Your browser is old and dusty. Try Google Chrome!

Details for sll0380

ORF sll0380
Accession NP_442320.1
Symbol
Category Surface polysaccharides, lipopolysaccharides and antigens
Definition probable glycosyltransferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Reverse -30 -49 -22.5183 0.179
NP_441418.1_6 Reverse -101 -120 -23.01 0.19
NP_440897.1_6 Reverse -136 -155 5.2102 0.123
NP_441453.1_4 Reverse -101 -109 14.7691 0.0119
NP_441453.1_4 Forward -110 -102 6.80426 0.121
NP_442151.1_1 Reverse -27 -46 4.12936 0.287
NP_441818.1_1 Reverse -102 -113 10.5796 0.232
NP_441818.1_9 Reverse -355 -374 -8.94866 0.285
NP_440150.1_6 Reverse -87 -106 2.85105 0.265
NP_442744.1_8 Forward -310 -291 -6.88371 0.297
NP_442173.1_1 Forward -109 -101 12.0158 0.0316
NP_442173.1_1 Reverse -102 -110 12.0158 0.0316
NP_001035873.1_1 Forward -272 -253 14.6137 0.295
NP_442752.1_4 Forward -110 -103 13.8055 0.0199
NP_442752.1_4 Reverse -22 -29 12.1338 0.0546
NP_440784.1_7 Forward -109 -102 6.23397 0.241
NP_440784.1_7 Reverse -102 -109 6.13563 0.241
NP_442909.1_7 Reverse -102 -116 7.3738 0.219
NP_442289.1_4 Forward -107 -91 11.3666 0.251
NP_440061.1_9 Forward -101 -87 7.76712 0.194
NP_441054.1_2 Forward -349 -330 10.9142 0.277
NP_441054.1_6 Forward -318 -299 17.109 0.246
NP_442062.1_8 Forward -110 -100 8.23984 0.0793
NP_442062.1_8 Reverse -101 -111 7.84651 0.0871
NP_440304.1_4 Forward -112 -102 9.22315 0.06
NP_440304.1_4 Forward -43 -33 4.60159 0.258
NP_442762.1_10 Forward -321 -302 -9.34199 0.227
NP_441925.1_4 Forward -41 -22 -7.57277 0.196
NP_441925.1_4 Reverse -297 -316 -12.4893 0.254
NP_441925.1_4 Forward -38 -19 -13.1776 0.257
NP_440856.1_4 Reverse -94 -113 -1.18052 0.193
NP_441083.1_5 Reverse -101 -111 18.0729 0.00245
NP_441083.1_5 Forward -110 -100 16.7946 0.00546
NP_441434.1_7 Reverse -103 -117 2.5562 0.28
NP_441738.1_2 Reverse -103 -110 15.28 0.0102
NP_440209.1_1 Forward -110 -102 8.57422 0.0425
NP_440209.1_1 Reverse -101 -109 8.47588 0.0457
NP_440178.1_7 Forward -111 -92 -20.0601 0.184
NP_442570.1_3 Forward -324 -305 -8.45701 0.286
NP_442111.1_4 Forward -111 -97 6.88276 0.11
NP_442111.1_4 Reverse -100 -114 6.48943 0.123
NP_441624.1_6 Forward -143 -124 12.1917 0.295
NP_441163.1_1 Forward -39 -22 7.80625 0.236
NP_441163.1_1 Forward -46 -29 7.60959 0.241
NP_440906.1_5 Forward -109 -102 6.23397 0.234
NP_440906.1_5 Reverse -102 -109 6.13563 0.241
NP_440747.1_10 Reverse -98 -110 -2.4193 0.0434
NP_440747.1_10 Forward -113 -101 -11.7607 0.142
NP_441130.1_10 Forward -112 -98 9.14437 0.128
NP_441486.1_1 Reverse -98 -112 -5.9986 0.272
NP_441880.2_10 Forward -109 -91 8.7706 0.269
NP_440944.1_2 Forward -122 -103 -1.18052 0.259
NP_442634.1_4 Reverse -99 -113 -4.03198 0.179
NP_440403.1_4 Forward -119 -100 -9.83364 0.287
NP_440403.1_10 Forward -102 -83 6.68596 0.212
NP_441014.1_8 Forward -140 -121 -8.752 0.288
NP_443018.1_3 Reverse -102 -109 11.7405 0.0655
NP_443018.1_3 Forward -109 -102 5.44732 0.193
NP_440376.1_1 Forward -110 -101 15.7327 0.00625
NP_440376.1_1 Reverse -101 -110 9.63616 0.0385
NP_440376.1_1 Forward -41 -32 0.491382 0.273
NP_440376.1_1 Reverse -90 -99 0.196389 0.283
NP_440376.1_1 Reverse -22 -31 0.196389 0.283
NP_442687.1_7 Forward -111 -101 16.303 0.0125
NP_442687.1_7 Reverse -100 -110 8.73149 0.101
NP_441013.1_2 Forward -32 -14 -4.79907 0.299
NP_440360.1_10 Reverse -297 -311 4.91614 0.227
NP_442658.1_1 Reverse -99 -109 6.37109 0.231
NP_442658.1_1 Forward -112 -102 5.09279 0.284
NP_442782.1_2 Forward -316 -302 2.94952 0.269
NP_442496.1_5 Forward -118 -100 6.31233 0.283
NP_441487.1_9 Forward -111 -92 9.14423 0.0988
NP_441256.1_1 Reverse -304 -323 0.786102 0.169
NP_439959.1_6 Forward -315 -296 12.6841 0.146
NP_441958.1_5 Forward -111 -101 18.2696 0.00183
NP_441958.1_5 Reverse -100 -110 10.6981 0.0112
NP_441127.1_1 Forward -41 -27 9.83269 0.267
NP_439905.1_1 Forward -30 -17 9.2624 0.221
NP_440984.1_7 Forward -104 -90 5.70279 0.245
NP_442690.1_1 Forward -74 -55 -16.5201 0.289
NP_442911.1_2 Forward -120 -101 2.65439 0.0491
NP_442911.1_2 Reverse -91 -110 -5.60541 0.163
NP_441591.1_10 Reverse -20 -39 5.01433 0.297
NP_442064.1_4 Reverse -297 -316 6.29183 0.254
NP_439975.1_2 Reverse -132 -150 8.08229 0.215
NP_441099.1_5 Reverse -91 -110 -8.752 0.203
NP_442002.1_9 Forward -111 -104 14.1004 0.074
NP_442598.1_2 Reverse -10 -19 14.2577 0.252
NP_441294.1_7 Reverse -97 -111 14.914 0.033
NP_442438.1_10 Reverse -178 -192 -0.492064 0.264
NP_442885.1_5 Reverse -103 -122 15.2399 0.236
NP_440377.1_1 Forward -349 -332 11.6602 0.271
NP_441000.1_6 Forward -111 -97 4.12949 0.0992
NP_441000.1_6 Forward -32 -18 -5.11362 0.261
NP_440147.1_4 Forward -112 -99 10.1474 0.0355
NP_440147.1_4 Reverse -99 -112 1.00259 0.242
NP_441550.1_8 Reverse -99 -109 17.1874 0.00906
NP_441550.1_8 Forward -112 -102 14.1392 0.0182
NP_441916.1_7 Reverse -101 -111 7.25653 0.0718
NP_441916.1_7 Forward -110 -100 7.15819 0.0745
NP_441916.1_7 Forward -106 -96 3.42162 0.216
NP_440465.1_10 Reverse -292 -311 2.3594 0.268
NP_440465.1_10 Forward -34 -15 -1.57384 0.295
NP_442004.1_6 Forward -110 -96 2.75286 0.257
NP_440703.1_9 Forward -47 -34 10.4418 0.2
NP_440703.1_9 Reverse -308 -321 5.0336 0.293
NP_441725.1_5 Reverse -102 -112 11.1898 0.0247
NP_441725.1_5 Forward -109 -99 2.04498 0.115
NP_441725.1_5 Reverse -33 -43 -0.806614 0.271
NP_439966.1_7 Forward -101 -91 10.796 0.0811
NP_439966.1_7 Reverse -99 -109 7.64939 0.15
NP_440736.1_3 Reverse -185 -204 -1.57384 0.291
NP_442941.1_3 Reverse -102 -112 1.55333 0.15
NP_442941.1_3 Forward -109 -99 0.963343 0.16
NP_440289.1_2 Forward -113 -100 6.21414 0.0605
NP_440289.1_2 Reverse -98 -111 5.52582 0.0634
NP_440289.1_2 Forward -44 -31 -4.60227 0.29
NP_440983.1_5 Reverse -301 -320 6.98095 0.168
NP_440983.1_5 Forward -99 -80 -6.39206 0.276
NP_440983.1_9 Reverse -120 -139 1.57275 0.292
NP_442281.1_1 Reverse -309 -323 2.65393 0.26
NP_442281.1_1 Forward -115 -101 2.06395 0.278
NP_441058.2_8 Reverse -115 -134 -1.18052 0.3
NP_440723.1_4 Reverse -87 -106 -4.03212 0.272
NP_441644.1_6 Reverse -101 -111 15.4175 0.00595
NP_441644.1_6 Reverse -32 -42 8.3377 0.103
NP_441644.1_6 Forward -110 -100 6.0761 0.167
NP_443049.1_6 Reverse -21 -31 11.4458 0.257
NP_442215.1_2 Forward -325 -309 -3.77637 0.222
NP_442029.1_1 Forward -318 -299 -11.6036 0.229
NP_442029.1_6 Reverse -85 -104 15.0441 0.0999
NP_442029.1_6 Forward -321 -302 7.86593 0.219
NP_442247.1_8 Reverse -99 -113 11.5043 0.247
NP_440253.1_2 Reverse -101 -119 -2.43913 0.268
NP_440929.1_8 Reverse -101 -110 16.5193 0.00413
NP_440929.1_8 Forward -110 -101 9.53783 0.0296
NP_442933.1_10 Reverse -101 -110 8.06287 0.0885
NP_442933.1_10 Forward -110 -101 7.96454 0.0937
NP_441751.2_8 Reverse -102 -116 -4.7203 0.179
NP_441751.2_8 Forward -109 -95 -5.40861 0.206
NP_442554.1_8 Forward -109 -99 12.7631 0.0225
NP_442554.1_8 Reverse -102 -112 4.99491 0.163
NP_442554.1_8 Reverse -308 -318 3.42162 0.226
NP_442142.1_4 Reverse -304 -317 16.6366 0.0264
NP_442292.1_1 Forward -109 -100 -0.196935 0.239
NP_442292.1_1 Reverse -102 -111 -0.295266 0.24
NP_441525.1_1 Reverse -97 -110 15.3589 0.21
NP_442476.1_6 Forward -109 -95 8.65272 0.0982
NP_442476.1_6 Reverse -91 -105 0.88457 0.238
NP_443009.1_5 Reverse -100 -111 8.4163 0.109
NP_443009.1_5 Forward -111 -100 8.31797 0.112
NP_442301.1_2 Forward -46 -27 3.63691 0.292
NP_442408.2_1 Reverse -101 -120 -2.16383 0.241
NP_440015.1_9 Forward -226 -208 -1.84914 0.296
NP_441448.1_1 Reverse -322 -341 8.94757 0.198
NP_440183.1_9 Forward -46 -27 -21.1417 0.296
NP_441468.1_1 Forward -109 -102 6.13563 0.209
NP_441468.1_1 Reverse -102 -109 6.0373 0.223
NP_441015.1_10 Forward -315 -296 1.27776 0.16
NP_441015.1_10 Reverse -85 -104 -5.70374 0.23
NP_441015.1_10 Forward -321 -302 -7.08038 0.262
NP_441673.1_1 Forward -110 -101 11.1111 0.0121
NP_441673.1_1 Reverse -101 -110 11.0128 0.018
NP_441016.2_6 Reverse -298 -317 15.3382 0.166
NP_441426.1_6 Forward -325 -306 19.469 0.0727
NP_441826.1_2 Forward -37 -23 -1.96703 0.261
NP_441826.1_2 Reverse -39 -53 -4.4253 0.296
NP_442811.1_2 Forward -318 -299 11.6025 0.113
NP_442490.1_9 Forward -122 -103 -0.39387 0.179
NP_442868.1_6 Reverse -99 -109 8.73149 0.0555
NP_443058.1_1 Forward -152 -133 11.6017 0.287
NP_442427.1_8 Forward -119 -100 14.6508 0.11
NP_442808.1_1 Reverse -100 -110 9.321 0.0481
NP_442808.1_1 Reverse -306 -316 5.78111 0.141
NP_442808.1_1 Forward -32 -22 4.60114 0.195
NP_442808.1_1 Forward -100 -90 4.10949 0.207
NP_440031.1_10 Reverse -118 -137 0.687771 0.274
NP_441315.1_1 Reverse -90 -108 17.8171 0.279
NP_442542.1_2 Reverse -99 -112 15.7522 0.0793
NP_442542.1_2 Forward -112 -99 9.85238 0.131
NP_442542.1_2 Reverse -30 -43 6.80412 0.205
NP_442050.1_5 Reverse -99 -109 11.4843 0.0959
NP_442342.1_9 Reverse -30 -46 6.54838 0.218
NP_440558.1_2 Reverse -291 -310 -4.81876 0.249
NP_441878.1_6 Forward -111 -101 10.5014 0.0176
NP_441878.1_6 Reverse -100 -110 10.4031 0.0176
NP_441878.1_6 Forward -42 -32 -7.78811 0.266
NP_441036.1_8 Forward -46 -36 8.1415 0.176
NP_441036.1_8 Forward -111 -101 7.15819 0.208
NP_441557.1_5 Forward -110 -101 10.2261 0.0144
NP_441557.1_5 Reverse -101 -110 10.1278 0.0188
NP_441557.1_8 Forward -30 -20 15.7125 0.18
NP_441445.1_1 Reverse -92 -111 4.52268 0.193
NP_441590.1_4 Forward -99 -80 7.96345 0.249
NP_441433.1_8 Forward -31 -12 -1.37718 0.258
NP_442830.1_1 Forward -311 -292 12.8808 0.28
NP_442830.1_5 Reverse -306 -320 -1.86927 0.3
NP_442183.1_1 Reverse -101 -115 12.291 0.0616
NP_442183.1_9 Reverse -133 -143 9.81313 0.296
NP_442397.1_9 Reverse -101 -120 11.9958 0.23
NP_441549.1_9 Forward -114 -96 -0.472507 0.143
NP_441549.1_9 Reverse -97 -115 -7.65067 0.209
NP_441549.1_9 Reverse -18 -36 -10.6989 0.285
NP_442347.1_2 Forward -380 -371 3.7363 0.284
NP_442645.1_2 Reverse -93 -112 -11.7019 0.144
NP_442965.1_2 Forward -127 -108 -5.01543 0.255
NP_442594.1_8 Reverse -89 -108 11.0125 0.173
NP_441633.1_3 Reverse -99 -112 -4.20895 0.185
NP_440136.1_2 Forward -109 -102 6.23397 0.171
NP_440136.1_2 Reverse -102 -109 6.13563 0.193
NP_442590.1_9 Forward -323 -304 7.66927 0.25
NP_442590.1_10 Forward -106 -87 8.84924 0.204
NP_442998.1_5 Reverse -329 -339 13.2547 0.158
NP_442998.1_10 Reverse -103 -110 15.5754 0.0102
NP_442998.1_10 Forward -108 -101 5.84064 0.235
NP_440299.1_1 Forward -272 -259 3.7553 0.232
NP_441799.1_1 Reverse -97 -111 6.88214 0.158
NP_441007.1_10 Forward -115 -102 -0.767364 0.293
NP_440087.1_1 Reverse -92 -111 2.0644 0.167
NP_441270.1_5 Reverse -12 -31 14.0678 0.211
NP_440915.1_6 Forward -114 -100 3.53951 0.101
NP_440915.1_6 Forward -45 -31 2.35953 0.119
NP_440915.1_6 Reverse -97 -111 -0.0987402 0.182
NP_440915.1_6 Forward -216 -202 -1.47537 0.236
NP_440915.1_6 Reverse -86 -100 -1.47537 0.236
NP_440915.1_6 Reverse -18 -32 -2.16369 0.26
NP_441179.1_9 Reverse -305 -315 17.2858 0.212
NP_442785.1_7 Forward -112 -98 17.7975 0.0996
NP_441464.1_8 Forward -110 -96 7.57108 0.206
NP_440702.1_2 Forward -257 -238 -4.42544 0.257
NP_441838.1_10 Forward -47 -28 14.0608 0.259
NP_442386.1_9 Forward -100 -91 7.66912 0.219
NP_442386.1_9 Reverse -306 -315 4.52254 0.297
NP_441340.1_5 Forward -109 -102 13.5105 0.0314
NP_441340.1_5 Reverse -102 -109 5.84064 0.208
NP_442484.1_2 Reverse -34 -53 3.83436 0.197
NP_440168.1_9 Reverse -21 -40 -5.99873 0.296
NP_440586.1_1 Forward -200 -181 -4.72043 0.278
NP_440586.1_8 Reverse -102 -109 9.47853 0.146
NP_440586.1_8 Forward -315 -308 5.8403 0.283
NP_440586.1_8 Forward -109 -102 5.74197 0.283
NP_441262.1_3 Forward -110 -103 14.7888 0.0223
NP_440027.1_3 Forward -48 -30 11.5231 0.159
NP_440027.1_3 Forward -110 -92 3.16499 0.278
NP_440027.1_3 Forward -109 -91 3.06666 0.28
NP_440027.1_3 Forward -41 -23 2.47668 0.289
NP_440027.1_8 Forward -137 -118 4.71854 0.287
NP_443051.1_1 Forward -111 -102 15.1427 0.00754
NP_443051.1_1 Reverse -100 -109 8.25953 0.0414
NP_439937.1_8 Forward -53 -34 -0.590531 0.241
NP_439937.1_9 Forward -32 -15 -1.24015 0.122
NP_439937.1_9 Forward -111 -94 -5.56669 0.157
NP_440439.1_1 Reverse -98 -111 11.229 0.0339
NP_440439.1_1 Reverse -19 -32 2.47756 0.133
NP_440439.1_1 Forward -113 -100 -0.177378 0.209
NP_440372.1_2 Forward -109 -102 13.8055 0.0214
NP_440372.1_2 Reverse -102 -109 6.52896 0.188
NP_441138.1_5 Forward -166 -153 4.26342 0.297
NP_440819.1_5 Forward -22 -14 7.59091 0.272
NP_440316.1_10 Forward -42 -32 7.74818 0.246
NP_440139.1_1 Reverse -95 -114 11.7 0.0797
NP_441572.1_7 Reverse -301 -320 2.16274 0.137
NP_441572.1_7 Reverse -84 -103 -1.57384 0.188
NP_441572.1_7 Forward -116 -97 -2.26216 0.193
NP_442887.1_5 Reverse -299 -318 -11.1119 0.264
NP_442384.1_10 Reverse -101 -114 13.294 0.0211
NP_442384.1_10 Forward -110 -97 12.3107 0.0292
NP_442114.1_8 Reverse -151 -165 6.48882 0.235
NP_442790.1_4 Forward -119 -100 -6.29373 0.144
NP_442262.1_10 Reverse -102 -109 13.2155 0.0213
NP_441689.1_5 Forward -112 -102 6.0761 0.197
NP_441060.1_4 Forward -27 -9 3.3624 0.252
NP_441965.1_3 Reverse -91 -110 2.55606 0.203
NP_441965.1_10 Forward -34 -18 4.18844 0.247
NP_442126.1_1 Forward -312 -293 33.137 0.0000263
NP_442126.1_2 Forward -342 -323 31.957 0.0000933
NP_442126.1_3 Forward -39 -20 26.8429 0.00222
NP_442126.1_4 Forward -291 -272 28.6138 0.000714
NP_442126.1_5 Forward -258 -239 29.1054 0.000227
NP_442126.1_6 Forward -165 -146 22.713 0.0623
NP_442126.1_7 Forward -228 -209 23.1072 0.058
NP_440297.1_9 Reverse -102 -112 9.22315 0.0917
NP_440297.1_9 Reverse -33 -43 0.0783647 0.282
NP_440297.1_9 Forward -109 -99 -0.118297 0.282
NP_441896.1_3 Forward -119 -100 0.884433 0.224
NP_440894.1_7 Forward -339 -320 15.7316 0.132
NP_440894.1_10 Reverse -27 -46 2.3594 0.29
NP_441894.1_1 Forward -26 -7 -6.39206 0.296
NP_440999.1_9 Reverse -303 -317 -1.77037 0.249
NP_440888.1_2 Forward -99 -85 8.3571 0.163
NP_440888.1_2 Forward -31 -17 7.47213 0.194
NP_442033.1_10 Reverse -30 -49 -7.08038 0.186
NP_440575.1_1 Forward -158 -139 -1.57461 0.29
NP_441543.1_3 Reverse -179 -193 15.7319 0.163
NP_442845.1_2 Reverse -84 -98 14.7492 0.0774
NP_442845.1_2 Forward -322 -308 4.12949 0.267
NP_442845.1_2 Reverse -22 -36 4.12949 0.267
NP_442845.1_4 Forward -101 -82 5.80098 0.268
NP_441551.1_5 Reverse -97 -113 7.92432 0.241
NP_441551.1_5 Reverse -28 -44 6.64602 0.262
NP_441178.1_6 Reverse -304 -323 10.52 0.226
NP_443064.1_6 Forward -110 -100 12.6639 0.0796
NP_443064.1_6 Reverse -101 -111 11.6943 0.124
NP_442337.1_8 Reverse -12 -31 -1.86883 0.292
NP_442578.1_7 Forward -109 -102 6.0373 0.18
NP_441462.1_2 Forward -110 -100 18.3679 0.0036
NP_441462.1_2 Reverse -101 -111 10.3048 0.0123
NP_441462.1_2 Forward -41 -31 4.89658 0.0783
NP_441462.1_2 Reverse -97 -107 -1.10161 0.281
NP_441410.1_3 Forward -119 -100 4.12936 0.288
NP_441560.1_3 Forward -47 -29 4.9357 0.298
NP_440516.1_8 Forward -110 -101 16.9127 0.00442
NP_440516.1_8 Reverse -101 -110 14.8477 0.00685
NP_440516.1_8 Forward -41 -32 -0.295266 0.232
NP_440516.1_8 Reverse -22 -31 -0.491928 0.262
NP_442428.1_5 Forward -109 -102 6.13563 0.209
NP_442428.1_5 Reverse -102 -109 6.0373 0.212
NP_440783.1_2 Reverse -296 -315 4.52268 0.111
NP_440673.1_3 Reverse -103 -110 12.4288 0.0426
NP_440673.1_3 Forward -325 -318 8.98723 0.203
NP_440673.1_3 Reverse -34 -41 8.8889 0.206
NP_441052.1_2 Reverse -307 -317 4.60159 0.154
NP_441052.1_2 Forward -110 -100 0.865012 0.256
NP_441052.1_2 Reverse -101 -111 0.57002 0.256
NP_440436.1_4 Forward -109 -100 6.39082 0.162
NP_440436.1_4 Reverse -102 -111 6.29249 0.164
NP_440436.1_4 Forward -267 -258 4.22755 0.277
NP_441884.1_9 Reverse -27 -46 -21.535 0.25
NP_442086.1_3 Forward -109 -90 8.84924 0.231
NP_441719.1_4 Forward -109 -102 6.82395 0.0855
NP_441719.1_4 Reverse -102 -109 6.52896 0.188
NP_441733.1_10 Forward -113 -100 3.5592 0.295
NP_441004.1_1 Forward -322 -303 -13.1769 0.255
NP_442813.1_4 Reverse -30 -49 -6.09707 0.299
NP_441729.1_2 Reverse -92 -111 23.9922 0.0208
NP_443054.1_2 Reverse -99 -113 -0.295402 0.293
NP_441851.1_10 Forward -111 -101 7.84651 0.13
NP_441851.1_10 Reverse -100 -110 7.64985 0.135
NP_441851.1_10 Reverse -370 -380 5.48657 0.211
NP_442011.1_1 Reverse -21 -40 7.86593 0.186
NP_441668.1_4 Forward -120 -101 -2.26216 0.288
NP_442515.1_1 Reverse -100 -114 12.9793 0.03
NP_442515.1_1 Forward -111 -97 2.06454 0.143
NP_441396.1_5 Forward -312 -303 8.65285 0.21
NP_441396.1_5 Reverse -130 -139 8.35786 0.224
NP_440463.1_7 Reverse -300 -314 14.3559 0.296
NP_441349.1_10 Reverse -91 -110 -6.49039 0.23
NP_442843.1_1 Forward -126 -107 -7.96535 0.252
NP_442843.1_1 Forward -127 -108 -12.0953 0.298
NP_442450.1_5 Forward -112 -102 9.61647 0.115
NP_440588.1_2 Reverse -13 -32 -5.80207 0.262
NP_440588.1_2 Forward -325 -306 -5.99873 0.266
NP_439950.1_1 Forward -121 -112 14.5527 0.212
NP_440954.1_1 Forward -196 -177 -2.26216 0.224
NP_442006.1_2 Forward -205 -188 -16.4808 0.254
NP_442006.1_2 Forward -48 -31 -17.1691 0.27
NP_441003.1_9 Reverse -298 -317 5.60432 0.261
NP_441078.1_4 Forward -110 -101 9.93116 0.0203
NP_441078.1_4 Reverse -101 -110 9.83282 0.0226
NP_442729.1_5 Forward -317 -307 17.6796 0.0748
NP_442729.1_8 Forward -114 -101 9.75405 0.125
NP_440539.1_9 Reverse -305 -324 0.982764 0.278
NP_440707.1_9 Forward -312 -293 0.884433 0.292
NP_442443.1_1 Reverse -16 -35 -6.98204 0.299
NP_441432.1_8 Forward -111 -102 5.60459 0.147
NP_442320.1_9 Forward -320 -306 19.1741 0.13
NP_440760.1_1 Forward -110 -91 -19.2734 0.219
NP_442797.1_7 Forward -111 -93 1.39578 0.259
NP_442400.1_10 Reverse -153 -166 13.8126 0.173
NP_440713.1_4 Reverse -18 -37 4.62101 0.226
NP_442489.1_7 Reverse -101 -110 10.5211 0.0102
NP_442489.1_7 Forward -110 -101 10.4228 0.0151
NP_440757.1_7 Forward -315 -297 -1.06249 0.269
NP_440757.1_7 Reverse -19 -37 -1.65248 0.275
NP_440559.1_1 Forward -109 -100 14.5527 0.0154
NP_440559.1_1 Reverse -102 -111 7.66954 0.0999
NP_441659.2_8 Reverse -101 -111 16.2046 0.0035
NP_441659.2_8 Forward -110 -100 9.81313 0.0269
NP_440363.1_9 Reverse -24 -42 13.6872 0.249
NP_441040.1_2 Reverse -14 -33 -9.53865 0.236
NP_441185.1_6 Forward -272 -253 -0.295539 0.29
NP_442346.1_5 Forward -111 -101 8.82982 0.124
NP_442346.1_5 Reverse -100 -110 8.1415 0.146
NP_442346.1_5 Forward -317 -307 4.89658 0.269
NP_440545.1_3 Forward -37 -20 0.137172 0.144
NP_440545.1_3 Reverse -97 -114 -2.3211 0.183
NP_440545.1_3 Forward -320 -303 -3.00942 0.197
NP_440545.1_3 Forward -35 -18 -7.04099 0.295
NP_440545.1_5 Forward -320 -303 5.64371 0.23
NP_440025.1_3 Forward -164 -150 11.2885 0.29
NP_441629.1_3 Reverse -180 -199 4.81688 0.218
NP_440459.1_2 Reverse -305 -322 10.9536 0.185
NP_440459.1_2 Forward -136 -119 7.41366 0.291
NP_442551.1_4 Forward -306 -291 -3.65835 0.292
NP_440847.1_3 Reverse -183 -197 11.012 0.275
NP_442603.1_7 Reverse -101 -115 10.3237 0.129
NP_440449.1_6 Reverse -17 -35 8.74215 0.194
NP_441047.1_3 Forward -150 -131 15.6341 0.268
NP_440170.1_1 Forward -324 -305 14.9458 0.0353
NP_441833.1_4 Reverse -102 -109 6.52896 0.0924
NP_441833.1_4 Forward -109 -102 6.23397 0.163
NP_443040.1_1 Forward -177 -163 9.60413 0.3
NP_442162.1_9 Forward -109 -102 12.9205 0.0282
NP_442162.1_9 Reverse -102 -109 12.9205 0.0282
NP_440671.1_4 Forward -47 -33 10.521 0.155
NP_440671.1_4 Forward -316 -302 5.40779 0.283
NP_441915.1_4 Reverse -29 -48 5.99684 0.293
NP_442140.1_3 Forward -315 -305 9.7148 0.103
NP_442140.1_3 Reverse -102 -112 3.61828 0.288
NP_440875.1_9 Forward -29 -19 6.81464 0.297
NP_441813.1_5 Reverse -99 -109 15.2213 0.0118
NP_441813.1_5 Forward -112 -102 6.37155 0.0947
NP_440590.1_4 Forward -109 -96 2.77255 0.0813
NP_440590.1_4 Reverse -91 -104 0.805932 0.143
NP_440567.1_1 Forward -109 -95 4.32615 0.123
NP_442497.1_10 Forward -109 -100 10.1278 0.0166
NP_442497.1_10 Reverse -102 -111 10.0295 0.0222
NP_440821.1_4 Forward -112 -102 10.1081 0.0188
NP_440821.1_4 Reverse -99 -109 1.16001 0.141
NP_441239.1_9 Reverse -99 -111 14.887 0.0247
NP_441239.1_9 Reverse -30 -42 8.10212 0.142
NP_441239.1_9 Forward -33 -21 6.23383 0.197
NP_441239.1_9 Forward -112 -100 5.54551 0.217
NP_441239.1_9 Reverse -305 -317 4.75886 0.243
NP_441892.1_1 Reverse -305 -322 -5.56602 0.283
NP_440796.1_3 Forward -117 -99 8.3765 0.264
NP_442193.1_1 Reverse -124 -142 9.85225 0.233
NP_442138.1_9 Forward -112 -93 7.66846 0.291
NP_440546.1_4 Forward -110 -100 13.8273 0.0459
NP_440546.1_4 Reverse -22 -32 11.1125 0.0963
NP_440546.1_4 Reverse -101 -111 10.2399 0.109
NP_440546.1_4 Reverse -90 -100 9.75513 0.121
NP_440546.1_4 Forward -316 -306 8.78555 0.171
NP_440462.1_6 Reverse -99 -109 6.76487 0.102
NP_440868.1_4 Reverse -97 -109 1.61227 0.177
NP_440868.1_4 Reverse -18 -30 0.137309 0.228
NP_440868.1_4 Forward -114 -102 -1.14099 0.296
NP_441879.1_2 Reverse -316 -335 12.1925 0.292
NP_441672.1_10 Reverse -92 -111 14.4541 0.244
NP_440696.1_3 Reverse -28 -46 2.96908 0.213
NP_440696.1_3 Reverse -29 -47 0.314141 0.233
NP_442039.1_4 Forward -109 -102 11.6422 0.0747
NP_442679.1_1 Reverse -145 -164 -5.80207 0.298
NP_442837.1_3 Forward -109 -102 6.0373 0.25
NP_442837.1_3 Reverse -102 -109 6.0373 0.25
NP_442053.1_1 Reverse -101 -110 16.6177 0.00257
NP_442053.1_1 Forward -110 -101 8.65285 0.0741
NP_440505.1_3 Forward -112 -102 5.97822 0.202
NP_440505.1_3 Reverse -20 -30 4.50326 0.284
NP_441203.1_1 Reverse -102 -121 -3.54046 0.0699
NP_441408.2_7 Forward -56 -37 -3.24547 0.272
NP_440914.1_1 Reverse -101 -111 6.56569 0.273
NP_441011.1_8 Forward -109 -100 10.8161 0.094
NP_442533.1_1 Forward -313 -294 -15.1435 0.252
NP_442533.1_6 Reverse -101 -110 14.2577 0.0132
NP_442533.1_6 Forward -99 -90 11.7994 0.0386
NP_442533.1_6 Forward -110 -101 7.47288 0.0898
NP_442533.1_6 Forward -31 -22 4.0313 0.194
NP_442533.1_6 Reverse -32 -41 2.06468 0.275
NP_440263.1_3 Reverse -119 -138 3.6377 0.245
NP_442232.1_3 Forward -39 -20 -13.8652 0.283
NP_441482.1_7 Forward -116 -102 5.70279 0.0394
NP_441482.1_7 Reverse -95 -109 -2.45868 0.0963
NP_439944.1_9 Reverse -102 -112 7.55152 0.138
NP_442202.1_10 Forward -32 -18 14.9459 0.147
NP_440116.1_8 Forward -40 -21 -5.80207 0.195
NP_441527.1_4 Reverse -259 -278 -9.2154 0.255
NP_440115.1_6 Reverse -315 -325 7.25653 0.152
NP_440115.1_6 Reverse -98 -108 5.48657 0.244
NP_440007.1_9 Forward -45 -31 1.76955 0.285
NP_441602.1_3 Reverse -17 -36 -4.6221 0.269
NP_441972.1_5 Forward -322 -303 -8.65367 0.27
NP_001035870.1_5 Forward -82 -63 14.7483 0.214
NP_442306.1_10 Reverse -96 -115 -12.7836 0.189
NP_441286.1_1 Reverse -100 -112 4.66053 0.031
NP_441286.1_1 Forward -111 -99 -3.40261 0.145
NP_440670.1_8 Forward -110 -101 18.0926 0.00136
NP_440670.1_8 Reverse -101 -110 15.831 0.00494
NP_440886.1_7 Reverse -303 -313 9.41933 0.0805
NP_440886.1_7 Reverse -100 -110 6.76441 0.114
NP_440886.1_7 Forward -139 -129 4.69947 0.22
NP_440886.1_7 Forward -100 -90 4.20782 0.249
NP_440886.1_7 Forward -32 -22 3.8145 0.265
NP_440083.1_9 Forward -91 -72 11.6469 0.281
NP_442614.1_2 Forward -110 -96 13.8643 0.112
NP_442614.1_2 Forward -41 -27 11.8976 0.176
NP_442614.1_2 Reverse -22 -36 11.5043 0.194
NP_442072.1_9 Forward -111 -93 -21.712 0.212
NP_442213.1_5 Reverse -11 -30 7.57094 0.176
NP_441403.1_4 Forward -319 -301 10.6389 0.282
NP_442022.1_4 Forward -208 -189 6.58763 0.27
NP_440907.2_8 Reverse -102 -112 8.04271 0.117
NP_441626.1_2 Forward -109 -102 12.2322 0.0511
NP_441626.1_2 Reverse -102 -109 5.93897 0.231
NP_442209.1_6 Forward -144 -125 14.9458 0.185
NP_440107.1_5 Reverse -297 -316 -2.65548 0.178
NP_441962.1_4 Reverse -96 -115 -10.4236 0.228
NP_441962.1_9 Reverse -120 -139 6.98095 0.258
NP_440387.1_1 Reverse -101 -117 4.18844 0.0455
NP_440855.1_5 Reverse -299 -318 2.45694 0.291
NP_441431.1_2 Reverse -304 -318 6.58715 0.266
NP_441431.1_2 Reverse -98 -112 6.29216 0.275
NP_441431.1_3 Forward -316 -297 2.65439 0.282
NP_441993.1_1 Reverse -24 -43 4.96787 0.21
NP_441993.1_1 Reverse -39 -58 3.01872 0.244
NP_442383.1_2 Reverse -357 -376 6.29264 0.292
NP_440114.1_10 Forward -110 -96 16.4209 0.0185
NP_440114.1_10 Reverse -101 -115 9.5377 0.169
NP_440114.1_10 Reverse -90 -104 8.16106 0.213
NP_440114.1_10 Reverse -22 -36 7.47274 0.235
NP_441510.2_7 Reverse -307 -321 12.782 0.28
NP_441510.2_7 Forward -47 -33 9.53707 0.281
NP_440766.1_4 Forward -45 -31 0.392915 0.286
NP_441311.1_2 Forward -162 -148 11.012 0.266
NP_442246.1_6 Reverse -145 -164 5.50599 0.281
NP_440457.1_1 Forward -114 -102 12.0354 0.092
NP_440457.1_1 Reverse -97 -109 10.7571 0.092
NP_440457.1_1 Forward -45 -33 7.02048 0.105
NP_440798.1_6 Forward -109 -96 3.5592 0.15
NP_441981.1_3 Forward -371 -357 14.8933 0.268
NP_441332.1_6 Reverse -31 -41 16.1001 0.0994
NP_441332.1_6 Forward -32 -22 16.0033 0.0994
NP_442509.1_9 Forward -110 -100 14.6309 0.0263
NP_442509.1_9 Reverse -101 -111 14.6309 0.0263
NP_442514.1_5 Reverse -299 -318 -5.21283 0.254
NP_440554.1_4 Reverse -102 -112 4.0116 0.205
NP_441845.1_6 Forward -122 -104 2.0841 0.262
NP_442737.1_5 Forward -317 -298 12.879 0.257
NP_441885.1_5 Forward -110 -100 9.12481 0.0238
NP_441885.1_5 Reverse -101 -111 1.55333 0.109
NP_441885.1_5 Forward -99 -89 -1.69159 0.277
NP_442341.1_7 Reverse -100 -114 10.1277 0.0682
NP_441756.1_5 Reverse -21 -40 -3.44213 0.29
NP_441173.1_9 Reverse -59 -67 9.85212 0.275
NP_440423.1_6 Forward -118 -99 -15.0452 0.229
NP_443000.1_7 Reverse -99 -109 1.84832 0.228
NP_440275.1_3 Forward -112 -102 7.45319 0.0714
NP_440275.1_3 Reverse -99 -109 7.35486 0.0755
NP_442275.1_1 Reverse -29 -48 0.294447 0.285
NP_440679.1_10 Reverse -103 -122 -18.8801 0.279
NP_441122.1_1 Forward -320 -305 3.81481 0.28
NP_441122.1_1 Forward -272 -257 3.12649 0.285
NP_439962.1_4 Reverse -30 -49 -7.4737 0.289
NP_442495.1_3 Forward -315 -297 14.1788 0.242
NP_441105.1_3 Reverse -296 -315 -5.80207 0.224
NP_440216.1_1 Forward -110 -96 7.9644 0.00737
NP_440216.1_1 Reverse -101 -115 -4.81863 0.115
NP_440216.1_1 Reverse -90 -104 -11.4068 0.184
NP_440216.1_9 Forward -374 -365 12.3894 0.241
NP_440216.1_9 Reverse -70 -79 9.83282 0.286
NP_440216.1_9 Reverse -309 -318 7.37455 0.286
NP_440216.1_9 Forward -126 -117 5.70292 0.29
NP_440216.1_9 Forward -25 -16 5.50626 0.292
NP_440172.1_1 Reverse -101 -111 13.353 0.0211
NP_440172.1_1 Forward -110 -100 6.56821 0.102
NP_440167.1_3 Reverse -91 -110 7.96426 0.286
NP_442015.1_10 Reverse -97 -110 10.1474 0.0402
NP_441226.1_7 Forward -109 -102 12.7234 0.0312
NP_441226.1_7 Reverse -102 -109 11.5435 0.0757
NP_441226.1_7 Reverse -33 -40 8.59356 0.197
NP_441226.1_7 Forward -98 -91 8.29857 0.205
NP_441226.1_7 Forward -30 -23 8.29857 0.205
NP_441111.1_7 Forward -109 -101 8.96754 0.0463
NP_441111.1_7 Reverse -102 -110 8.86921 0.0589
NP_441766.1_2 Reverse -101 -110 13.9627 0.0114
NP_441766.1_2 Forward -110 -101 7.76787 0.0714
NP_441766.1_2 Reverse -32 -41 1.67135 0.278
NP_443052.1_8 Reverse -91 -110 -4.6221 0.119
NP_442403.1_9 Reverse -355 -374 1.86774 0.299
NP_442154.1_1 Forward -315 -297 -9.91228 0.195
NP_440261.1_5 Forward -109 -96 -4.30728 0.145
NP_440261.1_5 Reverse -102 -115 -10.5021 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTGGCAGGGCACATTTATATTGAATCCCAGGCAAGAATCAGCGGCGTTTTAGGAGTGCACCAATTTGTCCACATTGGTCGCTTGGCCATGGTGGGGGGCATGAGTCGCATTGAACGGGATGTGCCTCCTTTTACCATTGTTGAAGGTAATCCTTCTCGGGTGCGTTCTTTAAACTTAATCGGCCTGCAACGTTCCGGTATGTCGGCGGAGGATTTGAGTGCGTTAAAACAAGCTTTTCGGTTAATTTATCGTTCTGACACCCCCTACCAACAGGCCTTGGAAGAATTAGGGCGATCGGCCGCCCATCCCTACGTGCAACATTTCCAATGCTTTTTGCAGAAATCTAGCTACGACCAAGGGCGACGGGGCCCCATCCCCGGCAAAAAATAGGTCAGTGCC

CDS

ATGACCGGCTCCCATTTATTAGTAAATCTTTCTTTTCTGCTGGCCCAACCGACGGGGTTGAGTGTCTATGCCAGTAATGTTTTTCCCCATCTCAAACCCCTCAAGCCAACATTACTAACTTCCCAGTTGGTGGCGGAGTTTCCCTGCCAAACTGTGCCGAATAATCTCACCCCAGCCCAGGGCAGTCGGGGCCATTTTAATCGCTTAGTTTGGACCCAGTTTCAGCTACCAGAACTTTACCGACAATTAAAAGGTTCTTTGCTTTTTTCCCCCATCCCGGAAGCTCCACTTTGGGCCGATTGTCGCACAGTGGTGATGGTGCATGATTTGATTCCCCTCCGGTTTCCCAACTGGAAATCTCCCCTGACTAGCTATTGCAAGTTTTATTTGCCGTTGGTGCTGGGGCAAGCGGAACATATTTTGTGTAATTCCCAAGCCACAGCCGATGATGTGGTGGACTATTTCCAAATTCCCGCCAGTAAAATTACGGCGATCGCCTTGGGCTATGACCGGGAACATTTTCAACCGGGACAGGATAATTTAGCCCCAAGGAAAAAGCCCTACTTTCTCTTTGTGGGCCGCCACGATCCGCACAAAAATGTGGGGCGGCTGATTCAAGCCTTTGCTCGATTTGTGCAAAATACCAACAGCCAAGATATTGAGTTAATTTTGGCCGGTCCTACCGATCGCCGTTACACTCCCAAATTAATGGCCTTGGCGACAGAATTGGGGGTTGGGACAGAGGTACATTGTTTAGACTACGTTAGCTATGACCAACTGCGACAACTTTATCGCCAGGCGATCGCCTTGGTGTTTCCCTCTTTATGGGAAGGATTTGGTTTTCCAGTGCTGGAAGCCATGGCCTGTGGCACGGCGGTAATTACCTCTTCCGTCTCGTCCTTACCAGAAGTGGGAGGAGATGCCGTTCTATTGGTCGATCCCTACAGTATTAAAGAGATTTATCAAGCTATGGAGCAGGTGTGGAAAGATCGCCGGTTGTGTCAGCAGTTACAACAACAGAGCTTAGCCAGAGCAAGGGAATTTTCCTGGGAAAAAACTGGACATTTAACTAGGGAAGTATTGGCAAAGTATCTTTAG

Protein

MTGSHLLVNLSFLLAQPTGLSVYASNVFPHLKPLKPTLLTSQLVAEFPCQTVPNNLTPAQGSRGHFNRLVWTQFQLPELYRQLKGSLLFSPIPEAPLWADCRTVVMVHDLIPLRFPNWKSPLTSYCKFYLPLVLGQAEHILCNSQATADDVVDYFQIPASKITAIALGYDREHFQPGQDNLAPRKKPYFLFVGRHDPHKNVGRLIQAFARFVQNTNSQDIELILAGPTDRRYTPKLMALATELGVGTEVHCLDYVSYDQLRQLYRQAIALVFPSLWEGFGFPVLEAMACGTAVITSSVSSLPEVGGDAVLLVDPYSIKEIYQAMEQVWKDRRLCQQLQQQSLARAREFSWEKTGHLTREVLAKYL