Your browser is old and dusty. Try Google Chrome!

Details for sll0383

ORF sll0383
Accession NP_442314.1
Symbol
Category Cobalamin, heme, phycobilin and porphyrin
Definition cobalamin biosynthesis protein M
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -287 -273 4.71948 0.145
NP_441061.1_2 Forward -399 -385 -0.688726 0.237
NP_440557.1_1 Reverse -167 -186 2.16274 0.243
NP_442761.1_5 Reverse -274 -293 5.01433 0.268
NP_440795.1_7 Forward -287 -280 14.6904 0.0123
NP_440795.1_7 Reverse -280 -287 14.6904 0.0123
NP_440795.1_7 Forward -84 -77 8.39725 0.213
NP_441418.1_6 Forward -288 -269 6.19431 0.00771
NP_442291.1_5 Reverse -278 -294 -1.80975 0.202
NP_441453.1_1 Reverse -272 -290 9.94979 0.144
NP_441453.1_4 Reverse -279 -287 16.539 0.00633
NP_441453.1_4 Forward -288 -280 16.539 0.00633
NP_442151.1_6 Forward -288 -274 13.9626 0.0421
NP_442151.1_6 Reverse -279 -293 6.98109 0.214
NP_441818.1_1 Reverse -280 -291 8.80962 0.277
NP_441818.1_1 Forward -287 -276 8.51463 0.288
NP_440226.1_1 Reverse -279 -298 8.94757 0.0802
NP_441630.1_3 Forward -296 -277 18.7807 0.0306
NP_440348.1_3 Reverse -268 -287 13.5691 0.29
NP_440996.1_3 Reverse -266 -284 8.67227 0.296
NP_442287.1_3 Forward -296 -279 19.9992 0.0456
NP_442655.1_1 Forward -90 -71 -0.787193 0.255
NP_442173.1_1 Forward -287 -279 15.4574 0.00633
NP_442173.1_1 Reverse -280 -288 15.4574 0.00633
NP_442752.1_4 Forward -288 -281 13.8055 0.0199
NP_442752.1_4 Reverse -279 -286 13.8055 0.0199
NP_442752.1_4 Forward -18 -11 7.90559 0.144
NP_443027.1_4 Forward -290 -280 13.2547 0.0521
NP_443027.1_4 Reverse -277 -287 7.35486 0.24
NP_442975.1_10 Reverse -275 -289 5.01387 0.234
NP_442975.1_10 Forward -292 -278 3.24392 0.26
NP_440784.1_7 Forward -287 -280 15.9687 0.0123
NP_440784.1_7 Reverse -280 -287 15.9687 0.0123
NP_440061.1_9 Forward -290 -276 11.4053 0.111
NP_440061.1_9 Reverse -235 -249 4.91554 0.3
NP_442062.1_8 Forward -288 -278 17.6796 0.00193
NP_442062.1_8 Reverse -279 -289 10.3048 0.0493
NP_440761.1_4 Reverse -161 -180 -11.8003 0.202
NP_441859.1_3 Forward -289 -270 12.3883 0.101
NP_440304.1_4 Reverse -277 -287 18.9579 0.00406
NP_440304.1_4 Forward -290 -280 10.8948 0.051
NP_440304.1_4 Reverse -170 -180 5.5849 0.201
NP_442242.1_4 Forward -287 -280 14.3954 0.0124
NP_442242.1_4 Reverse -280 -287 14.3954 0.0124
NP_440765.1_3 Forward -343 -324 6.4893 0.299
NP_441581.1_6 Forward -297 -278 10.7468 0.283
NP_439902.1_9 Reverse -80 -98 19.0954 0.191
NP_439918.1_3 Forward -291 -272 4.12936 0.265
NP_441619.1_9 Reverse -378 -397 19.6656 0.0256
NP_440893.1_3 Reverse -318 -337 2.35861 0.273
NP_441208.1_9 Reverse -276 -290 8.65272 0.219
NP_441594.1_6 Reverse -270 -289 7.57094 0.17
NP_441594.1_6 Forward -285 -266 2.85105 0.242
NP_442276.1_2 Reverse -261 -280 5.60432 0.291
NP_442110.1_7 Forward -288 -274 11.996 0.0593
NP_442110.1_7 Reverse -279 -293 1.57289 0.222
NP_442110.1_7 Reverse -106 -120 0.294584 0.264
NP_441925.1_4 Reverse -41 -60 -6.58946 0.185
NP_441925.1_4 Reverse -246 -265 -9.24438 0.216
NP_440856.1_4 Forward -295 -276 8.65258 0.0597
NP_441083.1_3 Forward -137 -127 16.0075 0.118
NP_441083.1_5 Forward -288 -278 19.3512 0.000718
NP_441083.1_5 Reverse -279 -289 11.2881 0.0159
NP_442827.1_8 Forward -296 -277 3.83357 0.143
NP_441738.1_2 Forward -286 -279 15.28 0.0102
NP_441738.1_2 Reverse -281 -288 15.28 0.0102
NP_441558.1_5 Forward -396 -377 7.47261 0.18
NP_441942.1_3 Reverse -379 -398 15.3417 0.296
NP_440209.1_1 Reverse -279 -287 18.1123 0.00295
NP_440209.1_1 Forward -288 -280 18.1123 0.00295
NP_442889.1_1 Reverse -372 -391 -14.3569 0.273
NP_440447.1_6 Reverse -271 -289 7.39397 0.14
NP_440056.1_1 Forward -399 -380 10.8159 0.194
NP_441713.1_1 Reverse -273 -292 11.7008 0.0344
NP_441770.1_10 Forward -396 -377 8.55425 0.279
NP_442920.1_3 Forward -155 -136 17.1404 0.278
NP_440178.1_7 Reverse -278 -297 -3.24547 0.0451
NP_440053.1_2 Forward -67 -48 18.4857 0.152
NP_442570.1_3 Reverse -376 -395 -9.53865 0.299
NP_441716.1_1 Forward -288 -274 10.4227 0.0956
NP_442111.1_4 Forward -289 -275 17.5025 0.00997
NP_442111.1_4 Reverse -278 -292 8.45605 0.0744
NP_440906.1_5 Forward -287 -280 15.8704 0.0124
NP_440906.1_5 Reverse -280 -287 15.8704 0.0124
NP_440747.1_10 Reverse -276 -288 7.80712 0.00223
NP_440747.1_10 Forward -291 -279 7.4138 0.00422
NP_440747.1_10 Forward -279 -267 -12.4491 0.282
NP_441130.1_10 Reverse -277 -291 16.6175 0.0225
NP_441486.1_1 Forward -291 -277 3.8345 0.0534
NP_439964.1_6 Reverse -164 -183 17.7974 0.282
NP_442634.1_4 Forward -290 -276 16.8142 0.01
NP_442634.1_4 Reverse -277 -291 -3.147 0.161
NP_441265.1_3 Reverse -273 -287 3.93283 0.181
NP_440057.1_4 Forward -387 -368 13.7945 0.225
NP_441014.1_8 Reverse -246 -265 -9.24366 0.293
NP_442848.1_1 Reverse -273 -287 -2.16369 0.263
NP_442848.1_1 Forward -202 -188 -2.45868 0.263
NP_442848.1_5 Forward -158 -140 0.314141 0.276
NP_441012.1_4 Reverse -275 -288 7.19745 0.272
NP_443018.1_3 Forward -287 -280 14.8871 0.0123
NP_443018.1_3 Reverse -280 -287 14.8871 0.0123
NP_443018.1_3 Forward -393 -386 9.38056 0.128
NP_441316.1_7 Reverse -277 -292 -2.47838 0.255
NP_441634.1_8 Reverse -235 -249 -0.688726 0.265
NP_440376.1_1 Forward -288 -279 19.4693 0.000692
NP_440376.1_1 Reverse -279 -288 19.4693 0.000692
NP_440376.1_1 Reverse -379 -388 2.26134 0.228
NP_440376.1_1 Reverse -378 -387 1.47469 0.251
NP_440376.1_1 Forward -49 -40 1.37636 0.252
NP_440376.1_1 Reverse -171 -180 -0.0986038 0.285
NP_442687.1_7 Reverse -278 -288 18.5646 0.0028
NP_442687.1_7 Forward -289 -279 9.02648 0.0994
NP_441846.1_10 Forward -264 -245 -12.7836 0.194
NP_440642.1_10 Reverse -236 -250 4.71887 0.25
NP_441422.1_7 Forward -290 -273 -9.10594 0.293
NP_440667.1_8 Forward -386 -367 12.88 0.236
NP_442296.1_5 Forward -261 -242 1.57275 0.281
NP_442658.1_1 Reverse -277 -287 14.8275 0.0188
NP_442658.1_1 Forward -290 -280 14.2375 0.0237
NP_442658.1_1 Reverse -252 -262 7.64939 0.213
NP_442658.1_1 Reverse -104 -114 6.0761 0.238
NP_442198.1_7 Forward -291 -272 20.0581 0.055
NP_442782.1_2 Forward -18 -4 3.04785 0.269
NP_442782.1_2 Forward -288 -274 2.2612 0.275
NP_442544.1_2 Reverse -311 -325 -1.67204 0.287
NP_440800.1_7 Forward -147 -133 10.816 0.294
NP_440607.1_3 Forward -396 -377 11.8967 0.298
NP_441487.1_6 Forward -296 -277 10.2259 0.175
NP_441487.1_9 Reverse -278 -297 -2.65548 0.293
NP_442937.1_5 Reverse -380 -399 6.19431 0.286
NP_441958.1_5 Forward -289 -279 21.2195 0.000805
NP_441958.1_5 Reverse -278 -288 20.5312 0.000966
NP_440203.1_5 Forward -285 -275 15.8108 0.0611
NP_439905.1_1 Reverse -280 -293 11.0324 0.204
NP_443001.1_7 Forward -287 -268 10.7175 0.166
NP_440984.1_7 Forward -293 -279 18.2892 0.0155
NP_442376.1_2 Reverse -274 -293 -4.6221 0.253
NP_442911.1_2 Reverse -269 -288 12.2908 0.0128
NP_441580.1_6 Reverse -268 -287 -8.06369 0.252
NP_440153.1_5 Reverse -280 -294 14.7492 0.0551
NP_442064.1_4 Forward -286 -267 8.25844 0.235
NP_443055.1_3 Forward -189 -170 17.807 0.05
NP_443055.1_6 Forward -395 -377 -2.43985 0.295
NP_440993.1_2 Forward -293 -277 2.61514 0.263
NP_440138.1_6 Forward -23 -4 3.83357 0.24
NP_441099.1_5 Reverse -269 -288 1.86774 0.0602
NP_442002.1_1 Reverse -376 -394 -9.51896 0.281
NP_442002.1_9 Reverse -278 -285 14.1004 0.074
NP_442002.1_9 Forward -313 -306 11.1505 0.185
NP_440809.1_9 Forward -297 -279 -7.65067 0.225
NP_440809.1_9 Reverse -270 -288 -7.749 0.225
NP_441294.1_7 Forward -292 -278 13.1862 0.0727
NP_441294.1_7 Forward -239 -225 9.53859 0.241
NP_441294.1_7 Reverse -325 -339 8.86667 0.274
NP_441646.1_1 Reverse -378 -397 11.0125 0.106
NP_441646.1_1 Reverse -272 -291 3.53937 0.206
NP_441646.1_1 Reverse -2 -21 1.57275 0.231
NP_442438.1_10 Reverse -274 -288 10.7177 0.0491
NP_441000.1_6 Reverse -278 -292 13.5693 0.0396
NP_442771.1_1 Forward -290 -272 -4.8974 0.166
NP_440147.1_4 Reverse -277 -290 11.0324 0.0341
NP_440147.1_4 Forward -290 -277 10.5407 0.0355
NP_440147.1_4 Reverse -383 -396 3.85419 0.179
NP_441295.1_4 Forward -393 -374 -2.75381 0.29
NP_441550.1_8 Forward -290 -280 15.8108 0.0132
NP_441550.1_8 Reverse -277 -287 15.4175 0.0132
NP_441916.1_7 Reverse -279 -289 18.9579 0.00144
NP_441916.1_7 Forward -288 -278 16.893 0.00407
NP_441916.1_7 Reverse -193 -203 2.63497 0.246
NP_440206.1_4 Reverse -274 -293 0.883656 0.289
NP_440465.1_10 Forward -291 -272 5.211 0.212
NP_441041.1_4 Forward -288 -269 2.65439 0.071
NP_441041.1_7 Reverse -276 -288 9.94422 0.104
NP_441041.1_7 Forward -291 -279 7.32042 0.169
NP_442004.1_6 Forward -288 -274 18.5841 0.0534
NP_441725.1_4 Reverse -274 -288 9.6354 0.149
NP_441725.1_5 Forward -287 -277 21.0229 0.00533
NP_441725.1_5 Forward -180 -170 7.45319 0.0965
NP_441725.1_5 Reverse -280 -290 1.94665 0.115
NP_439966.1_7 Forward -290 -280 14.3359 0.0203
NP_439966.1_7 Reverse -277 -287 9.12434 0.119
NP_442941.1_3 Reverse -280 -290 19.2529 0.00262
NP_442941.1_3 Forward -287 -277 11.3864 0.0116
NP_442941.1_3 Forward -84 -74 2.7333 0.14
NP_440289.1_2 Reverse -276 -289 6.31247 0.0604
NP_440289.1_2 Forward -291 -278 6.1158 0.0605
NP_440289.1_2 Reverse -92 -105 0.0192843 0.178
NP_440260.1_8 Reverse -243 -261 -5.19239 0.273
NP_442281.1_1 Reverse -274 -288 19.0751 0.00329
NP_442281.1_1 Forward -293 -279 8.25877 0.0832
NP_442281.1_1 Forward -185 -171 5.60385 0.152
NP_442281.1_1 Forward -392 -378 3.53891 0.228
NP_441334.1_7 Reverse -277 -296 -20.8467 0.281
NP_442256.1_2 Reverse -277 -295 10.4422 0.0965
NP_442068.1_1 Reverse -168 -187 7.47261 0.269
NP_441644.1_6 Reverse -279 -289 19.0557 0.000803
NP_441644.1_6 Forward -288 -278 15.7125 0.0048
NP_441644.1_6 Forward -394 -384 4.01116 0.253
NP_441795.1_5 Forward -65 -46 8.65258 0.245
NP_442215.1_2 Reverse -376 -392 0.845183 0.147
NP_442215.1_2 Forward -290 -274 -1.90808 0.189
NP_440929.1_8 Forward -288 -279 19.2726 0.000701
NP_440929.1_8 Reverse -279 -288 19.2726 0.000701
NP_442933.1_10 Forward -288 -279 17.601 0.00325
NP_442933.1_10 Reverse -279 -288 17.601 0.00325
NP_441751.2_8 Forward -287 -273 5.80112 0.0408
NP_442926.1_3 Reverse -268 -287 14.1591 0.0987
NP_442926.1_3 Forward -29 -10 2.45773 0.295
NP_442926.1_5 Reverse -274 -293 10.2702 0.263
NP_442554.1_8 Reverse -280 -290 17.2863 0.00543
NP_442554.1_8 Forward -287 -277 14.828 0.0108
NP_442554.1_8 Reverse -386 -396 3.12662 0.239
NP_442554.1_9 Reverse -12 -31 13.6457 0.279
NP_441762.1_7 Reverse -278 -290 1.7106 0.0735
NP_441762.1_7 Forward -289 -277 -6.84419 0.284
NP_442142.1_4 Reverse -276 -289 15.7516 0.0264
NP_442142.1_4 Reverse -12 -25 2.18201 0.299
NP_442292.1_1 Reverse -280 -289 17.5026 0.00435
NP_442292.1_1 Forward -287 -278 9.53783 0.0183
NP_440919.1_7 Reverse -136 -154 17.0198 0.142
NP_441525.1_1 Forward -398 -385 17.4239 0.139
NP_442476.1_6 Forward -287 -273 1.47456 0.214
NP_441711.1_4 Forward -396 -377 2.3594 0.29
NP_441523.1_6 Forward -292 -273 2.26107 0.297
NP_443009.1_5 Forward -289 -278 17.0694 0.00659
NP_443009.1_5 Reverse -278 -289 16.7744 0.00677
NP_441715.1_4 Reverse -280 -290 16.7946 0.0106
NP_441715.1_4 Forward -287 -277 7.25653 0.108
NP_440357.1_3 Forward -249 -230 4.52268 0.242
NP_440015.1_9 Forward -235 -217 -0.7675 0.264
NP_441448.1_7 Forward -261 -242 7.07928 0.26
NP_440183.1_1 Forward -287 -268 9.3409 0.244
NP_441198.1_8 Reverse -277 -287 13.076 0.108
NP_441468.1_1 Forward -287 -280 15.8704 0.0124
NP_441468.1_1 Reverse -280 -287 15.8704 0.0124
NP_441618.1_7 Forward -398 -379 12.626 0.295
NP_441015.1_10 Forward -267 -248 -9.93197 0.282
NP_441015.1_10 Forward -23 -4 -10.1286 0.283
NP_441015.1_10 Forward -281 -262 -11.0136 0.29
NP_441673.1_1 Forward -288 -279 20.8459 0.000698
NP_441673.1_1 Reverse -279 -288 20.8459 0.000698
NP_441826.1_2 Reverse -273 -287 5.01447 0.0978
NP_441330.1_1 Forward -293 -274 6.68596 0.0252
NP_441330.1_1 Forward -399 -380 -12.8819 0.183
NP_442490.1_9 Reverse -267 -286 -5.9004 0.273
NP_442868.1_6 Forward -290 -280 10.4031 0.038
NP_442868.1_6 Reverse -277 -287 9.22315 0.0527
NP_442868.1_6 Forward -400 -390 3.22496 0.202
NP_441056.1_1 Forward -288 -269 2.0644 0.137
NP_441056.1_1 Reverse -9 -28 -7.17871 0.271
NP_442808.1_1 Reverse -278 -288 8.73102 0.0481
NP_442808.1_1 Forward -289 -279 8.73102 0.0481
NP_442808.1_1 Reverse -48 -58 2.63453 0.26
NP_441101.1_10 Reverse -239 -258 -2.26216 0.229
NP_442692.1_1 Reverse -269 -288 -5.21209 0.274
NP_442542.1_2 Forward -290 -277 9.65572 0.133
NP_442542.1_9 Forward -295 -281 12.8803 0.108
NP_442050.1_5 Forward -290 -280 15.9091 0.0091
NP_442050.1_5 Reverse -277 -287 15.8108 0.0091
NP_442342.1_9 Forward -290 -274 8.90832 0.178
NP_440385.1_2 Forward -318 -304 17.8958 0.266
NP_441114.1_3 Forward -179 -170 7.57121 0.231
NP_440558.1_2 Reverse -270 -289 -5.21209 0.254
NP_442789.1_4 Forward -87 -68 7.37428 0.113
NP_441878.1_6 Reverse -278 -288 20.2362 0.0046
NP_441878.1_6 Forward -289 -279 10.5014 0.0176
NP_441878.1_6 Reverse -3 -13 -0.0199663 0.163
NP_441878.1_6 Reverse -378 -388 -6.50981 0.191
NP_441878.1_6 Reverse -171 -181 -6.70647 0.194
NP_441878.1_6 Forward -388 -378 -7.88644 0.278
NP_441036.1_8 Forward -289 -279 15.713 0.00724
NP_441036.1_8 Reverse -278 -288 8.4365 0.174
NP_442650.1_2 Forward -288 -274 6.88276 0.13
NP_441557.1_5 Forward -288 -279 19.9609 0.000699
NP_441557.1_5 Reverse -279 -288 19.9609 0.000699
NP_441445.1_1 Reverse -200 -219 3.83436 0.205
NP_441445.1_1 Reverse -270 -289 2.26107 0.238
NP_441590.1_4 Forward -398 -379 18.1898 0.131
NP_442066.2_4 Reverse -199 -218 -8.65367 0.294
NP_442419.1_2 Forward -293 -274 -5.31042 0.295
NP_440101.1_3 Forward -293 -274 10.7175 0.116
NP_440101.1_3 Reverse -4 -23 1.17943 0.282
NP_440101.1_10 Reverse -379 -398 5.89931 0.207
NP_442183.1_1 Forward -288 -274 15.8309 0.0182
NP_441459.1_8 Reverse -272 -285 13.884 0.286
NP_441574.1_1 Forward -288 -269 -4.81876 0.254
NP_441549.1_9 Forward -292 -274 5.62401 0.0925
NP_441549.1_9 Reverse -275 -293 -10.4039 0.278
NP_442170.1_5 Reverse -279 -298 0.196116 0.224
NP_442347.1_2 Forward -287 -278 3.34298 0.284
NP_442347.1_2 Reverse -280 -289 3.34298 0.284
NP_442347.1_10 Reverse -247 -261 16.2235 0.183
NP_441037.1_4 Reverse -277 -287 9.65667 0.21
NP_441037.1_4 Forward -389 -379 8.87701 0.237
NP_441037.1_4 Reverse -125 -135 7.90244 0.237
NP_441037.1_4 Forward -290 -280 7.22024 0.237
NP_442594.1_8 Forward -264 -245 3.04771 0.289
NP_442508.1_3 Forward -72 -53 13.6675 0.242
NP_441633.1_3 Forward -290 -277 5.62415 0.0481
NP_440136.1_2 Forward -287 -280 15.9687 0.0123
NP_440136.1_2 Reverse -280 -287 15.9687 0.0123
NP_442590.1_10 Forward -288 -269 5.50599 0.258
NP_442998.1_5 Forward -314 -304 12.9597 0.158
NP_442998.1_10 Forward -286 -279 15.5754 0.0102
NP_442998.1_10 Reverse -281 -288 15.5754 0.0102
NP_440731.1_2 Forward -30 -11 2.94938 0.297
NP_440899.1_1 Reverse -100 -119 12.1159 0.148
NP_440299.1_1 Reverse -275 -288 19.0949 0.00293
NP_441799.1_1 Forward -292 -278 9.6354 0.0879
NP_441799.1_1 Reverse -275 -289 7.27547 0.147
NP_441799.1_1 Forward -398 -384 5.80051 0.194
NP_441799.1_9 Reverse -278 -297 -0.983855 0.213
NP_441007.1_10 Reverse -274 -287 1.69091 0.203
NP_441007.1_10 Forward -293 -280 1.39592 0.203
NP_442201.1_10 Forward -299 -280 -7.27704 0.196
NP_442333.2_5 Forward -191 -172 -9.34199 0.246
NP_440256.1_1 Reverse -276 -295 14.0608 0.00931
NP_440256.1_1 Forward -291 -272 -0.787193 0.0961
NP_441512.1_4 Forward -398 -379 11.5042 0.237
NP_441559.1_8 Forward -293 -279 1.47456 0.155
NP_441559.1_8 Reverse -385 -399 -0.000409212 0.171
NP_441559.1_8 Reverse -274 -288 -6.58858 0.279
NP_440915.1_6 Reverse -275 -289 14.7492 0.0183
NP_440915.1_6 Forward -292 -278 1.08123 0.147
NP_440915.1_6 Forward -258 -244 -1.47537 0.236
NP_440915.1_6 Forward -17 -3 -3.34366 0.293
NP_442158.1_4 Reverse -234 -244 11.4848 0.271
NP_442785.1_7 Reverse -277 -291 8.94771 0.279
NP_441866.1_6 Reverse -139 -158 7.57013 0.271
NP_440749.1_1 Forward -288 -269 0.786102 0.257
NP_442866.1_1 Forward -293 -274 -1.27885 0.203
NP_442031.1_3 Reverse -374 -393 7.96426 0.221
NP_441464.1_10 Forward -61 -47 11.996 0.208
NP_440026.1_4 Forward -291 -272 10.9142 0.239
NP_440026.1_7 Reverse -385 -400 16.3028 0.175
NP_440695.1_5 Forward -288 -269 7.66927 0.15
NP_441494.1_6 Reverse -274 -287 10.7374 0.225
NP_442993.1_1 Reverse -322 -338 -11.6429 0.255
NP_442386.1_9 Forward -400 -391 7.86578 0.215
NP_442386.1_9 Forward -289 -280 6.39082 0.219
NP_442386.1_9 Reverse -278 -287 6.39082 0.219
NP_441340.1_5 Forward -287 -280 15.6737 0.0124
NP_441340.1_5 Reverse -280 -287 15.6737 0.0124
NP_442484.1_2 Reverse -268 -287 4.22769 0.19
NP_442484.1_2 Forward -287 -268 0.491109 0.247
NP_440168.1_8 Reverse -100 -119 5.40766 0.216
NP_440327.1_6 Forward -70 -51 8.94757 0.214
NP_440327.1_6 Forward -287 -268 2.65439 0.292
NP_442714.1_7 Reverse -40 -59 6.78429 0.16
NP_441160.1_5 Forward -59 -40 -5.9004 0.288
NP_440586.1_8 Forward -287 -280 13.2151 0.026
NP_440586.1_8 Reverse -280 -287 13.2151 0.026
NP_442251.1_6 Forward -287 -280 15.2804 0.0124
NP_442251.1_6 Reverse -280 -287 15.2804 0.0124
NP_440192.1_5 Reverse -225 -244 3.93269 0.268
NP_442959.1_7 Forward -122 -103 0.196116 0.235
NP_440969.1_3 Reverse -313 -331 6.40989 0.294
NP_441262.1_3 Reverse -279 -286 14.7888 0.0223
NP_441262.1_3 Forward -288 -281 14.7888 0.0223
NP_443051.1_1 Forward -289 -280 19.5676 0.00335
NP_443051.1_1 Reverse -278 -287 18.0926 0.00402
NP_443051.1_5 Forward -320 -301 5.60432 0.256
NP_439937.1_9 Forward -289 -272 -7.04165 0.157
NP_439937.1_9 Reverse -278 -295 -14.5148 0.287
NP_440398.1_4 Forward -387 -368 17.8957 0.159
NP_440408.1_7 Forward -288 -269 11.9958 0.212
NP_440408.1_7 Reverse -279 -298 7.57094 0.287
NP_440626.1_5 Reverse -310 -329 14.8466 0.241
NP_440439.1_1 Forward -291 -278 22.3404 0.00844
NP_440439.1_1 Reverse -276 -289 7.09911 0.0693
NP_439943.1_1 Reverse -379 -398 4.32602 0.105
NP_440372.1_2 Forward -287 -280 16.3621 0.0124
NP_440372.1_2 Reverse -280 -287 16.3621 0.0124
NP_441789.1_7 Forward -297 -278 -2.45958 0.257
NP_441789.1_7 Reverse -245 -264 -2.95123 0.267
NP_441803.1_2 Reverse -373 -392 -1.18052 0.294
NP_439977.1_5 Reverse -3 -22 1.96607 0.183
NP_440139.1_1 Forward -294 -275 14.0599 0.0548
NP_440139.1_1 Forward -187 -168 6.29183 0.143
NP_441572.1_7 Reverse -273 -292 8.84924 0.074
NP_441572.1_7 Forward -24 -5 -4.81876 0.244
NP_440267.1_2 Forward -293 -279 11.9953 0.125
NP_442384.1_10 Forward -288 -275 18.0139 0.00545
NP_442384.1_10 Reverse -279 -292 11.524 0.0348
NP_442384.1_10 Forward -394 -381 1.78924 0.247
NP_441018.1_7 Forward -292 -273 9.0459 0.236
NP_442262.1_10 Forward -287 -280 14.1988 0.0123
NP_442262.1_10 Reverse -280 -287 14.1988 0.0123
NP_442262.1_10 Forward -393 -386 9.47889 0.187
NP_441689.1_5 Reverse -277 -287 8.63269 0.132
NP_441689.1_5 Forward -290 -280 8.3377 0.132
NP_440163.1_10 Forward -205 -195 11.7798 0.169
NP_440163.1_10 Forward -334 -324 8.23984 0.282
NP_440344.1_10 Reverse -272 -289 10.6586 0.00697
NP_440282.1_3 Reverse -268 -287 0.687771 0.281
NP_440282.1_10 Reverse -269 -288 -8.752 0.263
NP_440531.1_6 Forward -296 -277 -0.983855 0.226
NP_442123.1_1 Forward -271 -252 13.4708 0.137
NP_442123.1_3 Reverse -279 -298 13.5691 0.16
NP_442910.1_1 Reverse -272 -291 4.32602 0.118
NP_442910.1_6 Reverse -246 -260 20.3541 0.00716
NP_440297.1_9 Forward -287 -277 19.0562 0.0359
NP_440297.1_9 Forward -180 -170 13.648 0.0917
NP_440297.1_9 Forward -155 -145 6.46988 0.185
NP_440297.1_9 Forward -281 -271 0.0783647 0.282
NP_440297.1_9 Reverse -280 -290 -0.216628 0.282
NP_442129.1_6 Forward -37 -18 15.7886 0.246
NP_440999.1_9 Reverse -275 -289 0.88457 0.174
NP_440999.1_9 Forward -292 -278 -2.55701 0.27
NP_440888.1_2 Reverse -279 -293 15.2402 0.0118
NP_440888.1_2 Forward -288 -274 7.96378 0.175
NP_440888.1_2 Reverse -253 -267 5.30886 0.284
NP_440600.1_4 Forward -296 -278 7.29564 0.0913
NP_442277.1_4 Forward -297 -278 13.6666 0.0519
NP_440575.1_1 Forward -309 -290 -3.44288 0.294
NP_441543.1_2 Reverse -280 -289 15.9293 0.00518
NP_441543.1_2 Forward -287 -278 9.34117 0.0818
NP_442845.1_2 Forward -288 -274 12.9793 0.1
NP_442845.1_2 Reverse -379 -393 7.37441 0.195
NP_442845.1_2 Reverse -273 -287 7.17775 0.198
NP_441551.1_5 Forward -292 -276 8.02265 0.241
NP_441551.1_5 Reverse -275 -291 6.35103 0.273
NP_441469.1_8 Reverse -278 -287 13.3727 0.073
NP_441469.1_8 Forward -289 -280 6.5879 0.227
NP_441469.1_8 Forward -269 -260 5.99792 0.241
NP_443064.1_6 Forward -288 -278 13.8273 0.0796
NP_443064.1_6 Reverse -279 -289 10.8217 0.13
NP_442578.1_7 Forward -287 -280 14.5921 0.026
NP_442578.1_7 Reverse -280 -287 14.5921 0.026
NP_440710.1_1 Forward -296 -278 3.46073 0.113
NP_440071.1_1 Forward -216 -199 11.7395 0.232
NP_440071.1_6 Forward -18 -4 13.1262 0.299
NP_441462.1_2 Reverse -279 -289 20.2362 0.000805
NP_441462.1_2 Forward -288 -278 20.1379 0.000967
NP_441929.1_3 Reverse -229 -248 5.89931 0.266
NP_443062.1_6 Reverse -271 -290 3.73603 0.229
NP_443062.1_6 Reverse -164 -183 1.27776 0.276
NP_441410.1_3 Reverse -270 -289 9.0459 0.21
NP_441410.1_3 Forward -297 -278 5.11266 0.252
NP_442204.1_1 Reverse -275 -286 9.79344 0.0736
NP_442204.1_1 Forward -292 -281 9.59678 0.0736
NP_442204.1_1 Forward -22 -11 6.35185 0.169
NP_442204.1_2 Reverse -269 -288 6.19431 0.291
NP_441560.1_8 Reverse -274 -293 11.7075 0.287
NP_441560.1_10 Reverse -271 -290 13.0775 0.138
NP_440516.1_6 Reverse -245 -259 8.55376 0.246
NP_440516.1_8 Forward -288 -279 16.9127 0.00442
NP_440516.1_8 Reverse -279 -288 16.9127 0.00442
NP_440516.1_8 Reverse -95 -104 -0.491928 0.262
NP_440516.1_8 Forward -276 -267 -0.590259 0.283
NP_442428.1_4 Reverse -378 -397 7.66927 0.184
NP_442428.1_5 Forward -287 -280 15.8704 0.0124
NP_442428.1_5 Reverse -280 -287 15.8704 0.0124
NP_442859.1_2 Reverse -274 -293 16.5191 0.068
NP_442823.1_8 Forward -399 -380 16.1257 0.177
NP_440673.1_3 Forward -286 -279 12.4288 0.0426
NP_440673.1_3 Reverse -281 -288 12.4288 0.0426
NP_440077.1_7 Reverse -171 -190 13.8641 0.268
NP_440865.1_9 Reverse -273 -292 -2.55715 0.184
NP_440865.1_9 Forward -294 -275 -6.98204 0.238
NP_441052.1_2 Forward -288 -278 10.4031 0.0285
NP_441052.1_2 Reverse -279 -289 10.4031 0.0285
NP_442219.1_9 Forward -287 -278 8.25953 0.0681
NP_442219.1_9 Reverse -280 -289 8.25953 0.0681
NP_440436.1_4 Forward -287 -278 15.9289 0.00508
NP_440436.1_4 Reverse -280 -289 9.24241 0.0871
NP_441884.1_8 Reverse -278 -297 -3.14714 0.143
NP_441884.1_9 Reverse -184 -203 -19.4701 0.15
NP_441884.1_9 Reverse -276 -295 -23.305 0.284
NP_440314.1_9 Reverse -41 -60 -9.93197 0.281
NP_440648.1_1 Reverse -279 -298 4.32602 0.226
NP_442414.1_9 Reverse -9 -28 10.8159 0.282
NP_442907.1_9 Reverse -274 -293 9.63589 0.102
NP_441719.1_4 Forward -287 -280 16.3621 0.0124
NP_441719.1_4 Reverse -280 -287 16.3621 0.0124
NP_441004.1_1 Reverse -373 -392 -17.5035 0.292
NP_441004.1_2 Reverse -243 -262 -0.4922 0.259
NP_441004.1_4 Forward -257 -247 8.23984 0.28
NP_441004.1_4 Reverse -376 -386 7.64985 0.294
NP_441004.1_5 Forward -341 -327 6.98109 0.295
NP_440129.1_10 Reverse -272 -286 6.29277 0.177
NP_440129.1_10 Forward -283 -269 2.45787 0.253
NP_442873.1_5 Reverse -246 -265 16.2232 0.149
NP_440296.1_10 Reverse -276 -295 -2.65548 0.209
NP_441115.1_4 Forward -289 -271 8.96649 0.229
NP_442206.1_10 Forward -120 -105 -0.413427 0.292
NP_442854.1_6 Reverse -273 -292 3.04771 0.272
NP_440328.1_4 Forward -204 -185 9.14423 0.105
NP_440328.1_4 Forward -294 -275 4.81767 0.159
NP_440094.1_2 Forward -29 -10 0.884433 0.281
NP_443054.1_2 Reverse -38 -52 -0.0987402 0.284
NP_442586.1_6 Forward -60 -41 11.6025 0.227
NP_441851.1_10 Reverse -278 -288 17.4829 0.0027
NP_441851.1_10 Forward -289 -279 8.53483 0.114
NP_442622.1_8 Reverse -279 -297 -18.7621 0.268
NP_442515.1_1 Reverse -278 -292 9.93102 0.058
NP_442515.1_1 Reverse -39 -53 0.491246 0.19
NP_442515.1_1 Forward -219 -205 -3.83532 0.298
NP_442515.1_1 Forward -289 -275 -3.93365 0.298
NP_440593.1_3 Forward -293 -274 -6.1954 0.271
NP_441982.1_6 Reverse -27 -36 12.7718 0.274
NP_441349.1_10 Forward -298 -279 1.37609 0.084
NP_441409.1_6 Reverse -273 -292 11.8975 0.0226
NP_442314.1_1 Forward -257 -239 29.3218 0.000551
NP_442314.1_2 Forward -60 -41 31.1704 0.000342
NP_442314.1_3 Forward -280 -266 23.894 0.0376
NP_442314.1_4 Forward -98 -80 23.3236 0.0273
NP_442314.1_5 Forward -379 -360 24.2872 0.0178
NP_442314.1_6 Forward -232 -213 24.9755 0.0122
NP_440432.1_9 Reverse -280 -295 6.37141 0.0477
NP_442843.1_1 Reverse -172 -191 -5.60541 0.244
NP_442843.1_1 Forward -66 -47 -12.0953 0.298
NP_439960.1_6 Forward -400 -381 7.47261 0.28
NP_441477.1_6 Forward -118 -104 19.5675 0.0972
NP_440431.1_3 Forward -289 -270 6.29264 0.09
NP_442450.1_5 Reverse -277 -287 19.1546 0.0103
NP_440588.1_2 Reverse -270 -289 -4.42544 0.216
NP_440195.1_5 Reverse -89 -108 0.196116 0.3
NP_442006.1_2 Forward -255 -238 1.12048 0.124
NP_442006.1_2 Forward -277 -260 -18.8407 0.296
NP_442243.1_1 Forward -394 -376 7.09821 0.178
NP_441570.1_1 Reverse -279 -297 0.0191479 0.0424
NP_441570.1_1 Reverse -226 -244 -2.93078 0.0686
NP_441570.1_1 Forward -288 -270 -17.3854 0.273
NP_441078.1_4 Forward -288 -279 19.6659 0.0007
NP_441078.1_4 Reverse -279 -288 19.6659 0.0007
NP_441078.1_4 Forward -369 -360 3.44131 0.14
NP_442729.1_8 Reverse -275 -288 8.67241 0.125
NP_441663.1_8 Forward -294 -275 6.4893 0.123
NP_442348.1_2 Reverse -171 -180 11.8978 0.225
NP_442348.1_2 Forward -59 -50 7.27622 0.28
NP_440707.1_6 Forward -296 -277 24.188 0.0066
NP_442443.1_1 Forward -261 -242 -5.31042 0.282
NP_440526.1_3 Forward -287 -276 8.61296 0.118
NP_441432.1_8 Forward -289 -280 16.8143 0.00595
NP_441432.1_8 Reverse -278 -287 8.35786 0.0755
NP_441432.1_8 Forward -277 -268 5.40793 0.158
NP_441432.1_8 Reverse -171 -180 3.83464 0.243
NP_441432.1_8 Reverse -111 -120 2.75299 0.287
NP_442320.1_8 Reverse -273 -287 7.27608 0.0204
NP_441732.1_2 Reverse -275 -291 2.32015 0.0253
NP_441732.1_2 Forward -292 -276 -16.3627 0.165
NP_440313.1_5 Forward -189 -171 12.1131 0.24
NP_440313.1_6 Forward -246 -227 18.4857 0.167
NP_442815.1_2 Forward -332 -314 3.26407 0.271
NP_441945.1_10 Reverse -171 -190 6.88262 0.291
NP_441057.1_3 Reverse -381 -400 -11.8003 0.24
NP_441072.1_2 Forward -299 -280 8.16093 0.24
NP_442400.1_1 Reverse -319 -338 -5.01543 0.283
NP_440713.1_4 Reverse -269 -288 4.03102 0.231
NP_442489.1_2 Forward -167 -148 0.58944 0.297
NP_442489.1_7 Forward -288 -279 20.1576 0.000695
NP_442489.1_7 Reverse -279 -288 20.1576 0.000695
NP_442079.1_6 Reverse -271 -290 12.1925 0.299
NP_442079.1_7 Forward -287 -268 1.47442 0.251
NP_440559.1_1 Forward -287 -278 17.306 0.00658
NP_440559.1_1 Reverse -280 -289 8.65285 0.0586
NP_441659.2_8 Reverse -279 -289 20.9245 0.000805
NP_441659.2_8 Forward -288 -278 19.3512 0.000966
NP_442913.1_10 Forward -297 -278 -2.16383 0.182
NP_442008.1_2 Reverse -276 -295 23.8939 0.00712
NP_440708.1_6 Reverse -11 -30 -9.047 0.26
NP_441800.1_10 Reverse -171 -190 4.81767 0.252
NP_441807.1_1 Reverse -279 -298 19.469 0.177
NP_442346.1_2 Forward -293 -274 4.03102 0.293
NP_442346.1_5 Reverse -278 -288 17.9746 0.00128
NP_442346.1_5 Forward -289 -279 16.303 0.00248
NP_442346.1_5 Reverse -225 -235 6.27322 0.208
NP_442346.1_5 Reverse -126 -136 5.28991 0.253
NP_442346.1_5 Reverse -171 -181 4.40493 0.29
NP_440545.1_3 Forward -292 -275 14.7885 0.0141
NP_440545.1_3 Reverse -275 -292 7.41366 0.0499
NP_440545.1_3 Forward -202 -185 -6.54933 0.283
NP_440831.1_3 Reverse -243 -262 14.3475 0.114
NP_440486.1_6 Forward -262 -243 5.40766 0.297
NP_440459.1_2 Forward -396 -379 7.61033 0.285
NP_441653.1_2 Forward -287 -268 19.5708 0.0262
NP_440010.1_4 Forward -292 -273 -0.886293 0.265
NP_440010.1_10 Reverse -381 -400 1.57275 0.297
NP_442551.1_4 Reverse -37 -52 7.35472 0.166
NP_440847.1_5 Reverse -380 -399 11.6025 0.281
NP_442603.1_7 Forward -288 -274 10.0287 0.134
NP_441888.1_7 Forward -147 -133 1.37622 0.253
NP_441050.1_5 Forward -74 -56 9.85225 0.143
NP_440449.1_6 Forward -395 -377 4.75436 0.291
NP_441593.1_4 Reverse -304 -323 18.7798 0.0455
NP_441948.1_4 Forward -295 -277 -3.71743 0.203
NP_441047.1_2 Forward -327 -308 -3.24547 0.29
NP_441833.1_4 Forward -287 -280 15.9687 0.0124
NP_441833.1_4 Reverse -280 -287 15.9687 0.0124
NP_441112.1_6 Forward -298 -279 10.2259 0.103
NP_442162.1_9 Forward -287 -280 16.2637 0.0124
NP_442162.1_9 Reverse -280 -287 16.2637 0.0124
NP_440671.1_4 Reverse -273 -287 19.5675 0.00937
NP_440671.1_4 Forward -208 -194 12.1926 0.114
NP_442199.1_5 Reverse -271 -290 -1.57384 0.181
NP_442140.1_3 Forward -393 -383 9.32148 0.109
NP_442140.1_3 Forward -287 -277 5.68323 0.198
NP_442140.1_3 Reverse -280 -290 4.69992 0.238
NP_442723.1_8 Reverse -378 -392 19.9608 0.149
NP_440875.1_9 Reverse -281 -291 13.5309 0.0677
NP_440875.1_9 Forward -16 -6 10.2214 0.231
NP_441813.1_5 Forward -290 -280 18.1713 0.00743
NP_441813.1_5 Reverse -277 -287 16.1063 0.01
NP_440590.1_4 Reverse -280 -293 3.16588 0.0756
NP_440590.1_4 Forward -287 -274 -4.20895 0.258
NP_440567.1_1 Forward -287 -273 15.8309 0.0166
NP_440567.1_1 Reverse -280 -294 1.67122 0.196
NP_442497.1_10 Forward -287 -278 19.8626 0.00532
NP_442497.1_10 Reverse -280 -289 17.601 0.00813
NP_440821.1_4 Reverse -277 -287 19.8429 0.00399
NP_440821.1_4 Forward -290 -280 2.24165 0.131
NP_441239.1_9 Forward -290 -278 16.5586 0.0166
NP_441239.1_9 Forward -396 -384 12.822 0.0418
NP_441239.1_9 Reverse -277 -289 11.7404 0.0551
NP_441239.1_9 Reverse -243 -255 6.03717 0.202
NP_441239.1_9 Reverse -7 -19 4.07055 0.264
NP_441951.1_7 Reverse -282 -296 16.2288 0.275
NP_441009.1_4 Forward -288 -269 12.5858 0.232
NP_441727.1_3 Reverse -272 -291 2.75272 0.299
NP_441892.1_1 Forward -297 -280 9.47861 0.0722
NP_441892.1_1 Reverse -270 -287 3.57876 0.123
NP_440604.1_6 Reverse -226 -245 -3.73712 0.232
NP_441017.1_6 Reverse -269 -283 12.6836 0.217
NP_440876.1_5 Reverse -17 -36 8.16093 0.277
NP_440949.1_7 Reverse -62 -81 8.25844 0.293
NP_440546.1_4 Reverse -385 -395 13.9243 0.0459
NP_440546.1_4 Reverse -279 -289 13.5365 0.0459
NP_440546.1_4 Forward -288 -278 12.8578 0.0572
NP_440546.1_4 Forward -394 -384 7.81598 0.22
NP_441230.1_5 Forward -293 -274 28.3188 0.000411
NP_440462.1_6 Forward -290 -280 18.7612 0.00454
NP_440462.1_6 Reverse -277 -287 7.84651 0.0699
NP_440868.1_4 Forward -292 -280 17.3452 0.0124
NP_440868.1_4 Reverse -275 -287 -0.551008 0.274
NP_440401.1_9 Reverse -54 -61 14.5917 0.287
NP_441249.1_3 Forward -396 -377 0.294447 0.285
NP_440374.1_7 Forward -309 -295 16.058 0.236
NP_440905.1_1 Forward -107 -89 6.01734 0.229
NP_442402.1_10 Forward -37 -27 10.4026 0.29
NP_441848.1_7 Reverse -57 -76 1.76863 0.228
NP_441084.1_6 Forward -396 -382 11.2833 0.208
NP_440696.1_3 Forward -292 -274 0.904127 0.225
NP_440696.1_3 Reverse -5 -23 -4.01242 0.294
NP_440696.1_6 Forward -399 -380 5.70265 0.266
NP_442039.1_4 Forward -287 -280 15.1821 0.0124
NP_442039.1_4 Reverse -280 -287 15.1821 0.0124
NP_442039.1_7 Forward -222 -212 15.5163 0.211
NP_442039.1_7 Reverse -108 -118 7.45319 0.276
NP_442837.1_3 Forward -287 -280 15.7721 0.0124
NP_442837.1_3 Reverse -280 -287 15.7721 0.0124
NP_440160.1_2 Forward -400 -381 -7.96535 0.286
NP_442053.1_1 Forward -288 -279 18.3876 0.0007
NP_442053.1_1 Reverse -279 -288 18.3876 0.0007
NP_440505.1_3 Forward -290 -280 17.188 0.00332
NP_440505.1_3 Forward -278 -268 12.0747 0.0596
NP_440505.1_3 Reverse -277 -287 7.55152 0.151
NP_440520.1_1 Forward -264 -245 5.99764 0.129
NP_442971.1_3 Forward -254 -235 13.0775 0.293
NP_441203.1_1 Forward -287 -268 -10.227 0.137
NP_441408.2_7 Forward -396 -377 5.60432 0.172
NP_442174.1_9 Forward -290 -271 12.6841 0.164
NP_440914.1_1 Reverse -279 -289 16.3248 0.00196
NP_440914.1_1 Forward -387 -377 10.7621 0.122
NP_440914.1_1 Forward -180 -170 10.6645 0.129
NP_440914.1_1 Forward -288 -278 8.51751 0.186
NP_441011.1_8 Reverse -280 -289 16.6177 0.00602
NP_441011.1_8 Forward -287 -278 14.356 0.0249
NP_442101.1_10 Forward -296 -277 5.80098 0.0488
NP_442533.1_6 Forward -288 -279 17.2076 0.00137
NP_442533.1_6 Reverse -279 -288 17.2076 0.00137
NP_442533.1_6 Reverse -4 -13 6.48957 0.109
NP_442533.1_6 Reverse -385 -394 4.71961 0.177
NP_442533.1_6 Forward -13 -4 4.12963 0.191
NP_442533.1_6 Forward -180 -171 4.0313 0.194
NP_442533.1_6 Forward -394 -385 3.83464 0.202
NP_442533.1_6 Forward -387 -378 3.34298 0.216
NP_442541.1_10 Forward -115 -101 0.982316 0.292
NP_442232.1_3 Forward -271 -252 -9.53865 0.252
NP_442232.1_3 Reverse -271 -290 -12.4886 0.282
NP_441482.1_7 Reverse -273 -287 19.4691 0.00373
NP_441482.1_7 Forward -24 -10 -11.2101 0.245
NP_441482.1_7 Forward -294 -280 -12.1934 0.29
NP_439944.1_9 Forward -287 -277 17.3846 0.00516
NP_439944.1_9 Reverse -280 -290 9.12481 0.1
NP_441697.1_5 Forward -319 -300 -0.716613 0.204
NP_441028.1_6 Forward -301 -291 5.19112 0.265
NP_440116.1_8 Forward -287 -268 2.65439 0.0857
NP_441527.1_4 Forward -253 -234 -8.73794 0.25
NP_440115.1_6 Forward -291 -281 13.0581 0.0818
NP_440115.1_6 Reverse -276 -286 9.7148 0.115
NP_440007.1_9 Reverse -275 -289 13.1759 0.163
NP_440007.1_9 Forward -22 -8 3.63784 0.268
NP_439965.1_1 Reverse -270 -289 -6.1954 0.211
NP_441059.1_2 Forward -398 -379 -5.50708 0.257
NP_441972.1_5 Forward -287 -268 -3.83545 0.201
NP_441972.1_5 Reverse -268 -287 -5.40875 0.22
NP_441106.1_1 Forward -289 -280 18.486 0.0028
NP_441106.1_1 Reverse -278 -287 9.73449 0.0311
NP_441106.1_1 Forward -19 -10 2.75299 0.261
NP_439903.1_6 Forward -291 -272 6.48849 0.167
NP_439903.1_6 Forward -184 -165 -0.787962 0.285
NP_001035870.1_5 Forward -185 -166 17.1082 0.214
NP_442306.1_10 Forward -293 -274 -10.227 0.11
NP_442306.1_10 Forward -399 -380 -12.3902 0.173
NP_441286.1_1 Forward -289 -277 14.4936 0.00418
NP_441286.1_1 Reverse -278 -290 -3.50094 0.145
NP_440092.1_9 Forward -119 -100 15.1424 0.269
NP_440670.1_8 Forward -288 -279 18.3876 0.000699
NP_440670.1_8 Reverse -279 -288 18.3876 0.000699
NP_441479.1_9 Forward -282 -264 14.9655 0.271
NP_441705.1_3 Reverse -127 -146 -4.6221 0.291
NP_440886.1_7 Forward -289 -279 8.04271 0.0805
NP_440886.1_7 Reverse -278 -288 8.04271 0.0805
NP_440886.1_7 Forward -105 -95 4.30615 0.243
NP_442614.1_2 Forward -288 -274 9.2427 0.242
NP_442614.1_2 Reverse -95 -109 6.09611 0.293
NP_442072.1_9 Reverse -278 -296 -20.532 0.204
NP_440513.1_6 Forward -298 -279 16.2232 0.189
NP_442022.1_4 Reverse -203 -222 11.6025 0.208
NP_440907.2_8 Forward -287 -277 9.81266 0.103
NP_440907.2_8 Reverse -280 -290 9.616 0.103
NP_442264.1_2 Forward -292 -275 6.72535 0.25
NP_442264.1_2 Reverse -269 -286 5.64371 0.274
NP_442264.1_5 Forward -288 -274 11.5043 0.256
NP_441021.1_1 Reverse -268 -287 -8.45701 0.195
NP_441021.1_1 Forward -287 -268 -10.7186 0.246
NP_440841.1_4 Reverse -277 -296 -6.68705 0.215
NP_441463.1_3 Reverse -269 -288 0.0977854 0.132
NP_441463.1_3 Forward -298 -279 -1.47551 0.141
NP_441463.1_3 Forward -191 -172 -10.6203 0.299
NP_441463.1_5 Reverse -278 -292 14.3559 0.188
NP_441463.1_6 Forward -290 -276 5.44959 0.287
NP_442842.1_4 Forward -287 -268 2.85105 0.265
NP_441626.1_2 Forward -287 -280 15.7721 0.0124
NP_441626.1_2 Reverse -280 -287 15.7721 0.0124
NP_442365.1_7 Reverse -275 -294 -1.27885 0.191
NP_441460.1_5 Reverse -227 -241 16.2235 0.204
NP_442794.1_1 Reverse -275 -287 10.2654 0.0721
NP_441401.1_5 Forward -337 -318 15.9945 0.264
NP_442615.1_1 Reverse -270 -288 0.805796 0.0957
NP_441962.1_4 Forward -287 -268 -14.9469 0.296
NP_440387.1_1 Forward -288 -272 -2.39974 0.147
NP_440387.1_5 Forward -233 -214 13.7292 0.26
NP_441431.1_2 Forward -397 -383 11.7987 0.132
NP_441431.1_2 Forward -291 -277 7.17714 0.247
NP_441836.1_2 Forward -400 -381 -1.67217 0.223
NP_440634.1_1 Forward -256 -237 12.8808 0.26
NP_441993.1_1 Reverse -273 -292 8.37887 0.147
NP_441993.1_1 Reverse -379 -398 4.18821 0.223
NP_442084.1_6 Forward -33 -15 5.03403 0.271
NP_440467.1_3 Reverse -268 -287 18.4831 0.0473
NP_440467.1_3 Forward -287 -268 12.0375 0.252
NP_440467.1_8 Reverse -159 -178 15.6341 0.126
NP_440114.1_10 Reverse -279 -293 17.5025 0.0104
NP_440114.1_10 Reverse -385 -399 10.6193 0.142
NP_440114.1_10 Reverse -171 -185 9.04604 0.186
NP_441425.1_3 Reverse -33 -43 15.2213 0.273
NP_442090.1_2 Reverse -18 -37 7.78217 0.281
NP_442437.1_8 Reverse -268 -287 7.47261 0.242
NP_442323.1_7 Forward -293 -274 17.5015 0.042
NP_441677.1_8 Forward -267 -253 18.7808 0.226
NP_440293.1_3 Forward -66 -47 -4.13045 0.258
NP_440766.1_4 Reverse -275 -289 8.16106 0.0871
NP_440766.1_5 Reverse -292 -304 7.36932 0.29
NP_439988.1_3 Reverse -374 -388 11.0127 0.219
NP_442743.1_8 Forward -316 -297 9.50036 0.255
NP_440643.1_2 Reverse -95 -114 18.584 0.0195
NP_439910.1_2 Reverse -271 -288 -22.184 0.215
NP_442867.1_8 Reverse -239 -258 8.65258 0.231
NP_440457.1_1 Reverse -275 -287 18.1319 0.0403
NP_440457.1_1 Forward -292 -280 1.31728 0.241
NP_440798.1_6 Reverse -280 -293 12.8023 0.0468
NP_441984.1_3 Forward -292 -274 12.9005 0.157
NP_441984.1_3 Forward -398 -380 8.37728 0.232
NP_440473.1_9 Forward -257 -238 -9.047 0.26
NP_442509.1_9 Forward -288 -278 17.3841 0.00128
NP_442509.1_9 Reverse -279 -289 8.04271 0.192
NP_442936.1_10 Forward -311 -297 9.16816 0.269
NP_442514.1_5 Forward -284 -265 -8.06442 0.284
NP_440554.1_4 Reverse -280 -290 17.9746 0.0131
NP_440554.1_4 Forward -287 -277 6.96153 0.107
NP_441885.1_5 Forward -288 -278 11.3864 0.00668
NP_441885.1_5 Reverse -279 -289 11.3864 0.00668
NP_440478.1_10 Reverse -383 -397 6.09611 0.3
NP_442341.1_3 Reverse -368 -387 1.27776 0.274
NP_442341.1_7 Forward -289 -275 6.3911 0.127
NP_442341.1_7 Reverse -318 -332 4.71948 0.181
NP_442341.1_7 Reverse -377 -391 1.96621 0.274
NP_442341.1_9 Forward -290 -276 22.5167 0.00232
NP_442341.1_9 Reverse -7 -21 6.78381 0.215
NP_441756.1_5 Reverse -275 -294 15.1424 0.0813
NP_442395.2_4 Forward -289 -270 6.29183 0.15
NP_443000.1_7 Forward -290 -280 20.3345 0.00223
NP_443000.1_7 Reverse -277 -287 8.82982 0.0437
NP_443000.1_7 Reverse -224 -234 1.55333 0.244
NP_442513.1_5 Forward -204 -185 10.0284 0.266
NP_441842.1_10 Reverse -88 -102 12.0943 0.111
NP_441842.1_10 Forward -295 -281 10.816 0.151
NP_441842.1_10 Reverse -272 -286 9.34103 0.192
NP_440275.1_3 Forward -290 -280 16.1063 0.0155
NP_440275.1_3 Reverse -277 -287 10.0098 0.0454
NP_442275.1_1 Forward -398 -379 3.04771 0.284
NP_441397.1_8 Reverse -292 -305 13.5261 0.245
NP_441902.1_3 Reverse -100 -110 11.524 0.298
NP_441359.1_5 Reverse -276 -295 3.6377 0.247
NP_441207.1_7 Forward -241 -227 10.6108 0.256
NP_440149.1_8 Reverse -172 -191 5.60432 0.0746
NP_440149.1_8 Forward -288 -269 -0.787193 0.154
NP_441105.1_3 Reverse -268 -287 14.6508 0.0216
NP_441105.1_3 Forward -293 -274 0.884433 0.12
NP_441105.1_3 Forward -274 -255 -9.93197 0.298
NP_442373.1_2 Forward -271 -252 2.26107 0.162
NP_442373.1_2 Reverse -169 -188 -7.67036 0.237
NP_440216.1_1 Reverse -279 -293 25.959 0.000481
NP_440216.1_1 Forward -288 -274 -2.26202 0.0484
NP_440216.1_9 Forward -245 -236 6.09625 0.289
NP_440172.1_1 Reverse -279 -289 17.5813 0.00421
NP_440172.1_1 Forward -288 -278 16.303 0.00854
NP_442015.1_10 Reverse -275 -288 19.7838 0.00366
NP_442015.1_10 Forward -292 -279 4.14919 0.178
NP_441226.1_7 Forward -287 -280 14.4934 0.0123
NP_441226.1_7 Reverse -280 -287 14.4934 0.0123
NP_442834.1_9 Reverse -145 -164 19.5673 0.0799
NP_441111.1_7 Forward -287 -279 18.7023 0.00294
NP_441111.1_7 Reverse -280 -288 18.7023 0.00294
NP_442379.1_10 Forward -295 -278 -1.82945 0.224
NP_441177.1_7 Forward -191 -172 13.5683 0.199
NP_441766.1_2 Forward -288 -279 17.5026 0.00297
NP_441766.1_2 Reverse -279 -288 17.5026 0.00297
NP_440416.1_1 Reverse -279 -298 -14.0619 0.284
NP_440416.1_9 Reverse -272 -291 6.58763 0.0325
NP_440416.1_9 Forward -295 -276 -6.88371 0.0951
NP_440416.1_9 Forward -283 -264 -18.0934 0.251
NP_440416.1_9 Reverse -378 -397 -18.9784 0.267
NP_443052.1_8 Forward -298 -279 -6.29373 0.142
NP_441940.1_4 Reverse -276 -295 9.24257 0.266
NP_441940.1_4 Forward -290 -271 8.35759 0.266
NP_442403.1_10 Forward -395 -376 23.2056 0.0399
NP_440591.1_9 Reverse -272 -290 12.2122 0.0935
NP_442154.1_1 Reverse -170 -188 -18.1721 0.278
NP_442154.1_1 Reverse -198 -216 -18.2704 0.279
NP_440261.1_5 Reverse -280 -293 5.03416 0.0478
NP_440261.1_5 Forward -287 -274 -0.767364 0.0655
NP_440988.1_10 Reverse -265 -279 4.31795 0.266
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGGGCAACCCATGGCCGAAGCCCAAGTATTAGTCTATGCCCCGAATAATTCCACTGAACCTTGGTTAACGGGGGTTACTGACAAAGAGGGCAAATTTATTTTTACTCCAGCAGGCGATCGCCCTGGCAATTGGGAAGTGGCAGTGCGGCAAGGGGGCCACGGAAATATGATCACCATACCTTGGCAACCAGAAACAACAGCGGTTGATAGCACCGATACAGCCAATGCCCTTACTTCTAGTGTCAACCAAGGCACTCCAGAAATTACCGTAGCCTCTGTACCGGATGCCAATGCTGCCCTATCTCCCATTCAACGGGGTATCACTTTAGGGGCCGTAATTTGGGGTTTTGTGGGTACTGCCCTATTTTTCAGCAGAAGCAAAGGTGAGGGCAGGGCCTAG

CDS

ATGCACATTCCCGATGGTCTATTGCCACCCCAGATCGTGGCCGGGGGCTATGCAGTGACGGGGTTAGCCACTTGGTACTGTCTGCGGCAAATTAATCGTCAAGGCCATGCCCAGGAAAATATTCCCAAAGCATCTTTGCTGACCGCAGCTTTTTTTGTTGCTTCCTCTATCTATATTCCCCTGCCGCCGGTGAGTGTCCACCTAATTCTCAACGGTCTGTTGGGGGTAATGCTGGGCTATTTTGCTCTGCCAGCCATTTTAATTGGCCTCTTTTTCCAAGCTTTGATGGTGGGCCATGGGGGGCTGACCACCTTGGGTATTAATGGTGTTTTGATGGGTTTGCCAACGTTGGCGGCCTATCATATTTTTCAACTGCGCCATGGGCTAGAAAAGTTTCTGCCGGAGCGCTGGGCCATGGGCATTGCTGCTTTTTTGGGGGGTAGCAGTGGTTTAGCCTTAACGGTGCTAATTTTCATTGCCCTCACTGTCACCAGTTTACCGACGGGTTTGGATGCCACCGCTGAGCGCCGAGCGATTATGGTGCTGGCGTTGGGCCATGTACCTCTGATTGTGCTAGAAGGCATATTCACTGCCCTGGTGGTTTTGTTTCTGCAACGGACTAAACCGGAATTACTGGAGAGTTAG

Protein

MHIPDGLLPPQIVAGGYAVTGLATWYCLRQINRQGHAQENIPKASLLTAAFFVASSIYIPLPPVSVHLILNGLLGVMLGYFALPAILIGLFFQALMVGHGGLTTLGINGVLMGLPTLAAYHIFQLRHGLEKFLPERWAMGIAAFLGGSSGLALTVLIFIALTVTSLPTGLDATAERRAIMVLALGHVPLIVLEGIFTALVVLFLQRTKPELLES