Your browser is old and dusty. Try Google Chrome!

Details for sll0376

ORF sll0376
Accession NP_442326.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Reverse -130 -137 9.77388 0.169
NP_441418.1_6 Forward -54 -35 -3.93378 0.0254
NP_441418.1_6 Forward -177 -158 -20.2567 0.108
NP_441418.1_6 Forward -297 -278 -30.5815 0.286
NP_441453.1_7 Reverse -38 -45 12.1338 0.295
NP_442151.1_6 Reverse -129 -143 9.34103 0.152
NP_441818.1_9 Forward -354 -335 -5.60541 0.254
NP_442169.1_1 Reverse -101 -120 -3.14714 0.29
NP_441098.1_3 Forward -350 -331 -5.92763 0.28
NP_441337.1_1 Forward -259 -240 15.2408 0.268
NP_442000.2_10 Forward -400 -382 13.7855 0.167
NP_441054.1_2 Forward -296 -277 9.83255 0.284
NP_442062.1_8 Forward -297 -287 5.28991 0.176
NP_440839.1_4 Forward -206 -187 11.405 0.268
NP_441859.1_3 Forward -55 -36 1.47364 0.284
NP_440304.1_4 Reverse -90 -100 3.02829 0.299
NP_440908.1_5 Forward -295 -278 13.0185 0.175
NP_441594.1_6 Reverse -189 -208 4.32602 0.221
NP_442742.1_9 Forward -122 -103 -10.9153 0.269
NP_441491.1_6 Forward -357 -343 16.4409 0.204
NP_441925.1_4 Forward -121 -102 -15.9309 0.275
NP_441083.1_5 Reverse -288 -298 -0.0199663 0.251
NP_441149.1_6 Forward -184 -165 11.2092 0.144
NP_441738.1_2 Reverse -290 -297 13.8051 0.0221
NP_441942.1_6 Forward -304 -285 16.3229 0.235
NP_440209.1_1 Reverse -288 -296 2.1827 0.254
NP_442180.1_10 Reverse -69 -88 -1.7705 0.268
NP_441770.1_4 Reverse -38 -57 -9.93197 0.263
NP_442570.1_3 Forward -193 -174 -3.14714 0.216
NP_441792.1_1 Reverse -169 -188 10.0292 0.157
NP_442111.1_4 Forward -55 -41 5.89945 0.145
NP_440012.1_6 Forward -41 -22 6.09597 0.299
NP_440747.1_10 Forward -300 -288 -12.0557 0.199
NP_441639.1_5 Forward -337 -319 8.47561 0.271
NP_440403.1_10 Reverse -285 -304 6.68596 0.212
NP_442848.1_9 Forward -60 -41 1.86774 0.255
NP_443018.1_3 Forward -296 -289 9.77388 0.118
NP_440376.1_1 Reverse -45 -54 2.458 0.221
NP_442687.1_7 Reverse -287 -297 6.07655 0.179
NP_442687.1_7 Forward -55 -45 5.78156 0.188
NP_442687.1_7 Forward -139 -129 4.69992 0.238
NP_442485.1_3 Reverse -180 -199 -3.83545 0.277
NP_441846.1_10 Reverse -93 -112 -23.7966 0.298
NP_440042.1_2 Reverse -278 -297 1.67108 0.201
NP_440667.1_2 Forward -297 -278 1.67108 0.204
NP_440141.1_8 Reverse -37 -56 8.55425 0.23
NP_442782.1_2 Reverse -33 -47 0.392915 0.29
NP_442544.1_2 Reverse -79 -93 8.65272 0.106
NP_441487.1_6 Forward -232 -213 -1.96717 0.286
NP_441487.1_9 Reverse -155 -174 3.73603 0.154
NP_442937.1_5 Forward -35 -16 6.39097 0.28
NP_441958.1_5 Reverse -44 -54 -1.3966 0.239
NP_440450.1_10 Forward -338 -319 10.6469 0.234
NP_440950.1_8 Reverse -335 -354 11.5651 0.188
NP_440203.1_5 Forward -306 -296 9.51767 0.254
NP_442119.1_9 Forward -66 -47 10.5209 0.248
NP_443055.1_6 Reverse -280 -298 -0.276578 0.256
NP_441099.1_5 Reverse -278 -297 -7.08038 0.17
NP_441000.1_6 Forward -66 -52 -5.70361 0.29
NP_441674.1_5 Forward -267 -248 12.6841 0.122
NP_440147.1_4 Forward -56 -43 0.805932 0.244
NP_441725.1_5 Forward -296 -286 5.48657 0.115
NP_442941.1_3 Reverse -289 -299 0.373358 0.212
NP_440983.1_5 Reverse -21 -40 1.27776 0.214
NP_441678.1_9 Forward -186 -167 -5.01543 0.297
NP_442256.1_2 Reverse -286 -304 -0.275845 0.139
NP_440375.1_8 Forward -60 -41 2.26107 0.23
NP_443049.1_6 Forward -298 -288 13.3 0.191
NP_442215.1_2 Forward -167 -151 -5.15301 0.246
NP_440253.1_2 Forward -54 -36 3.75572 0.112
NP_440253.1_2 Forward -303 -285 -3.42244 0.294
NP_442554.1_9 Forward -358 -339 12.4065 0.279
NP_440775.1_5 Reverse -328 -347 18.879 0.155
NP_440895.1_6 Forward -36 -23 12.5073 0.202
NP_441198.1_4 Forward -42 -23 12.2908 0.241
NP_441758.1_4 Reverse -99 -118 9.3409 0.254
NP_441020.2_6 Forward -299 -282 8.20031 0.205
NP_442868.1_6 Reverse -286 -296 3.42162 0.199
NP_442719.1_2 Forward -61 -43 -2.43985 0.186
NP_441612.1_2 Forward -15 -5 9.90466 0.21
NP_441612.1_2 Reverse -339 -349 6.70984 0.277
NP_442227.1_2 Reverse -73 -92 1.47442 0.245
NP_442427.1_8 Reverse -279 -298 4.916 0.288
NP_442808.1_1 Forward -114 -104 3.8145 0.222
NP_442542.1_2 Reverse -43 -56 8.47575 0.154
NP_442542.1_2 Reverse -286 -299 7.39411 0.182
NP_442050.1_5 Reverse -286 -296 7.45273 0.256
NP_442342.1_9 Forward -115 -99 3.10679 0.271
NP_441878.1_6 Forward -55 -45 -6.90313 0.198
NP_441878.1_6 Reverse -44 -54 -7.00147 0.201
NP_441445.1_1 Forward -306 -287 2.75272 0.229
NP_442183.1_1 Forward -297 -283 11.111 0.0757
NP_440086.1_4 Forward -23 -9 17.8672 0.204
NP_441574.1_1 Forward -42 -23 -1.37718 0.216
NP_441574.1_1 Reverse -192 -211 -7.4737 0.292
NP_441549.1_9 Forward -211 -193 -10.4039 0.278
NP_442594.1_8 Forward -180 -161 3.44104 0.282
NP_441633.1_3 Forward -56 -43 -7.25721 0.3
NP_442998.1_10 Reverse -290 -297 6.23397 0.157
NP_440256.1_1 Forward -104 -85 -10.1286 0.295
NP_440915.1_6 Reverse -41 -55 3.73617 0.1
NP_442158.1_4 Forward -23 -13 11.3864 0.278
NP_441296.1_1 Forward -264 -245 16.7157 0.165
NP_441704.1_8 Forward -308 -289 11.2084 0.142
NP_441464.1_1 Reverse -29 -48 6.88262 0.277
NP_441464.1_10 Reverse -102 -116 18.2892 0.0911
NP_441464.1_10 Reverse -101 -115 7.57108 0.295
NP_440677.1_6 Reverse -251 -270 12.2908 0.196
NP_442386.1_10 Reverse -103 -116 11.0324 0.217
NP_440168.1_9 Forward -56 -37 -4.91709 0.296
NP_442326.1_4 Forward -391 -373 19.4878 0.23
NP_442326.1_7 Forward -106 -87 18.6815 0.264
NP_442240.1_2 Forward -174 -155 -20.2567 0.295
NP_440586.1_8 Forward -232 -225 7.02027 0.279
NP_441262.1_3 Forward -297 -290 11.5438 0.0584
NP_440027.1_3 Reverse -156 -174 1.78836 0.295
NP_439937.1_9 Reverse -383 -400 1.5131 0.093
NP_439937.1_9 Reverse -161 -178 -14.8098 0.287
NP_439943.1_4 Forward -192 -173 4.42435 0.287
NP_441138.1_5 Forward -33 -20 11.8073 0.227
NP_440316.1_10 Reverse -103 -113 8.82982 0.239
NP_440139.1_1 Reverse -198 -217 2.6536 0.225
NP_440267.1_2 Reverse -27 -41 7.66879 0.194
NP_440948.1_4 Forward -193 -174 9.63589 0.279
NP_442114.1_4 Reverse -56 -67 12.35 0.107
NP_441980.1_5 Forward -60 -41 16.2232 0.172
NP_441877.1_5 Forward -204 -185 0.0977854 0.276
NP_441018.1_7 Reverse -98 -117 7.96426 0.259
NP_442262.1_10 Forward -296 -289 11.1505 0.115
NP_440163.1_10 Forward -300 -290 12.7631 0.154
NP_440531.1_6 Reverse -38 -57 -1.57384 0.234
NP_441060.1_3 Reverse -179 -198 9.14423 0.227
NP_441335.1_8 Reverse -42 -61 15.2408 0.133
NP_440350.1_5 Forward -356 -337 5.30933 0.158
NP_441543.1_3 Forward -115 -101 6.19383 0.286
NP_441918.1_7 Forward -298 -279 -0.787193 0.297
NP_443064.1_8 Forward -261 -251 14.8275 0.29
NP_441462.1_2 Reverse -45 -55 -1.29827 0.299
NP_441462.1_2 Forward -297 -287 -1.29827 0.299
NP_441410.1_3 Reverse -251 -270 4.81767 0.261
NP_440519.1_6 Reverse -171 -185 11.5043 0.29
NP_442204.1_2 Forward -223 -204 9.93088 0.225
NP_442204.1_2 Forward -307 -288 8.84924 0.239
NP_440516.1_8 Forward -297 -288 0.688044 0.136
NP_440783.1_5 Reverse -92 -111 -0.688862 0.238
NP_440077.1_4 Forward -173 -154 11.8975 0.268
NP_441052.1_2 Reverse -132 -142 2.92996 0.187
NP_441052.1_2 Reverse -288 -298 1.25834 0.249
NP_440436.1_4 Forward -64 -55 7.47246 0.129
NP_441004.1_1 Forward -190 -171 -11.8003 0.242
NP_441004.1_1 Reverse -40 -59 -17.3068 0.29
NP_440296.1_10 Reverse -257 -276 -6.39206 0.225
NP_442206.1_9 Reverse -288 -307 13.6666 0.28
NP_440328.1_4 Forward -47 -28 -0.688862 0.286
NP_443054.1_2 Forward -56 -42 1.08123 0.251
NP_442515.1_1 Forward -55 -41 3.04785 0.125
NP_442515.1_1 Reverse -155 -169 -3.73699 0.297
NP_442515.1_1 Forward -298 -284 -3.83532 0.298
NP_441683.1_7 Reverse -103 -122 -8.35868 0.284
NP_441982.1_6 Forward -245 -236 12.6763 0.274
NP_440432.1_9 Forward -296 -281 -4.24833 0.202
NP_441477.1_5 Reverse -39 -58 17.5024 0.189
NP_440431.1_2 Reverse -223 -242 9.53756 0.137
NP_441078.1_4 Reverse -45 -54 -0.983583 0.213
NP_441078.1_4 Forward -54 -45 -1.96689 0.282
NP_442729.1_7 Reverse -299 -317 5.23069 0.292
NP_440539.1_9 Reverse -184 -203 -2.36049 0.286
NP_442348.1_2 Reverse -230 -239 12.2911 0.218
NP_442443.1_1 Reverse -38 -57 -4.52377 0.272
NP_441432.1_8 Forward -186 -177 2.85133 0.281
NP_441432.1_9 Forward -333 -320 12.5736 0.201
NP_442344.1_4 Forward -272 -253 16.3224 0.112
NP_441732.1_2 Reverse -194 -210 -17.1494 0.24
NP_440313.1_5 Forward -233 -215 10.7364 0.294
NP_440760.1_1 Reverse -45 -64 -11.5053 0.0857
NP_442797.1_1 Forward -112 -93 -5.21209 0.288
NP_440713.1_4 Forward -191 -172 5.60432 0.205
NP_442489.1_7 Forward -297 -288 -1.86856 0.259
NP_442489.1_7 Reverse -45 -54 -1.96689 0.28
NP_440559.1_1 Reverse -289 -298 4.52295 0.26
NP_441659.2_8 Forward -138 -128 -0.0199663 0.282
NP_442346.1_5 Forward -139 -129 7.25653 0.176
NP_442346.1_5 Forward -31 -21 6.27322 0.208
NP_440545.1_5 Reverse -99 -116 5.54538 0.233
NP_441856.1_5 Forward -58 -39 14.3549 0.295
NP_440025.1_3 Forward -57 -43 9.44903 0.296
NP_440486.1_6 Reverse -247 -266 10.3242 0.219
NP_440459.1_2 Forward -63 -46 8.39697 0.264
NP_442828.1_7 Reverse -101 -120 -4.72043 0.276
NP_441502.1_9 Forward -22 -8 15.7491 0.289
NP_440912.1_3 Forward -130 -111 8.65176 0.271
NP_440671.1_4 Forward -303 -289 5.89945 0.27
NP_442723.1_1 Forward -123 -104 1.27698 0.298
NP_441239.1_9 Reverse -286 -298 2.98891 0.3
NP_442193.1_1 Reverse -215 -233 7.78729 0.28
NP_441017.1_8 Reverse -211 -226 12.8613 0.18
NP_439974.1_8 Forward -292 -273 23.714 0.00867
NP_440868.1_7 Reverse -23 -42 19.0748 0.0702
NP_442053.1_1 Reverse -288 -297 4.42462 0.249
NP_440505.1_3 Forward -299 -289 4.40493 0.292
NP_442255.1_5 Forward -248 -229 11.4058 0.227
NP_440914.1_2 Reverse -40 -59 18.0924 0.233
NP_442533.1_1 Forward -181 -162 -15.0452 0.248
NP_442322.1_4 Reverse -64 -81 -4.09173 0.253
NP_441028.1_6 Forward -118 -108 6.37109 0.23
NP_441527.1_7 Forward -360 -341 9.04509 0.282
NP_440007.1_9 Forward -253 -239 1.96621 0.281
NP_441059.1_2 Reverse -33 -52 -4.72043 0.242
NP_439903.1_6 Reverse -173 -192 3.44025 0.21
NP_441286.1_1 Forward -298 -286 3.97222 0.0397
NP_440670.1_8 Reverse -45 -54 5.01461 0.175
NP_442963.1_6 Reverse -177 -196 16.8536 0.236
NP_441021.1_10 Reverse -172 -191 16.4199 0.254
NP_441463.1_3 Reverse -82 -101 -10.227 0.291
NP_440387.1_1 Forward -207 -191 -5.93965 0.258
NP_441836.1_2 Forward -187 -168 -0.983855 0.215
NP_440634.1_10 Reverse -12 -31 14.3549 0.131
NP_441510.2_10 Reverse -43 -62 19.764 0.107
NP_440293.1_3 Reverse -96 -115 -5.40875 0.276
NP_441237.1_9 Forward -296 -286 11.9764 0.146
NP_441237.1_9 Reverse -46 -56 9.61647 0.281
NP_442743.1_1 Reverse -172 -191 7.07848 0.268
NP_440457.1_1 Reverse -256 -268 3.57889 0.191
NP_441332.1_6 Forward -113 -103 13.583 0.184
NP_441436.1_8 Forward -186 -167 10.8159 0.262
NP_440478.1_4 Reverse -284 -303 11.8975 0.239
NP_442341.1_7 Forward -55 -41 10.816 0.0596
NP_442341.1_7 Forward -142 -128 7.37441 0.107
NP_441173.1_9 Reverse -237 -245 13.2937 0.17
NP_441842.1_1 Forward -63 -50 10.4418 0.3
NP_442275.1_1 Forward -195 -176 9.53756 0.244
NP_441902.1_3 Forward -399 -389 12.1071 0.274
NP_441389.1_5 Reverse -247 -266 12.8808 0.25
NP_440641.1_4 Reverse -205 -224 16.1257 0.0551
NP_440172.1_1 Forward -297 -287 4.50326 0.184
NP_442015.1_4 Reverse -375 -393 4.44404 0.243
NP_440416.1_9 Reverse -175 -194 -20.65 0.287
NP_443052.1_9 Forward -115 -96 -6.49039 0.283
NP_440261.1_5 Reverse -130 -143 -5.97891 0.192
NP_440988.1_2 Reverse -29 -47 6.90232 0.299
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTGGGAGGAAACCGACCATGTTCTGGAAGCTCAGACAAGTATCCCGTTTCTGGTTTTGTTACTTGAATCAACCTATTTTTAGTCGAGAGTCAAAATCCACATGGCGATTGAGCCATTTTTGGTCCATGTATCAGATCTCCCTGCTGGAATCCTGTTGGCAAAAAAGTCCCATCAAGGAAACTTCCCTCTGATGGCGGTATGCTTAGCCAGTCTTGGCAAAGGGTCGGGAGAGTTGGTGGTTGACCAAAGAATTTGATTGTGGGTCACCGCAATTATTAGTCTTACCCCCCAGACCCCAAGCAGTTACCTTACCAAAGAGGGCAGGGAGTTATGCTACGATCCTTGGCCAATAGCCCCAGTGGTTGACTTGGTGATGATTTTTGTTAGGAAAACCAATCT

CDS

ATGACCCCATCAGATTATCAGGATCAGGAAGTTAAAACCCCCAAAGTGGAGGTGGTAGATTCCTACGATACGGGAGACGATGGCATCACTGATGCAGCCCGTAGATATTGGTTGCAGTTCCAACAATGGTTTGATAATTTGCCCCTCCCCGCCAAAGGCGCTGTGGCGATCGCCGTTTTGTTTGTTGCTTTTTCGGTGCTGACCCAGGTGCTGAAGTTTGTGGCTTCCCTGGTCACTTTGGCTATTTTGCTCGTCATTCTCTACGGAGTTTATCGGGTCTTTCTGCGCCAGGATAAGGGTAATTGA

Protein

MTPSDYQDQEVKTPKVEVVDSYDTGDDGITDAARRYWLQFQQWFDNLPLPAKGAVAIAVLFVAFSVLTQVLKFVASLVTLAILLVILYGVYRVFLRQDKGN