Your browser is old and dusty. Try Google Chrome!

Details for sll0372

ORF sll0372
Accession NP_442330.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_443027.1_4 Reverse -372 -382 9.41981 0.163
NP_440061.1_9 Reverse -48 -62 8.65209 0.167
NP_439979.1_7 Reverse -207 -224 16.9518 0.215
NP_442062.1_3 Reverse -154 -173 -3.04881 0.274
NP_442062.1_8 Forward -342 -332 11.2881 0.0483
NP_441802.1_1 Forward -300 -281 8.25926 0.224
NP_441581.1_8 Forward -286 -267 17.994 0.182
NP_439918.1_3 Forward -386 -367 5.89931 0.264
NP_441200.1_4 Forward -302 -283 14.0608 0.156
NP_441208.1_9 Forward -386 -372 13.7659 0.103
NP_441594.1_6 Reverse -29 -48 9.43923 0.143
NP_440273.1_2 Reverse -65 -84 16.3215 0.194
NP_441083.1_2 Reverse -204 -221 14.6894 0.284
NP_441083.1_5 Reverse -374 -384 1.35667 0.209
NP_441083.1_5 Forward -383 -373 -0.806614 0.28
NP_441738.1_2 Forward -381 -374 13.3134 0.0335
NP_440209.1_1 Reverse -374 -382 5.0343 0.194
NP_442889.1_1 Forward -47 -28 -15.1435 0.288
NP_440178.1_7 Forward -59 -40 -15.4385 0.161
NP_440644.1_3 Forward -350 -331 0.982764 0.278
NP_441624.1_7 Forward -33 -19 10.0294 0.217
NP_440747.1_10 Reverse -371 -383 -2.51763 0.0509
NP_440747.1_10 Forward -386 -374 -4.48425 0.101
NP_440470.1_5 Reverse -147 -166 6.63627 0.279
NP_443018.1_3 Forward -341 -334 8.49558 0.141
NP_440376.1_1 Forward -383 -374 0.196389 0.283
NP_440376.1_1 Reverse -374 -383 -0.0986038 0.285
NP_441274.1_10 Reverse -314 -333 11.0117 0.287
NP_441414.1_9 Reverse -374 -393 -6.09707 0.187
NP_441256.1_2 Forward -286 -267 5.89931 0.245
NP_441958.1_5 Reverse -373 -383 1.84832 0.0729
NP_442690.1_1 Forward -96 -77 -9.83364 0.205
NP_442911.1_2 Forward -393 -374 -2.26216 0.096
NP_442911.1_2 Reverse -323 -342 -10.6203 0.284
NP_440411.1_10 Forward -42 -23 15.0437 0.194
NP_441646.1_1 Reverse -326 -345 0.392778 0.251
NP_440377.1_1 Forward -190 -173 12.4333 0.26
NP_441000.1_5 Reverse -5 -24 3.44025 0.29
NP_441916.1_10 Reverse -29 -48 2.75272 0.241
NP_442941.1_3 Forward -382 -372 0.0783647 0.231
NP_442281.1_1 Reverse -27 -41 5.21053 0.166
NP_442500.1_8 Forward -167 -153 8.63588 0.291
NP_442288.1_3 Forward -40 -23 8.29864 0.257
NP_441860.1_1 Forward -166 -152 13.7072 0.294
NP_441556.1_10 Forward -46 -32 9.92981 0.281
NP_441644.1_6 Reverse -374 -384 3.42118 0.282
NP_442215.1_2 Reverse -16 -32 6.25339 0.0723
NP_442933.1_10 Reverse -374 -383 4.12963 0.28
NP_441751.2_8 Forward -382 -368 -6.98191 0.294
NP_442554.1_8 Forward -382 -372 4.89658 0.168
NP_442292.1_1 Forward -382 -373 5.70292 0.135
NP_440919.1_7 Reverse -78 -96 7.37907 0.228
NP_441715.1_4 Forward -382 -372 5.78156 0.18
NP_441673.1_1 Forward -383 -374 1.37636 0.114
NP_441673.1_1 Reverse -374 -383 1.1797 0.163
NP_442253.1_5 Forward -44 -27 -6.64766 0.298
NP_441826.1_2 Reverse -25 -39 0.392915 0.187
NP_441330.1_1 Forward -347 -328 -15.6352 0.289
NP_442719.1_2 Forward -28 -10 -8.733 0.255
NP_442719.1_2 Forward -27 -9 -10.6013 0.278
NP_440806.1_1 Reverse -171 -189 7.29564 0.273
NP_441612.1_2 Reverse -18 -28 10.0983 0.21
NP_442903.1_2 Forward -173 -154 6.34979 0.18
NP_442342.1_9 Reverse -308 -324 3.79511 0.258
NP_441114.1_3 Reverse -33 -42 7.96454 0.231
NP_441114.1_3 Forward -39 -30 7.57121 0.231
NP_442724.1_1 Reverse -13 -23 17.5813 0.259
NP_441878.1_6 Reverse -31 -41 -7.49312 0.231
NP_441036.1_8 Forward -384 -374 5.28991 0.295
NP_441557.1_5 Forward -383 -374 0.491382 0.144
NP_441557.1_5 Reverse -374 -383 0.29472 0.174
NP_441739.1_2 Forward -106 -90 3.30278 0.281
NP_441308.1_8 Reverse -47 -57 7.94484 0.297
NP_441819.1_5 Reverse -135 -154 9.97848 0.261
NP_442347.1_2 Reverse -50 -59 4.62128 0.274
NP_442317.1_6 Reverse -164 -183 4.12936 0.247
NP_441633.1_3 Reverse -331 -344 -5.58558 0.236
NP_442998.1_10 Forward -381 -374 12.3305 0.0564
NP_440899.1_8 Forward -242 -223 -5.11376 0.231
NP_441799.1_1 Forward -387 -373 8.55376 0.112
NP_441362.1_2 Reverse -76 -95 4.12128 0.283
NP_441559.1_8 Forward -363 -349 -5.50694 0.264
NP_441559.1_8 Reverse -369 -383 -6.19526 0.275
NP_441559.1_8 Forward -45 -31 -6.98191 0.281
NP_440748.1_5 Reverse -34 -53 0.491109 0.25
NP_440677.1_1 Reverse -365 -384 10.6192 0.164
NP_442251.1_6 Forward -382 -375 9.77388 0.162
NP_440027.1_3 Reverse -25 -43 3.8533 0.263
NP_443051.1_1 Reverse -373 -382 0.0980582 0.226
NP_439937.1_9 Reverse -30 -47 -0.945159 0.122
NP_441789.1_7 Reverse -40 -59 -4.72118 0.288
NP_440267.1_2 Reverse -44 -58 5.50552 0.264
NP_442384.1_10 Forward -383 -370 4.54251 0.153
NP_442384.1_10 Reverse -49 -62 1.69091 0.249
NP_441018.1_7 Reverse -311 -330 6.39097 0.289
NP_442262.1_10 Forward -341 -334 8.59391 0.22
NP_441060.1_4 Reverse -1 -19 10.6389 0.171
NP_440189.1_2 Reverse -17 -36 -0.0988766 0.284
NP_440350.1_1 Forward -292 -273 -4.91709 0.264
NP_440700.1_8 Forward -297 -283 9.93102 0.299
NP_442892.1_9 Forward -35 -21 17.3052 0.226
NP_441771.1_8 Reverse -171 -190 13.0342 0.104
NP_440575.1_8 Forward -84 -65 2.75272 0.166
NP_441462.1_2 Forward -383 -373 0.766681 0.125
NP_441621.1_3 Forward -344 -326 20.5703 0.076
NP_443062.1_6 Forward -391 -372 0.392778 0.295
NP_442204.1_1 Reverse -370 -381 1.4353 0.271
NP_440516.1_8 Reverse -374 -383 5.80125 0.112
NP_440673.1_2 Forward -22 -3 8.341 0.273
NP_441052.1_2 Reverse -32 -42 2.14332 0.216
NP_441052.1_2 Reverse -374 -384 0.963343 0.255
NP_440436.1_4 Reverse -375 -384 4.32588 0.272
NP_442689.1_8 Forward -27 -10 -5.95935 0.279
NP_442689.1_8 Reverse -288 -305 -6.35267 0.281
NP_441409.1_6 Forward -389 -370 -10.1286 0.2
NP_440432.1_9 Forward -40 -25 -5.03498 0.233
NP_440474.1_8 Reverse -334 -348 9.93039 0.151
NP_440431.1_5 Forward -99 -80 7.37428 0.299
NP_442006.1_2 Reverse -23 -40 -17.5624 0.279
NP_441078.1_4 Reverse -374 -383 0.196389 0.205
NP_441078.1_4 Forward -383 -374 0.196389 0.205
NP_442729.1_4 Reverse -201 -220 13.9616 0.297
NP_441432.1_9 Forward -25 -12 10.1497 0.256
NP_441732.1_2 Reverse -370 -386 -16.7561 0.195
NP_440760.1_1 Reverse -374 -393 -15.9302 0.16
NP_441023.1_1 Forward -383 -365 12.5072 0.233
NP_441072.1_5 Reverse -362 -380 15.6538 0.287
NP_442400.1_10 Reverse -13 -26 9.80195 0.27
NP_442489.1_7 Forward -383 -374 0.884706 0.145
NP_442489.1_7 Reverse -374 -383 0.491382 0.178
NP_441659.2_8 Reverse -374 -384 4.99491 0.12
NP_441659.2_8 Forward -383 -373 1.65166 0.233
NP_441659.2_8 Reverse -249 -259 0.471689 0.264
NP_440426.1_7 Reverse -364 -383 2.3594 0.207
NP_442913.1_10 Forward -392 -373 -0.983855 0.165
NP_441040.1_2 Forward -117 -98 -15.1435 0.286
NP_442346.1_5 Reverse -373 -383 5.28991 0.253
NP_441943.1_8 Reverse -22 -41 -13.1769 0.261
NP_442900.1_2 Forward -392 -373 3.04771 0.285
NP_441833.1_4 Forward -382 -375 11.0522 0.0559
NP_441329.1_3 Reverse -16 -26 14.8103 0.25
NP_441112.1_8 Reverse -12 -31 8.25926 0.207
NP_442943.1_1 Forward -164 -149 7.98652 0.195
NP_442943.1_1 Forward -218 -203 3.67984 0.26
NP_442199.1_7 Reverse -4 -23 5.01354 0.223
NP_441609.1_1 Reverse -150 -169 -2.0655 0.278
NP_441671.1_10 Forward -353 -334 2.94938 0.244
NP_440875.1_9 Reverse -335 -345 12.6548 0.106
NP_440875.1_9 Forward -381 -371 6.91198 0.294
NP_440227.1_6 Forward -167 -153 19.9694 0.165
NP_441892.1_1 Forward -351 -334 5.05372 0.105
NP_440401.1_9 Reverse -53 -60 12.6251 0.287
NP_440374.1_1 Forward -62 -43 9.53756 0.292
NP_442479.1_5 Reverse -151 -170 6.90443 0.242
NP_441582.1_5 Forward -43 -24 4.32522 0.234
NP_442402.1_4 Forward -364 -345 -0.29631 0.189
NP_442402.1_4 Reverse -281 -300 -10.326 0.299
NP_441848.1_4 Forward -303 -287 9.84247 0.269
NP_440696.1_3 Forward -44 -26 3.75572 0.206
NP_441811.1_8 Forward -389 -375 6.09611 0.287
NP_442053.1_1 Reverse -374 -383 4.91628 0.218
NP_440505.1_3 Reverse -372 -382 6.17489 0.192
NP_441527.1_8 Forward -347 -328 11.2092 0.182
NP_440115.1_6 Reverse -371 -381 4.79825 0.282
NP_441347.1_3 Reverse -200 -218 18.6037 0.204
NP_441186.1_4 Reverse -17 -27 14.6309 0.295
NP_440670.1_8 Forward -383 -374 6.78456 0.099
NP_440670.1_8 Reverse -374 -383 6.19458 0.124
NP_442382.1_9 Forward -32 -13 10.1267 0.281
NP_442072.1_9 Reverse -246 -264 -22.9903 0.271
NP_442221.1_1 Reverse -275 -294 17.3057 0.165
NP_442615.1_1 Reverse -365 -383 -4.20908 0.18
NP_442357.1_5 Forward -301 -287 18.4858 0.165
NP_440492.1_4 Forward -163 -144 21.6346 0.0687
NP_441156.1_5 Forward -346 -336 16.9233 0.23
NP_440754.1_8 Forward -29 -10 17.6178 0.195
NP_441421.1_6 Reverse -8 -25 9.60133 0.297
NP_441237.1_9 Forward -40 -30 10.6981 0.22
NP_441237.1_9 Reverse -32 -42 9.61647 0.281
NP_442930.1_1 Reverse -74 -84 9.81266 0.28
NP_439911.1_4 Reverse -247 -266 17.0107 0.137
NP_441332.1_4 Forward -168 -149 5.30933 0.261
NP_442509.1_9 Reverse -49 -59 12.1726 0.101
NP_441489.1_3 Forward -302 -288 7.26901 0.276
NP_442582.1_3 Reverse -12 -26 19.0145 0.0839
NP_440554.1_4 Forward -382 -372 5.19158 0.158
NP_441885.1_5 Reverse -374 -384 1.84832 0.0957
NP_441428.1_8 Reverse -325 -344 3.14605 0.251
NP_440750.1_5 Reverse -11 -25 4.52282 0.294
NP_443000.1_7 Reverse -372 -382 0.865012 0.285
NP_441207.1_7 Reverse -10 -24 11.0948 0.249
NP_439962.1_8 Forward -44 -25 6.98095 0.247
NP_440216.1_1 Forward -383 -369 -11.8001 0.219
NP_440216.1_9 Reverse -5 -14 13.3727 0.197
NP_440172.1_1 Reverse -374 -384 3.32329 0.232
NP_440390.1_1 Reverse -155 -174 18.0924 0.161
NP_440305.1_1 Reverse -11 -25 20.1604 0.0286
NP_441766.1_2 Reverse -374 -383 3.83464 0.202
NP_441430.1_6 Forward -51 -32 11.0125 0.252
NP_440261.1_5 Forward -382 -369 -5.19226 0.188
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCATACAACTTATTGTTGAAGATCGCCTGGAAGATATTCGTCGAGGTTTACCTGAAGAGGCCATTGAAGAAACGATTCTAATTCCATGAAGCGTAAGGATTTAGAGAAAAAGTTGCGGCAGGCTGGTTGTTGTTTAAAGCAAGAAGGTGGCTCCCACTCTCTTTGGATTAATCCTACAACTGGAATTGTTGAAGCTGTGCCTCGACATACAGAAATCAAGGAGTTTTTAGCTCAAAAAATCCTTAAAAGTCTAGACGCAAAGTAGTCTTTTTGTTTCCACTGAATGACGCTGACGGTTAATCCCGTAAACTGGTCTGAAAATTTGGTAGCCTAGCAAAGCTGGGGGTTCACATTTTGGTGTGCATTGCCCCTTGGTTTTGTCAAATTTTTCGATGGTGTT

CDS

ATGGAAGTAGACGGTATTTGGTTGCGGTTAATCTGGTTGGACTATCGCTTAGCGGTCATCGTTTCTGTGTTTATCCCCTTGGTGCTGATCATTTGGTCGGCATTTAAGCGGGTGGATGCCATCAATCGCTTGCTAATTATCTATTGGCGCGTGGCCAGCCTGTTGGTGGTAACGGTTTATCTCCTGATTCCCGGCTGGTCATTGGCTTTCTTCACTGGTTTTGCCGCCCGTTGTCTAATTCCCATTAGTTTATGGTTTTGGGTGGACCTCAATGATGAAATCAAAGATTTACCCCCTTCTCCTTTGAAATTGGCCACCACCACTTGGCGATGGGCCATCACTATTTTTTCCTGCTTTGCCATCTTGGTAAATATTCCTTTCCTCTCCTGTGGGCTGAATGGCATTGGTGGGGCAGAAAGTTTCTGTCAGGTTTGGCTCCAGCCCCCTCTCCATTACAAGGCTTGGTTCCACGCTAATTCCAACACCGGATTTCTCGGCTTTTTGGGCATTGTGGGCCTAGTGGCCTATGTGATGTATTTCCTCTCTTTCCTGATTTTTCGTTTGGGTCGTCAAGGGCGATCGGCTCTGGATCATTAA

Protein

MEVDGIWLRLIWLDYRLAVIVSVFIPLVLIIWSAFKRVDAINRLLIIYWRVASLLVVTVYLLIPGWSLAFFTGFAARCLIPISLWFWVDLNDEIKDLPPSPLKLATTTWRWAITIFSCFAILVNIPFLSCGLNGIGGAESFCQVWLQPPLHYKAWFHANSNTGFLGFLGIVGLVAYVMYFLSFLIFRLGRQGRSALDH