Your browser is old and dusty. Try Google Chrome!

Details for sll0382

ORF sll0382
Accession NP_442315.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -64 -50 2.2612 0.178
NP_440897.1_6 Forward -320 -301 -1.18128 0.187
NP_441453.1_4 Forward -224 -216 5.0343 0.209
NP_441453.1_4 Forward -59 -51 4.14932 0.264
NP_442182.1_3 Reverse -175 -194 3.04771 0.264
NP_441818.1_9 Forward -335 -316 -5.21209 0.251
NP_441818.1_9 Forward -338 -319 -8.35868 0.277
NP_441818.1_9 Forward -351 -332 -9.73531 0.291
NP_441816.1_6 Reverse -71 -83 15.5753 0.23
NP_442744.1_8 Forward -59 -40 -3.14714 0.297
NP_442655.1_10 Reverse -18 -37 -2.55715 0.19
NP_441066.1_1 Reverse -254 -273 10.5209 0.151
NP_442752.1_4 Reverse -182 -189 5.54565 0.194
NP_442909.1_2 Reverse -59 -78 12.4875 0.254
NP_440061.1_9 Reverse -160 -174 7.17714 0.216
NP_441145.1_1 Forward -166 -147 4.81767 0.254
NP_442062.1_8 Forward -59 -49 14.4347 0.0134
NP_442062.1_8 Forward -159 -149 6.56821 0.123
NP_442062.1_8 Reverse -182 -192 3.22496 0.279
NP_441900.1_2 Forward -40 -22 -5.48809 0.288
NP_442974.1_10 Reverse -59 -78 13.8633 0.267
NP_441859.1_3 Forward -40 -21 1.76863 0.275
NP_440304.1_4 Forward -61 -51 8.53483 0.0756
NP_442268.1_3 Forward -223 -204 12.6833 0.295
NP_439918.1_2 Forward -350 -331 5.11266 0.162
NP_440307.1_2 Reverse -64 -83 6.29264 0.209
NP_441208.1_1 Forward -71 -52 -2.85214 0.256
NP_441208.1_9 Forward -348 -334 9.34103 0.215
NP_441208.1_9 Reverse -27 -41 5.99778 0.254
NP_441594.1_6 Forward -290 -271 4.81767 0.211
NP_440370.1_10 Forward -305 -286 8.16093 0.243
NP_441925.1_4 Forward -43 -24 -16.9142 0.287
NP_440769.1_8 Forward -103 -84 8.06259 0.246
NP_441955.1_8 Reverse -162 -179 10.6586 0.248
NP_441955.1_8 Forward -183 -166 7.512 0.274
NP_440209.1_1 Forward -224 -216 5.13263 0.17
NP_442180.1_10 Forward -33 -14 6.78429 0.0765
NP_440447.1_1 Reverse -177 -195 5.72234 0.194
NP_441713.1_1 Reverse -44 -63 -3.83545 0.113
NP_442570.1_3 Forward -82 -63 -2.55715 0.212
NP_442111.1_4 Reverse -214 -228 2.35953 0.28
NP_442111.1_4 Forward -53 -39 2.16287 0.286
NP_441163.1_1 Forward -172 -155 10.1662 0.217
NP_441163.1_1 Forward -295 -278 9.77286 0.224
NP_441163.1_4 Reverse -157 -176 12.8237 0.278
NP_440747.1_10 Forward -227 -215 -12.2524 0.254
NP_441854.1_10 Forward -179 -160 5.211 0.259
NP_441486.1_1 Reverse -53 -67 1.86788 0.0969
NP_441486.1_1 Forward -62 -48 0.786239 0.126
NP_442634.1_2 Reverse -176 -195 4.916 0.263
NP_442634.1_4 Reverse -28 -42 -5.11362 0.235
NP_441265.1_1 Forward -306 -287 -9.63698 0.167
NP_440470.1_5 Forward -104 -85 7.11373 0.279
NP_440842.1_10 Forward -291 -277 1.08123 0.296
NP_442848.1_1 Forward -139 -125 -4.13031 0.282
NP_442848.1_4 Reverse -40 -54 6.3911 0.284
NP_442848.1_5 Forward -66 -48 -3.71743 0.297
NP_441012.1_4 Forward -147 -134 7.88576 0.272
NP_441012.1_4 Reverse -164 -177 6.80412 0.276
NP_441012.1_4 Reverse -52 -65 6.1158 0.286
NP_443018.1_3 Forward -58 -51 10.7572 0.0907
NP_443018.1_3 Reverse -51 -58 4.56234 0.241
NP_441634.1_8 Reverse -166 -180 -3.34366 0.295
NP_440376.1_1 Reverse -50 -59 6.48957 0.0963
NP_440376.1_1 Forward -59 -50 6.19458 0.109
NP_440376.1_1 Forward -65 -56 4.42462 0.159
NP_440376.1_1 Forward -242 -233 1.76968 0.242
NP_441857.1_5 Forward -184 -166 3.3624 0.244
NP_441857.1_6 Forward -352 -342 15.9097 0.199
NP_440266.1_3 Forward -166 -150 14.5964 0.266
NP_440580.1_2 Reverse -68 -86 10.4422 0.118
NP_442687.1_7 Reverse -49 -59 6.37155 0.171
NP_442589.1_5 Reverse -63 -82 12.5858 0.265
NP_442485.1_3 Reverse -45 -64 -6.1954 0.299
NP_441846.1_10 Reverse -167 -186 -23.305 0.282
NP_441013.1_2 Forward -301 -283 -2.43913 0.282
NP_441013.1_7 Reverse -152 -171 13.6666 0.281
NP_441422.1_3 Reverse -35 -54 14.4193 0.277
NP_442720.1_8 Forward -30 -12 10.8356 0.297
NP_442658.1_1 Reverse -48 -58 13.4509 0.0397
NP_442658.1_1 Forward -179 -169 5.38779 0.269
NP_442782.1_2 Reverse -50 -64 2.35953 0.275
NP_442782.1_2 Forward -64 -50 0.392915 0.29
NP_442496.1_5 Forward -172 -154 5.13236 0.288
NP_442205.1_3 Forward -202 -183 15.4385 0.285
NP_442205.1_9 Forward -65 -49 -2.20308 0.268
NP_439959.1_6 Forward -176 -157 11.7008 0.176
NP_442937.1_5 Reverse -19 -38 8.06259 0.234
NP_441958.1_5 Forward -60 -50 1.55333 0.095
NP_440203.1_5 Reverse -314 -324 13.0576 0.131
NP_440203.1_5 Reverse -33 -43 11.6809 0.182
NP_442025.1_7 Forward -352 -334 14.0265 0.276
NP_439905.1_1 Forward -58 -45 10.934 0.204
NP_439905.1_1 Forward -295 -282 9.75405 0.216
NP_440984.1_7 Forward -182 -168 5.40779 0.257
NP_442690.1_1 Reverse -72 -91 -15.8318 0.28
NP_442911.1_2 Reverse -20 -39 -9.14533 0.25
NP_442064.1_1 Reverse -45 -64 -11.8003 0.262
NP_442064.1_4 Forward -84 -65 4.22689 0.294
NP_440827.1_3 Reverse -157 -176 10.5209 0.298
NP_442210.1_5 Forward -334 -315 11.4058 0.22
NP_441646.1_1 Forward -172 -153 4.03102 0.203
NP_441646.1_1 Forward -46 -27 0.786102 0.243
NP_441752.1_6 Reverse -166 -185 -1.47551 0.288
NP_441674.1_10 Reverse -56 -74 2.47742 0.259
NP_440147.1_4 Reverse -48 -61 -0.275709 0.279
NP_441916.1_7 Reverse -50 -60 6.46988 0.0941
NP_441041.1_4 Forward -363 -344 -10.9153 0.238
NP_441041.1_4 Forward -170 -151 -11.7019 0.251
NP_442004.1_6 Reverse -50 -64 6.19444 0.181
NP_439966.1_7 Forward -226 -216 5.97777 0.199
NP_440736.1_3 Forward -61 -42 10.8159 0.145
NP_442941.1_3 Reverse -51 -61 0.471689 0.203
NP_442941.1_4 Reverse -77 -96 16.5191 0.134
NP_440289.1_2 Forward -227 -214 -2.83231 0.262
NP_440983.1_5 Reverse -156 -175 -8.94866 0.298
NP_440260.1_7 Reverse -289 -308 -5.40875 0.261
NP_442281.1_1 Reverse -337 -351 2.8506 0.253
NP_442281.1_1 Forward -182 -168 2.65393 0.26
NP_441334.1_7 Forward -193 -174 -15.0452 0.275
NP_442575.1_8 Forward -177 -158 -6.98204 0.294
NP_441556.1_7 Forward -187 -168 5.70185 0.198
NP_441556.1_10 Reverse -228 -242 11.2925 0.231
NP_441644.1_6 Reverse -50 -60 8.04271 0.11
NP_441644.1_6 Forward -59 -49 4.40448 0.239
NP_440867.1_10 Forward -297 -278 8.94757 0.25
NP_440867.1_10 Reverse -167 -186 7.27595 0.251
NP_442215.1_2 Reverse -28 -44 -0.924775 0.175
NP_442029.1_6 Forward -176 -157 7.7676 0.222
NP_440253.1_2 Forward -224 -206 4.14905 0.106
NP_442933.1_10 Reverse -50 -59 4.52295 0.24
NP_441751.2_8 Reverse -51 -65 -3.24533 0.137
NP_442926.1_3 Reverse -157 -176 3.83436 0.279
NP_442554.1_8 Reverse -51 -61 6.76487 0.107
NP_442554.1_8 Forward -58 -48 2.92996 0.249
NP_442554.1_8 Forward -176 -166 2.43831 0.272
NP_442075.1_3 Forward -118 -99 13.9625 0.279
NP_441762.1_7 Forward -297 -285 -3.6976 0.127
NP_441762.1_7 Forward -225 -213 -5.66422 0.228
NP_442142.1_4 Forward -33 -20 14.8666 0.0302
NP_442142.1_4 Reverse -165 -178 13.49 0.0348
NP_442142.1_4 Forward -62 -49 4.54195 0.217
NP_442143.1_3 Forward -44 -25 13.1758 0.13
NP_441264.1_3 Forward -306 -287 -3.54046 0.293
NP_443009.1_5 Forward -60 -49 13.6278 0.0301
NP_440183.1_9 Forward -184 -165 -19.2734 0.277
NP_440379.1_5 Forward -297 -278 -10.6203 0.281
NP_441468.1_1 Reverse -51 -58 4.07068 0.263
NP_441618.1_6 Forward -170 -151 8.35759 0.3
NP_441015.1_8 Forward -178 -159 -0.4922 0.293
NP_441015.1_10 Forward -176 -157 -2.26216 0.178
NP_441673.1_1 Reverse -50 -59 1.37636 0.114
NP_441673.1_1 Forward -59 -50 1.1797 0.163
NP_441673.1_1 Forward -65 -56 -8.06341 0.254
NP_441731.1_7 Forward -185 -166 16.1257 0.147
NP_441016.2_6 Forward -233 -214 10.6184 0.222
NP_441426.1_4 Reverse -70 -89 2.26107 0.29
NP_441826.1_2 Forward -65 -51 0.491246 0.184
NP_441826.1_2 Reverse -24 -38 -3.147 0.283
NP_441826.1_2 Reverse -50 -64 -3.83532 0.288
NP_442490.1_4 Reverse -61 -80 15.7018 0.287
NP_442490.1_9 Forward -344 -325 -7.37537 0.278
NP_442490.1_10 Reverse -167 -185 22.3403 0.0136
NP_441612.1_2 Forward -65 -55 11.1632 0.21
NP_442808.1_1 Forward -225 -215 5.87944 0.137
NP_442808.1_1 Reverse -310 -320 4.99446 0.178
NP_441101.1_10 Reverse -304 -323 6.58763 0.173
NP_441114.1_3 Forward -57 -48 7.37455 0.239
NP_440558.1_2 Reverse -46 -65 1.57275 0.178
NP_440558.1_2 Forward -68 -49 -0.590531 0.204
NP_440558.1_2 Reverse -47 -66 -6.78538 0.28
NP_442789.1_4 Forward -322 -303 -4.32711 0.259
NP_441878.1_6 Reverse -49 -59 2.24165 0.0462
NP_441878.1_6 Forward -66 -56 2.04498 0.0528
NP_441878.1_6 Forward -321 -311 1.74999 0.0642
NP_441878.1_6 Forward -60 -50 1.25834 0.108
NP_441878.1_6 Forward -178 -168 -0.0199663 0.163
NP_441557.1_5 Reverse -50 -59 0.491382 0.144
NP_441557.1_5 Forward -59 -50 0.29472 0.174
NP_441445.1_8 Forward -79 -60 -12.7836 0.293
NP_441590.1_4 Forward -63 -44 4.91521 0.279
NP_441590.1_4 Reverse -319 -338 1.57197 0.3
NP_442962.1_5 Reverse -150 -169 5.11266 0.242
NP_440084.1_8 Forward -99 -85 9.56081 0.282
NP_441564.1_10 Reverse -315 -334 5.211 0.239
NP_442397.1_9 Reverse -43 -62 2.16274 0.283
NP_440440.1_2 Reverse -154 -173 15.9282 0.237
NP_442135.1_3 Reverse -163 -182 5.60432 0.26
NP_441574.1_1 Forward -344 -325 -3.93378 0.246
NP_442494.1_4 Reverse -154 -173 13.7649 0.226
NP_440058.1_8 Reverse -276 -295 13.5691 0.298
NP_441549.1_9 Reverse -46 -64 -5.09406 0.198
NP_442347.1_2 Forward -190 -181 8.65285 0.0792
NP_442347.1_2 Forward -154 -145 5.70292 0.226
NP_442645.1_2 Forward -67 -48 -0.688862 0.0487
NP_442888.1_6 Forward -188 -169 6.58763 0.217
NP_442590.1_10 Reverse -24 -43 11.6025 0.158
NP_442590.1_10 Forward -183 -164 3.44104 0.293
NP_442998.1_5 Reverse -80 -90 7.55152 0.289
NP_440299.1_1 Reverse -379 -392 6.21356 0.149
NP_441799.1_1 Forward -63 -49 9.14375 0.0988
NP_441799.1_1 Reverse -46 -60 8.25877 0.12
NP_441559.1_8 Reverse -45 -59 1.47456 0.155
NP_441559.1_8 Forward -44 -30 -4.22864 0.219
NP_441559.1_8 Reverse -163 -177 -7.37523 0.291
NP_442785.1_7 Forward -61 -47 13.7659 0.228
NP_442866.1_1 Reverse -25 -44 1.27776 0.161
NP_441464.1_8 Reverse -56 -70 7.37441 0.21
NP_440695.1_5 Forward -332 -313 -1.86883 0.291
NP_442993.1_1 Reverse -50 -66 -2.79306 0.119
NP_442993.1_1 Reverse -150 -166 -13.5111 0.292
NP_442386.1_9 Reverse -49 -58 9.93072 0.144
NP_442054.1_2 Forward -307 -288 1.96607 0.153
NP_441340.1_5 Forward -58 -51 3.97235 0.274
NP_442186.1_9 Reverse -183 -202 3.83436 0.294
NP_442327.1_3 Forward -105 -86 12.0793 0.182
NP_442484.1_2 Reverse -157 -176 -1.27885 0.288
NP_440168.1_8 Forward -183 -164 2.45773 0.261
NP_440168.1_9 Forward -202 -183 1.96607 0.235
NP_442474.1_9 Forward -302 -283 8.35759 0.274
NP_442714.1_5 Forward -287 -268 1.76941 0.238
NP_441160.1_6 Reverse -344 -363 5.01433 0.19
NP_441134.1_10 Forward -188 -170 9.55725 0.278
NP_440586.1_8 Forward -319 -312 8.88855 0.205
NP_440027.1_3 Forward -306 -288 10.5398 0.173
NP_440027.1_3 Forward -40 -22 2.96833 0.282
NP_443051.1_1 Forward -60 -51 -0.0986038 0.256
NP_439937.1_8 Reverse -180 -199 -4.13045 0.278
NP_439937.1_9 Reverse -310 -327 -7.5333 0.162
NP_439937.1_9 Forward -60 -43 -9.99156 0.22
NP_440439.1_1 Forward -62 -49 -1.16069 0.255
NP_440439.1_1 Reverse -165 -178 -2.144 0.298
NP_440819.1_5 Forward -168 -160 7.98423 0.228
NP_440267.1_2 Forward -45 -31 7.57046 0.196
NP_442887.1_5 Forward -88 -69 -4.03212 0.264
NP_442384.1_10 Reverse -50 -63 5.52582 0.127
NP_442384.1_10 Reverse -30 -43 1.88757 0.243
NP_442384.1_10 Forward -320 -307 0.412608 0.291
NP_441018.1_7 Reverse -46 -65 12.3892 0.161
NP_441018.1_7 Reverse -287 -306 9.24257 0.23
NP_440530.1_5 Forward -354 -335 13.1758 0.25
NP_442790.1_4 Reverse -21 -40 -15.0452 0.284
NP_442262.1_10 Forward -58 -51 9.87221 0.164
NP_441814.1_5 Forward -346 -327 12.4875 0.175
NP_440531.1_6 Forward -185 -166 17.699 0.0353
NP_440531.1_6 Reverse -116 -135 -2.75381 0.258
NP_442917.1_3 Forward -68 -49 8.94757 0.183
NP_442910.1_6 Forward -185 -171 1.08123 0.295
NP_441965.1_10 Forward -62 -46 5.56507 0.203
NP_441965.1_10 Forward -180 -164 2.61514 0.285
NP_441965.1_10 Reverse -284 -300 2.51681 0.287
NP_440297.1_9 Reverse -51 -61 0.471689 0.282
NP_442280.1_10 Reverse -158 -176 6.62323 0.27
NP_441592.1_4 Reverse -50 -69 0.786102 0.227
NP_441592.1_4 Reverse -226 -245 -3.44213 0.281
NP_441896.1_3 Reverse -41 -60 5.11266 0.131
NP_440999.1_9 Forward -195 -181 -3.34366 0.291
NP_441771.1_4 Reverse -189 -208 -1.7705 0.292
NP_442147.1_7 Forward -329 -310 7.57094 0.298
NP_440052.1_8 Reverse -13 -32 8.25926 0.294
NP_441543.1_2 Reverse -216 -225 15.0444 0.0111
NP_441543.1_2 Forward -58 -49 6.5879 0.143
NP_441543.1_2 Forward -319 -310 4.0313 0.293
NP_442845.1_2 Forward -65 -51 8.25939 0.195
NP_442845.1_2 Reverse -50 -64 4.12949 0.267
NP_441178.1_6 Reverse -62 -81 5.50519 0.268
NP_441918.1_7 Forward -114 -95 3.34271 0.265
NP_440982.1_1 Forward -184 -165 3.34192 0.297
NP_441469.1_8 Reverse -49 -58 12.3894 0.111
NP_442315.1_1 Forward -331 -313 21.062 0.0448
NP_442315.1_2 Forward -247 -235 15.8703 0.259
NP_442315.1_5 Forward -68 -58 17.0896 0.277
NP_442315.1_8 Forward -389 -375 22.1241 0.0444
NP_443064.1_6 Forward -39 -29 9.94905 0.187
NP_440071.1_6 Forward -293 -279 14.3866 0.249
NP_441462.1_2 Reverse -50 -60 0.766681 0.125
NP_443062.1_6 Forward -328 -309 2.26107 0.258
NP_441410.1_4 Forward -68 -49 7.96345 0.297
NP_440519.1_8 Forward -335 -319 1.14018 0.294
NP_442204.1_1 Reverse -164 -175 0.0586712 0.284
NP_442204.1_6 Reverse -18 -37 8.16093 0.228
NP_440255.1_7 Forward -314 -297 7.02034 0.299
NP_440516.1_2 Reverse -44 -62 5.13236 0.132
NP_440516.1_8 Forward -224 -215 -0.295266 0.232
NP_442428.1_5 Reverse -51 -58 4.46401 0.267
NP_441443.1_1 Forward -168 -149 -1.37718 0.244
NP_441867.1_2 Forward -174 -155 -20.65 0.292
NP_440673.1_3 Reverse -313 -320 9.38056 0.192
NP_440673.1_3 Forward -57 -50 8.98723 0.203
NP_441052.1_2 Reverse -215 -225 4.50326 0.157
NP_441052.1_2 Forward -320 -310 0.963343 0.255
NP_440436.1_4 Forward -58 -49 11.9957 0.0435
NP_441004.1_1 Forward -171 -152 -16.6185 0.286
NP_441004.1_1 Forward -366 -347 -17.3068 0.29
NP_441004.1_2 Forward -176 -157 -3.3438 0.277
NP_442366.1_5 Reverse -179 -189 10.501 0.261
NP_441729.1_1 Forward -63 -44 14.6508 0.281
NP_442206.1_7 Reverse -48 -67 12.9791 0.295
NP_443054.1_2 Forward -61 -47 1.37622 0.247
NP_443054.1_2 Reverse -166 -180 0.294584 0.269
NP_441851.1_10 Forward -66 -56 12.1731 0.0552
NP_441851.1_10 Reverse -49 -59 4.79825 0.247
NP_442622.1_8 Reverse -215 -233 -19.1554 0.296
NP_442515.1_1 Forward -40 -26 -1.37704 0.253
NP_441396.1_1 Forward -245 -226 -2.16383 0.27
NP_441046.1_2 Reverse -16 -35 -1.27885 0.288
NP_442689.1_8 Reverse -76 -93 -1.53445 0.216
NP_441349.1_10 Forward -69 -50 -5.01543 0.189
NP_441661.1_3 Reverse -47 -64 -5.36936 0.28
NP_439960.1_6 Reverse -162 -181 16.9124 0.107
NP_439960.1_10 Reverse -278 -296 4.9357 0.161
NP_440474.1_8 Reverse -51 -65 11.5037 0.107
NP_440396.1_10 Forward -38 -22 12.9392 0.153
NP_441477.1_5 Forward -78 -59 11.0125 0.268
NP_440431.1_3 Forward -229 -210 -9.34199 0.244
NP_440588.1_2 Forward -68 -49 7.7676 0.048
NP_442006.1_2 Forward -288 -271 -7.33598 0.171
NP_442006.1_2 Reverse -168 -185 -15.7924 0.228
NP_442006.1_2 Forward -74 -57 -16.8741 0.265
NP_441570.1_1 Reverse -30 -48 -10.5023 0.171
NP_440078.1_4 Reverse -274 -293 9.93088 0.27
NP_440078.1_4 Forward -349 -330 9.93088 0.27
NP_441078.1_4 Reverse -50 -59 8.1612 0.039
NP_441078.1_4 Forward -59 -50 0.983037 0.151
NP_441078.1_4 Reverse -215 -224 -1.47524 0.266
NP_441078.1_4 Reverse -56 -65 -1.77023 0.266
NP_441078.1_4 Forward -65 -56 -1.77023 0.266
NP_441078.1_4 Forward -320 -311 -1.86856 0.272
NP_442443.1_1 Forward -173 -154 -5.70374 0.284
NP_441432.1_8 Forward -40 -31 11.9961 0.0519
NP_441432.1_8 Reverse -49 -58 6.48957 0.114
NP_442320.1_8 Reverse -209 -223 -5.9986 0.261
NP_441732.1_2 Forward -43 -27 2.02515 0.0253
NP_441732.1_2 Forward -63 -47 -16.5594 0.174
NP_440629.1_8 Reverse -289 -307 20.6687 0.072
NP_440131.1_4 Forward -81 -62 10.9142 0.243
NP_439900.1_4 Reverse -151 -165 17.7968 0.155
NP_442353.1_4 Reverse -285 -304 -0.492971 0.29
NP_440713.1_4 Reverse -65 -84 2.26107 0.266
NP_442489.1_7 Reverse -50 -59 8.1612 0.0294
NP_442489.1_7 Forward -59 -50 7.76787 0.0518
NP_442489.1_7 Forward -65 -56 -1.27858 0.185
NP_442489.1_7 Forward -320 -311 -1.57357 0.213
NP_442489.1_7 Forward -224 -215 -1.6719 0.235
NP_442489.1_7 Reverse -30 -39 -1.6719 0.235
NP_442079.1_7 Forward -223 -204 2.26107 0.232
NP_441659.2_8 Reverse -50 -60 1.74999 0.227
NP_441659.2_8 Forward -59 -49 0.0783647 0.277
NP_442913.1_10 Forward -74 -55 -4.22878 0.23
NP_441040.1_2 Reverse -283 -302 -6.09707 0.181
NP_442849.1_1 Forward -363 -349 7.9644 0.282
NP_439956.1_7 Forward -70 -51 0.687771 0.298
NP_441800.1_3 Forward -176 -158 3.65739 0.292
NP_442346.1_5 Forward -60 -50 5.97822 0.219
NP_442346.1_5 Reverse -49 -59 5.48657 0.243
NP_442346.1_5 Forward -321 -311 4.69992 0.276
NP_442346.1_10 Reverse -54 -73 -2.85214 0.294
NP_440545.1_3 Forward -63 -46 -3.8944 0.214
NP_440545.1_3 Reverse -178 -195 -6.35267 0.276
NP_440025.1_4 Forward -202 -183 9.63589 0.295
NP_440831.1_3 Forward -174 -155 5.41637 0.28
NP_441629.1_1 Reverse -42 -61 6.29264 0.258
NP_441629.1_3 Reverse -319 -338 4.12856 0.218
NP_440250.1_4 Reverse -73 -92 4.91521 0.253
NP_441653.1_2 Forward -235 -216 2.37001 0.294
NP_440010.1_10 Forward -77 -58 1.47442 0.299
NP_442551.1_4 Forward -61 -46 -0.708419 0.245
NP_442311.1_5 Forward -77 -58 0.786102 0.27
NP_441585.1_5 Forward -46 -27 0.883656 0.291
NP_441888.1_7 Reverse -163 -177 2.06454 0.229
NP_442162.1_4 Forward -180 -161 15.4374 0.261
NP_441915.1_4 Reverse -283 -302 6.09517 0.293
NP_442140.1_3 Forward -295 -285 6.66654 0.159
NP_441609.1_1 Forward -101 -82 -0.688862 0.242
NP_440875.1_9 Reverse -170 -180 8.85871 0.233
NP_441813.1_5 Forward -226 -216 0.0783647 0.222
NP_441227.1_4 Reverse -29 -48 21.0423 0.0456
NP_440567.1_4 Reverse -38 -57 1.96607 0.261
NP_441239.1_9 Forward -179 -167 16.1653 0.0175
NP_441239.1_9 Reverse -48 -60 9.97041 0.0912
NP_441239.1_9 Reverse -63 -75 8.59377 0.128
NP_441239.1_9 Forward -61 -49 6.23383 0.197
NP_441239.1_9 Reverse -166 -178 3.2839 0.289
NP_441951.1_6 Forward -297 -278 10.4225 0.253
NP_441951.1_9 Forward -185 -166 2.94938 0.254
NP_442044.1_1 Reverse -177 -196 -13.5702 0.277
NP_442044.1_1 Forward -44 -25 -13.6686 0.277
NP_442193.1_8 Reverse -121 -140 14.1583 0.211
NP_443035.1_10 Forward -184 -167 8.39697 0.273
NP_440212.1_5 Reverse -276 -295 18.6823 0.127
NP_440354.1_7 Forward -65 -47 9.45892 0.224
NP_442138.1_1 Reverse -48 -67 10.7167 0.208
NP_440546.1_4 Forward -74 -64 8.20381 0.199
NP_440546.1_4 Forward -296 -286 6.55553 0.291
NP_440868.1_4 Forward -228 -216 6.03717 0.0879
NP_440868.1_4 Reverse -46 -58 0.825626 0.199
NP_442499.1_3 Forward -201 -183 4.44404 0.289
NP_441084.1_6 Forward -369 -355 14.4828 0.0972
NP_441084.1_6 Forward -61 -47 12.5437 0.16
NP_440653.1_10 Forward -170 -151 7.37428 0.203
NP_440696.1_3 Forward -69 -51 0.904127 0.225
NP_440696.1_6 Forward -332 -313 3.34271 0.288
NP_440843.1_8 Forward -351 -332 13.4708 0.297
NP_442039.1_4 Reverse -125 -132 8.39725 0.202
NP_442039.1_7 Forward -294 -284 15.2213 0.211
NP_441811.1_1 Reverse -56 -75 5.89931 0.28
NP_441926.1_3 Reverse -50 -66 12.2516 0.0929
NP_442837.1_3 Forward -190 -183 6.52896 0.2
NP_440160.1_2 Forward -65 -46 -8.65367 0.286
NP_442053.1_1 Forward -224 -215 5.80125 0.164
NP_440505.1_3 Forward -308 -298 4.99491 0.252
NP_440505.1_3 Forward -226 -216 4.60159 0.277
NP_440505.1_7 Reverse -37 -56 -0.787193 0.271
NP_440914.1_1 Reverse -50 -60 13.2019 0.0378
NP_440914.1_1 Forward -65 -55 9.10306 0.186
NP_442533.1_1 Forward -323 -304 -8.16202 0.202
NP_442533.1_1 Reverse -15 -34 -15.5368 0.256
NP_442533.1_1 Reverse -24 -43 -15.8318 0.257
NP_442533.1_6 Reverse -168 -177 11.7994 0.0386
NP_442533.1_6 Forward -59 -50 8.25953 0.0776
NP_442533.1_6 Reverse -50 -59 7.66954 0.0897
NP_442533.1_6 Reverse -56 -65 7.47288 0.0898
NP_442533.1_6 Reverse -233 -242 4.52295 0.179
NP_442533.1_6 Forward -320 -311 3.93297 0.197
NP_442232.1_3 Forward -67 -48 -7.27704 0.198
NP_442322.1_3 Reverse -197 -211 18.5841 0.282
NP_442322.1_4 Forward -185 -168 -9.40158 0.295
NP_441482.1_7 Forward -45 -31 -3.73699 0.138
NP_439944.1_9 Reverse -51 -61 5.68323 0.231
NP_441028.1_6 Reverse -355 -365 12.6642 0.183
NP_441028.1_6 Reverse -159 -169 10.6976 0.197
NP_441527.1_4 Reverse -185 -204 -7.87851 0.239
NP_440007.1_9 Forward -62 -48 5.01447 0.266
NP_441106.1_1 Reverse -49 -58 5.3096 0.162
NP_441106.1_1 Reverse -167 -176 2.458 0.283
NP_440429.1_2 Reverse -163 -182 10.6192 0.267
NP_441815.1_6 Reverse -157 -176 11.5033 0.118
NP_442588.1_6 Reverse -164 -183 -2.95047 0.296
NP_442306.1_10 Reverse -45 -64 -21.9284 0.296
NP_440670.1_8 Forward -59 -50 5.3096 0.167
NP_441930.1_2 Reverse -49 -59 12.2714 0.262
NP_440886.1_7 Reverse -49 -59 5.48612 0.181
NP_442614.1_2 Forward -290 -276 10.3243 0.234
NP_442022.1_4 Reverse -18 -37 5.211 0.293
NP_442264.1_2 Reverse -26 -43 6.92201 0.25
NP_442264.1_2 Reverse -40 -57 4.85706 0.292
NP_441463.1_3 Reverse -205 -224 -8.65367 0.272
NP_441463.1_3 Forward -69 -50 -8.94866 0.276
NP_441463.1_6 Forward -308 -294 14.2433 0.165
NP_441463.1_6 Forward -61 -47 6.80246 0.267
NP_442365.1_7 Reverse -46 -65 -5.99873 0.284
NP_441589.1_5 Forward -178 -159 15.3999 0.267
NP_440387.1_1 Reverse -50 -66 6.25339 0.0282
NP_440387.1_1 Reverse -30 -46 -6.33298 0.279
NP_441431.1_2 Forward -299 -285 5.70218 0.291
NP_441174.1_2 Forward -62 -48 15.3392 0.119
NP_441174.1_2 Reverse -165 -179 11.5043 0.296
NP_441174.1_3 Forward -185 -166 14.1591 0.297
NP_440114.1_10 Reverse -50 -64 15.1426 0.0294
NP_441817.1_3 Reverse -10 -29 10.0292 0.277
NP_442698.1_10 Forward -324 -305 -0.295539 0.297
NP_441206.1_4 Reverse -145 -164 6.58763 0.079
NP_440492.1_9 Reverse -81 -95 12.1951 0.294
NP_441156.1_5 Forward -163 -153 15.6819 0.251
NP_442743.1_5 Forward -64 -45 13.3725 0.125
NP_440643.1_2 Forward -290 -271 3.44104 0.278
NP_442867.1_8 Reverse -58 -77 9.93088 0.214
NP_442867.1_8 Reverse -160 -179 7.86593 0.242
NP_442680.1_5 Reverse -77 -96 3.00294 0.237
NP_442680.1_5 Reverse -180 -199 -0.904675 0.297
NP_441332.1_3 Reverse -149 -168 10.8159 0.173
NP_440660.1_6 Reverse -54 -73 15.1424 0.241
NP_442439.1_8 Forward -178 -159 10.5209 0.246
NP_442341.1_7 Reverse -310 -324 4.62115 0.185
NP_441756.1_5 Reverse -166 -185 -4.32711 0.294
NP_441173.1_9 Forward -87 -79 12.1137 0.21
NP_441173.1_9 Reverse -160 -168 9.75379 0.284
NP_443000.1_7 Forward -41 -31 2.33998 0.226
NP_442451.1_2 Reverse -48 -67 -7.4737 0.236
NP_439962.1_4 Forward -185 -166 -2.95047 0.242
NP_440175.1_4 Forward -67 -48 -10.0303 0.171
NP_440175.1_7 Forward -336 -318 10.1438 0.267
NP_442495.1_5 Forward -299 -280 5.50599 0.291
NP_442591.1_8 Reverse -57 -76 20.1573 0.152
NP_441105.1_3 Forward -70 -51 -1.7705 0.151
NP_441105.1_3 Reverse -157 -176 -8.65367 0.275
NP_440216.1_1 Reverse -50 -64 -11.8985 0.228
NP_440172.1_1 Reverse -50 -60 11.5831 0.0368
NP_440172.1_6 Reverse -9 -28 6.09597 0.278
NP_441350.1_9 Forward -295 -276 23.008 0.0275
NP_442015.1_10 Forward -69 -56 3.95252 0.178
NP_441226.1_4 Reverse -280 -299 12.8808 0.205
NP_441766.1_9 Forward -295 -276 -1.96717 0.276
NP_440416.1_9 Reverse -49 -68 -18.0934 0.251
NP_440416.1_9 Reverse -277 -296 -19.5684 0.276
NP_440416.1_9 Reverse -64 -83 -20.7484 0.288
NP_443052.1_9 Forward -31 -12 -4.91709 0.262
NP_442154.1_1 Forward -73 -55 -18.3687 0.281
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGGCCACTAAAGATGGTCAGACTATTCCATTCAAACTAGGGGTAAAGAAGGAGTTGGGTTTTGTCTGCGGTGATTTTGTGGGCGATGAACGTAAGGGAATTCTCACCGCTGGCGGCAAGGCAGACTTGGAAGCCACCTTTCATTTAGATCATTTATTTGGGGACGGACAAGAACCCGTCGATAGCGACATTAACCTTAGTGCTTTTGGCTTTGATCCCCTAGCAGCCCTGGCCGGGGAAAAGGGCATTGATCTCAATAGTCAGGACTTGCAAGCTCGATTAGGGGCGGCAGATTATCAAACCTTTTTACAAGTTTTAGCCAACCTTGGCCATGTGGGGGAAGGCCATTGCCGACAAACCAAGGCATTCACCACCATCACTTCCTTCAACCTGTAAATCCG

CDS

ATGAAATTTAACCTAGCTCTATTTTGTTTAGCGGGAGGCATACTTACCCAGACGGTCTCCGTCCTTGCCCACGGAGTTAAAGTGGAACATCATTCGGTGGCGGCGATCGCCGTGGCGGCCCATTATGACTCCGGGCAACCCATGGCCGAAGCCCAAGTATTAGTCTATGCCCCGAATAATTCCACTGAACCTTGGTTAACGGGGGTTACTGACAAAGAGGGCAAATTTATTTTTACTCCAGCAGGCGATCGCCCTGGCAATTGGGAAGTGGCAGTGCGGCAAGGGGGCCACGGAAATATGATCACCATACCTTGGCAACCAGAAACAACAGCGGTTGATAGCACCGATACAGCCAATGCCCTTACTTCTAGTGTCAACCAAGGCACTCCAGAAATTACCGTAGCCTCTGTACCGGATGCCAATGCTGCCCTATCTCCCATTCAACGGGGTATCACTTTAGGGGCCGTAATTTGGGGTTTTGTGGGTACTGCCCTATTTTTCAGCAGAAGCAAAGGTGAGGGCAGGGCCTAG

Protein

MKFNLALFCLAGGILTQTVSVLAHGVKVEHHSVAAIAVAAHYDSGQPMAEAQVLVYAPNNSTEPWLTGVTDKEGKFIFTPAGDRPGNWEVAVRQGGHGNMITIPWQPETTAVDSTDTANALTSSVNQGTPEITVASVPDANAALSPIQRGITLGAVIWGFVGTALFFSRSKGEGRA