0.121
NP_441453.1_4 Reverse -91 -99 5.42762 0.135
NP_441453.1_4 Forward -100 -92 3.95266 0.275
NP_441453.1_8 Reverse -54 -71 9.08529 0.239
NP_442151.1_6 Forward -113 -99 5.99778 0.253
NP_441818.1_1 Forward -69 -58 15.2011 0.0343
NP_440226.1_1 Forward -70 -51 9.0459 0.0786
NP_440226.1_1 Reverse -61 -80 1.76941 0.29
NP_441098.1_3 Forward -187 -168 -6.98037 0.285
NP_442744.1_8 Forward -113 -94 -6.49039 0.297
NP_442173.1_1 Forward -69 -61 12.0158 0.0316
NP_442173.1_1 Reverse -62 -70 4.83764 0.241
NP_442752.1_4 Reverse -61 -68 13.8055 0.0199
NP_442975.1_10 Forward -104 -90 2.16228 0.283
NP_441675.1_4 Forward -136 -117 12.4875 0.177
NP_440784.1_7 Reverse -62 -69 6.23397 0.241
NP_440784.1_7 Forward -69 -62 6.13563 0.241
NP_442909.1_7 Forward -69 -55 11.4053 0.131
NP_442909.1_7 Forward -99 -85 9.6354 0.145
NP_441054.1_2 Reverse -242 -261 15.9291 0.136
NP_442062.1_6 Forward -110 -92 13.8838 0.29
NP_440761.1_4 Forward -111 -92 -20.8467 0.3
NP_441900.1_1 Reverse -30 -49 16.7735 0.14
NP_441802.1_1 Reverse -46 -65 4.32602 0.296
NP_440304.1_4 Reverse -20 -30 4.20827 0.272
NP_440044.1_8 Forward -69 -50 -1.7705 0.251
NP_442110.1_7 Reverse -226 -240 0.294584 0.264
NP_441925.1_4 Forward -304 -285 -16.3242 0.282
NP_441083.1_5 Forward -70 -60 17.7779 0.00336
NP_441083.1_5 Reverse -61 -71 8.04317 0.046
NP_441083.1_5 Reverse -335 -345 3.81494 0.164
NP_441434.1_1 Reverse -346 -360 15.7678 0.186
NP_441434.1_7 Forward -68 -54 5.01447 0.225
NP_441738.1_2 Forward -68 -61 15.28 0.0102
NP_441558.1_5 Forward -72 -53 6.98095 0.198
NP_440209.1_1 Reverse -61 -69 8.57422 0.0425
NP_440209.1_1 Forward -70 -62 5.52596 0.0821
NP_442889.1_8 Forward -147 -133 4.71887 0.255
NP_442889.1_10 Forward -191 -172 10.2397 0.287
NP_441770.1_4 Reverse -381 -400 -2.55715 0.188
NP_442570.1_3 Forward -39 -20 10.1275 0.11
NP_442445.1_1 Reverse -267 -286 17.109 0.122
NP_442445.1_1 Reverse -37 -56 13.3725 0.23
NP_442445.1_1 Forward -118 -99 11.5042 0.271
NP_442445.1_2 Reverse -332 -351 16.6174 0.191
NP_441716.1_1 Reverse -197 -211 5.21113 0.239
NP_441716.1_1 Reverse -61 -75 2.94952 0.284
NP_441163.1_1 Forward -283 -266 9.47787 0.226
NP_440906.1_5 Reverse -62 -69 6.23397 0.234
NP_440906.1_5 Forward -69 -62 6.13563 0.241
NP_440747.1_10 Forward -73 -61 -2.81262 0.0713
NP_440747.1_10 Reverse -58 -70 -11.9574 0.178
NP_441486.1_1 Forward -103 -89 -1.5737 0.173
NP_441486.1_1 Reverse -58 -72 -3.44199 0.178
NP_441486.1_1 Reverse -88 -102 -6.09693 0.278
NP_441486.1_1 Forward -147 -133 -6.19526 0.283
NP_441486.1_1 Forward -238 -224 -6.29359 0.288
NP_441486.1_1 Forward -73 -59 -6.39192 0.294
NP_441194.1_2 Forward -342 -323 17.4032 0.197
NP_441880.2_10 Forward -30 -12 9.36059 0.243
NP_440842.1_10 Reverse -19 -33 2.94952 0.269
NP_441014.1_2 Reverse -90 -109 15.4374 0.245
NP_441014.1_8 Forward -77 -58 -8.94866 0.288
NP_441014.1_10 Forward -324 -305 -1.47628 0.262
NP_442848.1_1 Reverse -55 -69 5.70279 0.0803
NP_443018.1_3 Forward -69 -62 11.7405 0.0655
NP_443018.1_3 Forward -30 -23 10.7572 0.0907
NP_443018.1_3 Reverse -92 -99 10.6589 0.0967
NP_443018.1_3 Reverse -62 -69 5.44732 0.193
NP_443018.1_3 Reverse -23 -30 4.56234 0.241
NP_443018.1_3 Forward -99 -92 4.16902 0.278
NP_441634.1_8 Forward -379 -365 -2.95034 0.295
NP_441634.1_9 Reverse -262 -281 12.29 0.214
NP_441182.1_5 Reverse -82 -101 8.65258 0.222
NP_440376.1_1 Reverse -61 -70 5.99792 0.111
NP_440376.1_1 Reverse -97 -106 4.32629 0.163
NP_440376.1_1 Forward -70 -61 -0.196935 0.285
NP_441857.1_6 Forward -211 -201 14.1397 0.254
NP_441588.1_4 Forward -68 -58 8.63316 0.14
NP_441588.1_4 Reverse -93 -103 6.37155 0.2
NP_441588.1_4 Reverse -137 -147 5.48657 0.258
NP_442730.1_8 Forward -72 -53 6.1935 0.228
NP_441846.1_10 Reverse -2 -21 -9.73531 0.19
NP_441846.1_10 Reverse -1 -20 -20.7484 0.256
NP_442958.1_3 Reverse -80 -99 1.47442 0.267
NP_440642.1_10 Forward -48 -34 1.76896 0.289
NP_441422.1_7 Forward -72 -55 -3.00942 0.226
NP_442658.1_1 Reverse -20 -30 13.0576 0.04
NP_440141.1_8 Forward -121 -102 6.4893 0.26
NP_442782.1_2 Reverse -91 -105 6.48943 0.223
NP_442782.1_2 Reverse -279 -293 1.96621 0.281
NP_441414.1_9 Reverse -335 -354 -3.44213 0.136
NP_441414.1_9 Reverse -61 -80 -7.96535 0.227
NP_441958.1_5 Reverse -60 -70 0.865012 0.12
NP_441958.1_5 Forward -101 -91 -0.609952 0.215
NP_440203.1_5 Reverse -377 -387 9.71433 0.245
NP_439905.1_1 Forward -275 -262 13.0973 0.178
NP_439905.1_3 Reverse -364 -383 14.9458 0.199
NP_440984.1_7 Forward -349 -335 4.71948 0.292
NP_441338.2_9 Reverse -342 -361 4.71934 0.266
NP_440153.1_5 Reverse -62 -76 1.96621 0.241
NP_442064.1_4 Reverse -87 -106 7.57013 0.242
NP_440993.1_3 Forward -80 -61 4.91521 0.159
NP_440993.1_4 Forward -281 -264 13.3135 0.171
NP_440809.1_9 Forward -79 -61 -6.1757 0.225
NP_441294.1_7 Forward -74 -60 16.1618 0.0171
NP_441294.1_7 Forward -110 -96 11.2664 0.15
NP_442885.1_5 Forward -68 -49 13.3716 0.279
NP_441000.1_6 Forward -71 -57 -5.40861 0.275
NP_440147.1_4 Reverse -114 -127 4.93583 0.142
NP_441550.1_8 Reverse -59 -69 11.091 0.0555
NP_441550.1_8 Forward -72 -62 10.501 0.066
NP_441916.1_7 Reverse -91 -101 4.50326 0.174
NP_441916.1_7 Reverse -135 -145 3.91327 0.198
NP_441041.1_4 Reverse -91 -110 -7.76869 0.192
NP_441041.1_4 Reverse -85 -104 -10.4236 0.232
NP_440703.1_9 Forward -106 -93 5.0336 0.293
NP_441725.1_5 Forward -30 -20 12.6647 0.0247
NP_441725.1_5 Forward -69 -59 1.455 0.135
NP_441725.1_5 Forward -99 -89 -1.00328 0.279
NP_441725.1_8 Forward -215 -196 8.16093 0.275
NP_439966.1_7 Forward -72 -62 15.0242 0.0177
NP_439966.1_7 Reverse -59 -69 6.0761 0.195
NP_439966.1_7 Reverse -89 -99 5.09279 0.243
NP_439966.1_9 Reverse -264 -273 4.42462 0.253
NP_442941.1_3 Forward -69 -59 10.1081 0.024
NP_442941.1_3 Forward -99 -89 0.373358 0.212
NP_442941.1_3 Reverse -62 -72 0.0783647 0.231
NP_440674.1_7 Forward -102 -83 8.75009 0.276
NP_440289.1_2 Reverse -58 -71 2.2809 0.1
NP_440260.1_8 Reverse -263 -281 7.39397 0.154
NP_440260.1_8 Forward -40 -22 6.60732 0.154
NP_442281.1_1 Reverse -111 -125 5.1122 0.169
NP_442281.1_1 Forward -105 -91 3.8339 0.217
NP_442281.1_1 Forward -149 -135 2.45727 0.266
NP_442575.1_8 Reverse -31 -50 -5.50708 0.269
NP_440437.1_1 Forward -106 -87 -3.93378 0.248
NP_440437.1_1 Forward -76 -57 -4.13045 0.251
NP_441087.1_6 Reverse -199 -217 0.0184138 0.258
NP_442982.1_5 Reverse -17 -36 -1.08219 0.263
NP_441644.1_6 Forward -70 -60 14.4342 0.0126
NP_441644.1_6 Reverse -91 -101 7.64939 0.121
NP_441644.1_6 Reverse -104 -114 4.40448 0.239
NP_441644.1_6 Reverse -61 -71 4.01116 0.253
NP_441644.1_6 Forward -100 -90 3.61784 0.272
NP_443049.1_6 Reverse -60 -70 14.4711 0.114
NP_442177.1_1 Reverse -243 -262 13.9625 0.284
NP_441810.1_9 Forward -107 -88 2.26107 0.269
NP_440253.1_2 Forward -70 -52 5.42735 0.0933
NP_440929.1_8 Forward -70 -61 7.07956 0.0713
NP_442933.1_10 Reverse -91 -100 4.71961 0.22
NP_441751.2_8 Forward -99 -85 -4.22864 0.166
NP_441751.2_8 Forward -69 -55 -5.40861 0.206
NP_442554.1_8 Forward -99 -89 12.4681 0.0263
NP_442554.1_8 Reverse -336 -346 9.22315 0.0617
NP_442554.1_8 Forward -69 -59 6.07655 0.126
NP_442554.1_8 Reverse -62 -72 4.3066 0.189
NP_442554.1_8 Reverse -23 -33 1.74999 0.298
NP_442313.1_5 Forward -51 -32 8.06259 0.211
NP_442292.1_1 Forward -69 -60 8.65285 0.0335
NP_442292.1_1 Forward -99 -90 5.80125 0.129
NP_442292.1_1 Reverse -336 -345 3.7363 0.192
NP_442292.1_1 Reverse -62 -71 -0.0986038 0.239
NP_442143.1_3 Forward -105 -86 4.22769 0.225
NP_440895.1_6 Reverse -350 -363 8.08242 0.296
NP_441715.1_4 Forward -69 -59 4.99491 0.24
NP_440357.1_1 Reverse -123 -142 7.27595 0.296
NP_440015.1_9 Forward -70 -52 -1.45582 0.283
NP_440183.1_9 Forward -44 -25 -12.7836 0.26
NP_441468.1_1 Reverse -62 -69 6.13563 0.209
NP_441468.1_1 Forward -69 -62 6.0373 0.223
NP_441468.1_1 Reverse -23 -30 4.07068 0.263
NP_441468.1_1 Reverse -92 -99 3.97235 0.277
NP_441015.1_10 Reverse -56 -75 3.83436 0.133
NP_441673.1_1 Reverse -61 -70 1.37636 0.114
NP_441673.1_1 Forward -70 -61 1.1797 0.163
NP_441673.1_1 Forward -106 -97 -8.06341 0.254
NP_441096.1_5 Forward -59 -41 14.9646 0.297
NP_441876.1_9 Forward -25 -15 11.1893 0.28
NP_441826.1_2 Reverse -91 -105 1.96621 0.137
NP_441826.1_2 Forward -70 -56 -0.492064 0.213
NP_441826.1_2 Reverse -16 -30 -3.63866 0.286
NP_442868.1_6 Forward -72 -62 9.12481 0.0539
NP_442868.1_6 Reverse -20 -30 3.51995 0.198
NP_442868.1_6 Reverse -59 -69 0.176696 0.247
NP_442719.1_2 Forward -37 -19 -9.12632 0.259
NP_442227.1_2 Forward -98 -79 -0.885524 0.26
NP_443058.1_7 Reverse -72 -91 3.44104 0.263
NP_443058.1_7 Forward -345 -326 2.65439 0.283
NP_442427.1_8 Reverse -52 -71 12.6841 0.152
NP_441911.1_10 Forward -195 -176 13.3793 0.21
NP_441911.1_10 Forward -266 -247 6.82367 0.291
NP_442808.1_1 Forward -71 -61 9.616 0.0481
NP_442808.1_1 Forward -297 -287 1.74956 0.281
NP_442050.1_1 Reverse -42 -61 6.58763 0.286
NP_442050.1_5 Forward -72 -62 11.1893 0.105
NP_442050.1_5 Reverse -59 -69 6.76441 0.282
NP_440558.1_2 Forward -34 -15 -6.78538 0.28
NP_440274.1_2 Forward -51 -37 14.2569 0.236
NP_441878.1_6 Reverse -21 -31 -7.49312 0.231
NP_441557.1_5 Reverse -61 -70 1.08137 0.0794
NP_441557.1_5 Forward -70 -61 0.589713 0.134
NP_441557.1_5 Reverse -91 -100 -0.885252 0.26
NP_441445.1_1 Reverse -52 -71 6.98095 0.138
NP_442397.1_9 Forward -70 -51 4.916 0.254
NP_440595.1_8 Reverse -42 -61 15.7324 0.156
NP_441116.1_9 Forward -354 -340 16.3225 0.155
NP_441574.1_1 Forward -125 -106 -1.57384 0.22
NP_441549.1_9 Reverse -87 -105 -8.24065 0.223
NP_442347.1_2 Forward -69 -60 10.3245 0.058
NP_442965.1_2 Reverse -44 -63 5.50599 0.159
NP_440547.1_1 Reverse -86 -105 7.4718 0.288
NP_442594.1_8 Reverse -4 -23 2.3594 0.295
NP_441633.1_3 Forward -33 -20 -6.56889 0.259
NP_440136.1_2 Reverse -62 -69 6.23397 0.171
NP_440136.1_2 Forward -69 -62 6.13563 0.193
NP_442590.1_10 Reverse -85 -104 12.4875 0.145
NP_442590.1_10 Reverse -91 -110 9.24257 0.2
NP_441728.2_4 Forward -189 -170 12.1748 0.273
NP_442998.1_5 Reverse -277 -287 11.2881 0.189
NP_442998.1_10 Forward -68 -61 15.5754 0.0102
NP_440731.1_2 Reverse -49 -68 4.81767 0.293
NP_440899.1_8 Forward -361 -342 -9.53865 0.264
NP_441799.1_1 Forward -74 -60 9.34041 0.0942
NP_440256.1_1 Reverse -58 -77 2.65439 0.0619
NP_440256.1_1 Forward -103 -84 -10.0303 0.293
NP_441559.1_8 Forward -15 -1 -5.80194 0.27
NP_441559.1_8 Forward -41 -27 -5.90027 0.271
NP_440915.1_6 Reverse -131 -145 -2.65535 0.278
NP_441296.1_5 Forward -54 -35 13.9625 0.244
NP_442866.1_1 Reverse -261 -280 -2.45882 0.214
NP_440695.1_6 Reverse -116 -130 10.8961 0.265
NP_442993.1_1 Reverse -91 -107 -1.80975 0.101
NP_442993.1_1 Forward -70 -54 -9.77456 0.194
NP_442386.1_9 Forward -71 -62 11.9957 0.0754
NP_442386.1_9 Reverse -90 -99 7.96411 0.213
NP_441340.1_5 Reverse -62 -69 13.5105 0.0314
NP_441340.1_5 Forward -99 -92 11.3472 0.0526
NP_441340.1_5 Forward -69 -62 5.84064 0.208
NP_441340.1_5 Forward -30 -23 3.97235 0.274
NP_442484.1_2 Forward -51 -32 -1.37718 0.288
NP_440168.1_9 Reverse -11 -30 5.30933 0.227
NP_440168.1_9 Reverse -141 -160 -3.54046 0.296
NP_439976.1_4 Forward -254 -235 6.09517 0.278
NP_440586.1_8 Forward -69 -62 9.47853 0.146
NP_440586.1_8 Reverse -92 -99 5.74197 0.283
NP_440586.1_8 Reverse -62 -69 5.74197 0.283
NP_440969.1_3 Reverse -153 -171 21.8478 0.0562
NP_440684.1_9 Reverse -85 -99 7.27608 0.272
NP_441262.1_3 Reverse -61 -68 14.7888 0.0223
NP_443051.1_1 Reverse -60 -69 7.47288 0.0571
NP_439937.1_9 Forward -23 -6 -12.9415 0.278
NP_441740.2_10 Forward -37 -18 6.88262 0.286
NP_440408.1_7 Reverse -37 -56 15.2408 0.165
NP_440408.1_7 Reverse -42 -61 13.7658 0.175
NP_440408.1_7 Reverse -61 -80 7.7676 0.284
NP_440439.1_1 Reverse -88 -101 -2.04567 0.293
NP_440372.1_2 Reverse -62 -69 13.8055 0.0214
NP_440372.1_2 Forward -69 -62 6.52896 0.188
NP_442887.1_5 Reverse -89 -108 -7.57203 0.264
NP_442384.1_10 Reverse -61 -74 1.9859 0.24
NP_442384.1_10 Reverse -85 -98 0.412608 0.291
NP_441877.1_5 Forward -354 -335 -0.787193 0.282
NP_441018.1_7 Reverse -247 -266 9.43923 0.223
NP_441018.1_7 Reverse -263 -282 8.55425 0.242
NP_440530.1_5 Forward -134 -115 6.88262 0.258
NP_442262.1_10 Forward -69 -62 13.2155 0.0213
NP_442262.1_10 Reverse -92 -99 12.0355 0.062
NP_442262.1_10 Forward -30 -23 9.87221 0.164
NP_441689.1_5 Reverse -59 -69 12.7626 0.113
NP_441689.1_5 Forward -102 -92 7.94438 0.18
NP_440163.1_10 Reverse -58 -68 11.3864 0.169
NP_440282.1_3 Forward -111 -92 9.14423 0.186
NP_441965.1_7 Reverse -22 -41 14.2566 0.268
NP_442693.1_7 Reverse -271 -290 9.93088 0.227
NP_440297.1_9 Forward -99 -89 -0.118297 0.282
NP_440297.1_9 Forward -69 -59 -0.511621 0.289
NP_442187.1_3 Reverse -60 -70 15.6147 0.105
NP_442280.1_10 Forward -56 -38 10.9088 0.215
NP_441896.1_5 Reverse -287 -294 15.3787 0.268
NP_440700.1_8 Forward -106 -92 11.996 0.28
NP_440999.1_1 Forward -299 -280 15.5349 0.0715
NP_440888.1_2 Forward -70 -56 12.3887 0.046
NP_440600.1_4 Reverse -127 -145 -3.12744 0.218
NP_440600.1_4 Forward -78 -60 -7.84733 0.294
NP_440052.1_8 Reverse -80 -99 16.8141 0.055
NP_442277.1_2 Reverse -256 -270 10.521 0.287
NP_441543.1_2 Forward -69 -60 7.07956 0.131
NP_441543.1_2 Forward -99 -90 5.3096 0.204
NP_442845.1_2 Forward -106 -92 15.9292 0.0663
NP_442845.1_2 Reverse -55 -69 7.17775 0.198
NP_442845.1_2 Reverse -85 -99 6.88276 0.201
NP_442845.1_2 Reverse -61 -75 5.70279 0.225
NP_441551.1_5 Reverse -87 -103 13.5292 0.123
NP_441551.1_5 Forward -74 -58 6.74435 0.258
NP_441469.1_8 Reverse -21 -30 8.94785 0.227
NP_442315.1_2 Reverse -274 -286 8.29878 0.297
NP_442578.1_5 Forward -23 -4 0.196116 0.278
NP_442578.1_7 Reverse -62 -69 6.0373 0.18
NP_441462.1_2 Reverse -61 -71 7.55152 0.0543
NP_441462.1_2 Reverse -91 -101 -0.314959 0.206
NP_443062.1_6 Reverse -83 -102 1.27776 0.276
NP_440519.1_6 Forward -26 -12 10.3243 0.29
NP_440519.1_6 Forward -75 -61 9.43936 0.29
NP_440516.1_8 Reverse -61 -70 18.9776 0.00442
NP_440516.1_8 Forward -70 -61 5.01461 0.118
NP_442428.1_5 Reverse -62 -69 6.13563 0.209
NP_442428.1_5 Forward -69 -62 6.0373 0.212
NP_442428.1_5 Reverse -23 -30 4.46401 0.267
NP_442428.1_5 Reverse -92 -99 4.36568 0.271
NP_442428.1_8 Reverse -262 -281 11.8975 0.221
NP_441068.1_3 Forward -338 -319 18.6823 0.256
NP_442120.1_10 Reverse -91 -110 -2.0655 0.176
NP_442120.1_10 Reverse -368 -387 -9.73531 0.244
NP_441835.1_2 Reverse -191 -210 4.52268 0.27
NP_440673.1_2 Forward -41 -22 8.5361 0.266
NP_440673.1_3 Forward -68 -61 12.4288 0.0426
NP_440673.1_3 Forward -29 -22 9.67555 0.179
NP_440077.1_3 Reverse -259 -278 11.9958 0.226
NP_441052.1_2 Forward -70 -60 10.6981 0.0285
NP_441052.1_2 Forward -144 -134 1.84832 0.225
NP_441052.1_2 Reverse -61 -71 0.668351 0.256
NP_442219.1_8 Forward -41 -22 15.7045 0.103
NP_442219.1_9 Reverse -62 -71 8.65285 0.0681
NP_442219.1_9 Forward -69 -60 7.96454 0.0696
NP_440436.1_4 Forward -69 -60 7.57079 0.124
NP_440436.1_4 Forward -99 -90 4.7192 0.244
NP_441884.1_9 Reverse -58 -77 -21.24 0.235
NP_441321.1_5 Reverse -28 -47 5.89931 0.265
NP_442864.1_7 Reverse -67 -85 14.1788 0.211
NP_442907.1_9 Forward -99 -80 -5.9004 0.284
NP_441719.1_4 Reverse -62 -69 6.82395 0.0855
NP_441719.1_4 Forward -69 -62 6.52896 0.188
NP_441004.1_1 Reverse -38 -57 -8.65367 0.201
NP_441004.1_2 Reverse -11 -30 -4.32711 0.29
NP_441004.1_4 Reverse -19 -29 9.02648 0.259
NP_442366.1_3 Forward -126 -108 -5.38906 0.287
NP_442366.1_5 Forward -147 -137 11.9759 0.148
NP_442139.1_7 Reverse -357 -376 12.8808 0.174
NP_442206.1_10 Reverse -73 -88 1.2582 0.236
NP_443054.1_2 Reverse -26 -40 7.17775 0.165
NP_442308.1_7 Reverse -95 -114 17.1442 0.2
NP_441851.1_10 Reverse -90 -100 5.68323 0.203
NP_442208.1_5 Reverse -28 -47 -2.36049 0.252
NP_442011.1_1 Reverse -60 -79 -2.95047 0.285
NP_441668.1_4 Forward -354 -335 13.7658 0.0659
NP_441668.1_4 Reverse -94 -113 -0.0988766 0.248
NP_441683.1_7 Reverse -1 -20 -8.06369 0.284
NP_441349.1_10 Forward -80 -61 -7.76869 0.258
NP_440389.1_5 Reverse -328 -347 14.8254 0.213
NP_442843.1_1 Reverse -23 -42 -11.1119 0.286
NP_440195.1_4 Forward -281 -262 4.916 0.292
NP_440023.1_7 Forward -124 -105 4.916 0.293
NP_442006.1_2 Reverse -36 -53 -18.2507 0.289
NP_442006.1_2 Reverse -13 -30 -18.939 0.296
NP_441570.1_1 Reverse -61 -79 -9.32229 0.134
NP_441078.1_4 Reverse -61 -70 0.196389 0.205
NP_441078.1_4 Forward -70 -61 -0.000272808 0.205
NP_441078.1_4 Reverse -97 -106 -0.786921 0.207
NP_441078.1_4 Forward -106 -97 -1.57357 0.266
NP_442348.1_2 Forward -161 -152 10.3245 0.27
NP_440526.1_3 Forward -69 -58 0.54986 0.275
NP_441432.1_8 Reverse -60 -69 14.0611 0.0258
NP_441432.1_8 Reverse -90 -99 4.22796 0.235
NP_441432.1_8 Reverse -96 -105 3.14632 0.259
NP_442320.1_8 Reverse -55 -69 4.22782 0.0522
NP_441732.1_2 Forward -110 -94 -7.0213 0.0614
NP_441732.1_2 Reverse -112 -128 -8.0046 0.105
NP_441732.1_2 Forward -104 -88 -16.8544 0.207
NP_442797.1_7 Forward -77 -59 2.0841 0.245
NP_440199.1_10 Reverse -58 -68 16.7946 0.0381
NP_441057.1_4 Forward -40 -22 5.72234 0.195
NP_440713.1_4 Forward -80 -61 1.17943 0.291
NP_442489.1_7 Forward -70 -61 0.688044 0.152
NP_442489.1_7 Reverse -61 -70 0.688044 0.152
NP_442489.1_7 Reverse -91 -100 -1.57357 0.213
NP_442489.1_7 Reverse -97 -106 -1.77023 0.247
NP_441452.1_1 Forward -54 -35 17.109 0.128
NP_440559.1_1 Forward -69 -60 7.76787 0.0918
NP_440559.1_1 Reverse -62 -71 6.48957 0.134
NP_440559.1_1 Forward -99 -90 5.01461 0.161
NP_441659.2_8 Forward -70 -60 5.48657 0.106
NP_441659.2_8 Forward -100 -90 4.3066 0.139
NP_442913.1_1 Reverse -22 -41 3.04771 0.292
NP_442913.1_10 Forward -79 -60 2.0644 0.132
NP_442849.1_1 Reverse -276 -290 8.94771 0.264
NP_439956.1_7 Reverse -261 -280 8.55425 0.257
NP_439956.1_7 Reverse -276 -295 0.687771 0.298
NP_442346.1_5 Reverse -21 -31 9.32148 0.118
NP_442346.1_5 Reverse -90 -100 5.5849 0.238
NP_442346.1_10 Forward -33 -14 5.70265 0.168
NP_440352.1_5 Reverse -331 -350 14.8945 0.136
NP_440250.1_1 Forward -110 -92 23.2253 0.0143
NP_440459.1_2 Forward -115 -98 9.57695 0.224
NP_442137.1_6 Forward -229 -210 4.22769 0.275
NP_440847.1_3 Forward -20 -6 11.602 0.261
NP_442875.1_8 Forward -341 -322 15.8307 0.147
NP_442603.1_7 Reverse -61 -75 12.6836 0.0948
NP_442603.1_7 Forward -100 -86 8.84875 0.162
NP_442828.1_7 Reverse -40 -59 -5.60541 0.277
NP_441585.1_5 Forward -390 -371 -1.27961 0.298
NP_441833.1_4 Forward -69 -62 6.52896 0.0924
NP_441833.1_4 Reverse -62 -69 6.23397 0.163
NP_442799.1_8 Reverse -306 -325 12.0823 0.172
NP_441329.1_6 Forward -194 -175 1.19323 0.244
NP_441895.1_2 Forward -144 -125 -17.7001 0.234
NP_442162.1_9 Forward -69 -62 12.9205 0.0282
NP_442162.1_9 Reverse -62 -69 12.9205 0.0282
NP_440788.1_8 Forward -209 -190 8.84924 0.286
NP_440671.1_4 Reverse -55 -69 14.9459 0.0532
NP_440671.1_4 Forward -106 -92 6.98109 0.23
NP_441973.1_1 Forward -48 -33 0.471552 0.235
NP_442045.1_5 Forward -34 -15 1.57275 0.261
NP_442140.1_3 Forward -30 -20 3.61828 0.288
NP_442723.1_1 Forward -61 -42 2.26028 0.291
NP_442723.1_1 Forward -312 -293 1.57197 0.295
NP_441696.1_4 Reverse -273 -286 16.5389 0.19
NP_440875.1_9 Forward -375 -365 8.85871 0.233
NP_441813.1_5 Forward -72 -62 15.0247 0.0147
NP_441813.1_5 Reverse -59 -69 6.17489 0.1
NP_441813.1_5 Reverse -89 -99 3.02829 0.178
NP_440590.1_4 Reverse -62 -75 1.39592 0.125
NP_440567.1_1 Reverse -62 -76 2.85119 0.16
NP_442497.1_10 Forward -69 -60 0.589713 0.153
NP_440821.1_4 Reverse -59 -69 8.53483 0.0468
NP_441239.1_9 Reverse -20 -32 7.70879 0.15
NP_441239.1_9 Forward -72 -60 3.67722 0.279
NP_441951.1_9 Forward -45 -26 8.75091 0.229
NP_440400.1_1 Reverse -335 -354 -3.14789 0.291
NP_441892.1_1 Forward -109 -92 -5.76269 0.288
NP_442193.1_3 Reverse -227 -246 16.9464 0.216
NP_440833.1_6 Reverse -342 -356 12.192 0.2
NP_440833.1_6 Forward -398 -384 7.17714 0.285
NP_441617.1_6 Forward -351 -332 1.17943 0.213
NP_441617.1_6 Reverse -84 -103 -2.85214 0.258
NP_442138.1_5 Forward -114 -95 10.2259 0.276
NP_442809.1_1 Reverse -323 -342 9.93006 0.295
NP_440546.1_4 Reverse -61 -71 12.1791 0.0679
NP_440546.1_4 Reverse -91 -101 11.9852 0.0679
NP_440546.1_4 Forward -100 -90 10.143 0.109
NP_442041.1_2 Reverse -272 -290 9.65558 0.283
NP_441230.1_5 Forward -105 -86 -0.295539 0.281
NP_441230.1_8 Reverse -357 -376 18.1907 0.135
NP_440462.1_4 Reverse -265 -279 11.8976 0.205
NP_440462.1_6 Forward -72 -62 5.68323 0.145
NP_440868.1_4 Forward -74 -62 9.57708 0.0464
NP_440868.1_4 Reverse -57 -69 3.38223 0.136
NP_442479.1_9 Forward -353 -334 -9.53865 0.266
NP_442402.1_10 Reverse -326 -336 10.8943 0.275
NP_441848.1_7 Reverse -216 -235 -0.492971 0.244
NP_441084.1_6 Forward -102 -88 11.962 0.179
NP_440696.1_3 Forward -74 -56 1.88744 0.217
NP_442039.1_4 Reverse -62 -69 11.6422 0.0747
NP_442039.1_7 Reverse -24 -34 13.943 0.211
NP_442039.1_10 Forward -285 -267 10.1465 0.293
NP_441811.1_8 Reverse -79 -93 11.3077 0.218
NP_442891.1_10 Forward -38 -19 16.1257 0.145
NP_440825.1_6 Reverse -342 -361 8.65258 0.285
NP_442837.1_3 Forward -69 -62 6.0373 0.25
NP_442837.1_3 Reverse -62 -69 6.0373 0.25
NP_442894.1_1 Reverse -168 -187 19.6648 0.0304
NP_442053.1_1 Forward -70 -61 14.4544 0.0114
NP_442053.1_1 Reverse -61 -70 7.86621 0.0863
NP_440505.1_3 Reverse -59 -69 14.7297 0.0176
NP_441252.1_6 Reverse -276 -283 14.3954 0.168
NP_441203.1_1 Forward -69 -50 -20.3551 0.297
NP_440914.1_1 Forward -70 -60 13.1043 0.0386
NP_440914.1_1 Reverse -61 -71 12.1284 0.0654
NP_440914.1_1 Reverse -116 -126 10.3717 0.142
NP_440914.1_1 Reverse -22 -32 9.68861 0.178
NP_440914.1_2 Reverse -368 -387 18.6823 0.233
NP_442533.1_1 Forward -221 -202 -17.6018 0.291
NP_442533.1_6 Reverse -91 -100 11.2095 0.046
NP_442533.1_6 Forward -144 -135 5.01461 0.16
NP_442533.1_6 Forward -70 -61 4.42462 0.179
NP_442533.1_6 Reverse -104 -113 2.06468 0.275
NP_442541.1_10 Forward -22 -8 12.0937 0.182
NP_442541.1_10 Forward -31 -17 7.86545 0.225
NP_442541.1_10 Forward -383 -369 2.75226 0.254
NP_443016.1_1 Forward -37 -18 -7.37537 0.274
NP_441482.1_7 Reverse -55 -69 -9.24352 0.196
NP_439944.1_9 Forward -69 -59 9.22315 0.1
NP_442269.1_10 Reverse -80 -99 4.42435 0.247
NP_441028.1_6 Forward -49 -39 12.6642 0.183
NP_441028.1_6 Forward -18 -8 7.94438 0.217
NP_441028.1_6 Forward -17 -7 5.68278 0.243
NP_441028.1_6 Reverse -210 -220 3.8145 0.281
NP_440116.1_8 Reverse -62 -81 6.29264 0.0571
NP_440007.1_9 Reverse -57 -71 6.29277 0.229
NP_441961.1_4 Forward -39 -20 3.44104 0.277
NP_440572.1_9 Reverse -141 -160 18.1907 0.209
NP_440429.1_2 Reverse -23 -42 14.5524 0.176
NP_439903.1_1 Reverse -275 -294 -1.08219 0.253
NP_439903.1_6 Forward -103 -84 5.11187 0.186
NP_442306.1_10 Forward -75 -56 -21.24 0.254
NP_441286.1_1 Reverse -60 -72 2.49725 0.06
NP_441286.1_1 Forward -71 -59 2.30059 0.0669
NP_441286.1_1 Forward -32 -20 2.30059 0.0669
NP_440670.1_8 Reverse -61 -70 8.75118 0.0606
NP_440670.1_8 Forward -70 -61 6.19458 0.124
NP_441930.1_2 Reverse -21 -31 11.3864 0.294
NP_440886.1_7 Forward -71 -61 6.66608 0.115
NP_440886.1_7 Forward -21 -11 3.71617 0.267
NP_442614.1_2 Reverse -61 -75 15.3392 0.0773
NP_442614.1_2 Reverse -42 -56 14.2576 0.104
NP_442614.1_2 Forward -281 -267 6.98109 0.276
NP_442382.1_7 Forward -107 -88 4.22769 0.257
NP_440513.1_4 Reverse -61 -80 10.5209 0.271
NP_442213.1_5 Forward -352 -333 -2.16383 0.293
NP_441403.1_1 Reverse -27 -41 19.8133 0.059
NP_439967.1_7 Forward -94 -76 15.1621 0.136
NP_441021.1_1 Forward -63 -44 -10.1286 0.229
NP_440841.1_4 Reverse -59 -78 1.27776 0.119
NP_440666.1_3 Reverse -318 -337 19.3707 0.0614
NP_442459.1_7 Forward -63 -44 -0.787193 0.277
NP_441463.1_3 Forward -80 -61 -9.63698 0.282
NP_441626.1_2 Reverse -62 -69 12.2322 0.0511
NP_441626.1_2 Forward -69 -62 5.93897 0.231
NP_442365.1_7 Forward -74 -55 -2.36049 0.2
NP_442365.1_7 Forward -387 -368 -5.99873 0.284
NP_440107.1_5 Forward -77 -58 -6.58872 0.258
NP_440107.1_5 Reverse -84 -103 -6.68705 0.262
NP_442615.1_1 Forward -122 -104 -5.19239 0.206
NP_442615.1_1 Forward -153 -135 -5.97904 0.231
NP_441962.1_9 Forward -293 -274 4.916 0.29
NP_440358.1_8 Reverse -369 -388 2.45773 0.241
NP_440114.1_10 Forward -70 -56 7.66941 0.229
NP_440114.1_10 Reverse -135 -149 6.6861 0.26
NP_442698.1_10 Reverse -9 -28 2.45773 0.284
NP_442323.1_7 Reverse -92 -111 3.9319 0.228
NP_441510.2_7 Reverse -85 -99 9.6354 0.281
NP_441677.1_7 Forward -171 -152 19.3367 0.291
NP_440766.1_4 Reverse -57 -71 2.65453 0.176
NP_441237.1_9 Forward -30 -20 13.7464 0.0687
NP_440643.1_2 Reverse -11 -30 3.83436 0.278
NP_440457.1_1 Reverse -57 -69 2.30059 0.214
NP_440142.1_7 Reverse -38 -57 11.0125 0.202
NP_442040.1_4 Forward -284 -265 16.0274 0.0736
NP_441436.1_2 Reverse -235 -254 -5.80207 0.294
NP_440473.1_9 Forward -400 -381 -6.68705 0.236
NP_441765.1_4 Forward -339 -320 15.3391 0.138
NP_441159.1_8 Reverse -186 -205 2.16195 0.236
NP_440554.1_4 Reverse -92 -102 5.48657 0.145
NP_440554.1_4 Forward -69 -59 4.10993 0.201
NP_442862.1_3 Forward -340 -323 6.43035 0.267
NP_442737.1_9 Forward -30 -11 16.4369 0.211
NP_441885.1_5 Reverse -61 -71 9.51814 0.0206
NP_441885.1_5 Forward -70 -60 1.25834 0.11
NP_441885.1_5 Forward -100 -90 -0.314959 0.195
NP_441885.1_5 Forward -144 -134 -1.29827 0.259
NP_440649.2_8 Forward -219 -205 9.63603 0.266
NP_442341.1_7 Reverse -386 -400 7.86607 0.0985
NP_442341.1_9 Reverse -40 -54 6.39049 0.228
NP_442341.1_9 Forward -102 -88 5.70218 0.258
NP_442341.1_9 Forward -72 -58 5.01387 0.284
NP_441173.1_9 Forward -285 -277 12.1137 0.21
NP_440191.1_4 Forward -17 -7 14.2146 0.266
NP_440423.1_6 Reverse -53 -72 -3.3438 0.126
NP_443000.1_7 Reverse -59 -69 7.35486 0.0859
NP_443000.1_7 Forward -72 -62 1.06167 0.274
NP_440507.2_3 Forward -215 -196 6.98015 0.293
NP_440275.1_3 Reverse -59 -69 5.5849 0.14
NP_440560.1_5 Reverse -207 -226 14.8245 0.108
NP_440091.1_1 Reverse -57 -69 6.72548 0.0921
NP_440679.1_10 Reverse -196 -215 -13.6686 0.222
NP_443010.1_10 Forward -103 -86 3.44723 0.253
NP_439962.1_6 Reverse -289 -307 7.4923 0.282
NP_440175.1_7 Reverse -263 -281 15.0234 0.128
NP_440175.1_7 Reverse -247 -265 8.67997 0.292
NP_440149.1_8 Forward -70 -51 -1.96717 0.162
NP_440149.1_8 Reverse -55 -74 -6.1954 0.244
NP_440149.1_8 Reverse -232 -251 -6.58872 0.255
NP_440149.1_8 Reverse -374 -393 -7.17871 0.275
NP_441105.1_3 Reverse -86 -105 -8.65367 0.275
NP_441730.1_2 Forward -134 -116 5.52568 0.299
NP_440216.1_1 Reverse -61 -75 -0.0987402 0.0284
NP_440216.1_9 Reverse -24 -33 7.17789 0.286
NP_440172.1_1 Reverse -91 -101 14.1397 0.0149
NP_440172.1_1 Reverse -61 -71 6.27322 0.107
NP_440172.1_1 Forward -70 -60 2.24165 0.279
NP_440172.1_1 Forward -344 -334 2.14332 0.283
NP_440249.1_2 Forward -227 -217 14.3359 0.284
NP_442015.1_10 Forward -74 -61 2.18257 0.199
NP_441226.1_7 Reverse -62 -69 12.7234 0.0312
NP_441226.1_7 Forward -99 -92 12.4284 0.0404
NP_441226.1_7 Forward -69 -62 11.5435 0.0757
NP_441111.1_7 Forward -69 -61 8.86921 0.0589
NP_440244.1_1 Reverse -34 -53 -6.58872 0.287
NP_441766.1_2 Forward -70 -61 14.7494 0.00772
NP_441766.1_2 Reverse -91 -100 4.62128 0.172
NP_440416.1_9 Forward -38 -19 -17.8968 0.248
NP_440416.1_9 Forward -53 -34 -19.4701 0.275
NP_441430.1_6 Forward -216 -197 9.83255 0.291
NP_440261.1_7 Reverse -271 -290 5.11266 0.102
NP_440988.1_10 Reverse -59 -73 11.6757 0.187
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGGCGGAAATCCACCATGTCAATTTCCAGCCCCGCTACAAACATCAGGTAAATTTTGCCGATGTCGGTGAAGAGTTTGATGCTTTCCGAATCTTCATTCAGCACCCCCAAACCACTTTTGCCCAACACAATGCCGGCAAACAAAAGTCCCACCAGTCCTGGTAATTTCAAGCGCTCAAAAATGGGCGGCAGGATCAGGGTCACCAATAATAAAATAGTGAAGTCAATTAAAGGGTTACTCGGAATTGGTGCGAATAGGCCATCCATAAAGTGGGTGGAGATTGTTTAGGTCATAGGCAAAAGCCATCGGCATCATCATACCGTTCCGGCTCCCGATCGCCATTTCTCTTCCCTTTCCCCTAGCCGGTTTTGCCATTGCGCCCCTTTCCCCCTTTATCCCC

CDS

ATGCGTAACCAGTATTTTTCCCTCATCAGCCCAGCCCTATGGCCTGCTGTAGTCCCCACCCTGGCTAGTGTTTACCTAGGAACTCTGGTCATATCCTCCCCGGCGATCGCCCTAGATTGTGCTGAAATAGGGGCACTGGCCCAACGCAATTCCCGTTGTTGGGAAAGTTTGCCCTCCATCATGGGCCCCAAGGCTGACAATGGTGACCCCCATAGTCCCAGTACCACTCCCGCTATAGATGCTGGCGATGGACTGCAACCTTTTCAAGGCGTCTGGAAATTCGATTATGAAAAAACCATGGAAGCCCACAGAGAAAGTCCCGACTATAAGCCAGAGGAAGACATGGAAGCATTATCTGGACTGCTGAATCTAATGTTTGGCATGGTTTCCCTGAAAATTAGCGGAAATCAATTGCAAATGAGCGCTGCTGACAGCAATGAAGTTATTACCACCATCGACTGTGAAGTGGATTCCGCCACCGCCACCGTGGTCACAGCCCAATGTACCAAGGACGGTGAAACCAAAACAATCAAATTTGAGAATATTTTGCCTGGGCAATATATGAGATTTAATGCGGTGGGGGAAAACGATTGTCCCTACTGTACTTGGCGTCGGGTGGAGCCATAA

Protein

MRNQYFSLISPALWPAVVPTLASVYLGTLVISSPAIALDCAEIGALAQRNSRCWESLPSIMGPKADNGDPHSPSTTPAIDAGDGLQPFQGVWKFDYEKTMEAHRESPDYKPEEDMEALSGLLNLMFGMVSLKISGNQLQMSAADSNEVITTIDCEVDSATATVVTAQCTKDGETKTIKFENILPGQYMRFNAVGENDCPYCTWRRVEP