Your browser is old and dusty. Try Google Chrome!

Details for sll0368

ORF sll0368
Accession NP_442335.1
Symbol
Category Interconversions and salvage of nucleosides and nucleotides
Definition uracil phosphoribosyltransferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -80 -94 15.4376 0.104
NP_441061.1_2 Forward -240 -226 2.35953 0.177
NP_440557.1_1 Forward -294 -275 4.52268 0.182
NP_442100.1_5 Forward -211 -197 19.1741 0.243
NP_442272.1_9 Reverse -308 -326 19.4878 0.0923
NP_441818.1_6 Reverse -279 -293 8.84938 0.274
NP_441818.1_9 Forward -381 -362 -3.24547 0.221
NP_441818.1_9 Forward -23 -4 -6.88371 0.266
NP_442169.1_1 Forward -373 -354 5.11266 0.26
NP_442173.1_1 Reverse -287 -295 8.18089 0.111
NP_442752.1_4 Forward -8 -1 7.90559 0.144
NP_442975.1_10 Forward -68 -54 5.60385 0.216
NP_440061.1_6 Forward -138 -120 14.473 0.202
NP_442062.1_8 Reverse -286 -296 7.64985 0.0911
NP_441859.1_3 Forward -349 -330 4.91521 0.211
NP_440304.1_4 Reverse -284 -294 8.33817 0.0811
NP_441935.1_1 Reverse -287 -306 10.4225 0.211
NP_441619.1_8 Reverse -178 -192 8.55376 0.238
NP_442276.1_2 Forward -58 -39 5.99764 0.291
NP_439957.1_9 Forward -132 -113 2.62561 0.3
NP_441738.1_2 Forward -293 -286 13.8051 0.0221
NP_441770.1_5 Forward -356 -337 -2.26216 0.285
NP_441025.1_6 Forward -134 -115 9.28929 0.15
NP_440438.2_8 Reverse -118 -137 3.73603 0.241
NP_440403.1_4 Forward -76 -57 -5.70374 0.22
NP_440842.1_4 Reverse -118 -137 1.42398 0.248
NP_440376.1_1 Reverse -286 -295 2.55633 0.218
NP_441857.1_6 Forward -326 -316 13.4514 0.282
NP_442687.1_7 Forward -209 -199 4.3066 0.255
NP_441846.1_10 Reverse -82 -101 -22.715 0.264
NP_442296.1_9 Forward -95 -76 -1.47551 0.204
NP_442658.1_1 Forward -297 -287 5.68278 0.258
NP_441414.1_9 Reverse -286 -305 -8.16202 0.23
NP_441256.1_1 Reverse -170 -189 -7.27704 0.239
NP_441958.1_5 Reverse -285 -295 -0.0199663 0.178
NP_442685.1_2 Reverse -24 -34 16.303 0.131
NP_440203.1_5 Forward -292 -282 11.6809 0.182
NP_441580.1_6 Reverse -4 -23 -8.45701 0.262
NP_442236.1_3 Reverse -190 -209 7.7676 0.248
NP_441654.1_7 Reverse -307 -326 10.597 0.299
NP_442431.1_10 Forward -384 -366 5.42735 0.201
NP_441398.1_5 Forward -84 -65 9.14423 0.258
NP_441041.1_4 Forward -372 -353 -13.7669 0.295
NP_439966.1_7 Forward -297 -287 10.1076 0.0968
NP_442941.1_3 Forward -294 -284 0.373358 0.212
NP_442049.1_10 Reverse -75 -94 5.211 0.289
NP_441556.1_7 Forward -306 -287 1.37531 0.287
NP_442982.1_5 Reverse -46 -65 -3.44213 0.298
NP_440929.1_8 Forward -295 -286 4.91628 0.162
NP_441346.1_6 Forward -377 -359 19.292 0.22
NP_441751.2_8 Forward -294 -280 -4.22864 0.166
NP_442142.1_4 Reverse -5 -18 7.68852 0.132
NP_443009.1_5 Reverse -285 -296 4.77807 0.23
NP_443009.1_5 Reverse -338 -349 4.48308 0.244
NP_440970.1_2 Reverse -136 -153 16.066 0.295
NP_441764.1_4 Forward -137 -120 17.7164 0.0666
NP_440051.1_4 Reverse -56 -75 20.059 0.113
NP_442227.1_2 Forward -96 -77 -3.73712 0.295
NP_443058.1_9 Reverse -153 -171 12.7038 0.189
NP_440789.1_1 Reverse -118 -137 19.4681 0.0556
NP_442808.1_1 Forward -296 -286 0.864583 0.3
NP_442775.1_1 Reverse -73 -92 10.5209 0.288
NP_440145.1_4 Reverse -317 -327 15.0242 0.231
NP_442820.1_9 Reverse -345 -363 5.52568 0.262
NP_442542.1_2 Forward -163 -150 10.2457 0.127
NP_441114.1_3 Forward -347 -338 6.39124 0.277
NP_440923.1_5 Reverse -5 -24 18.8781 0.247
NP_441590.1_4 Reverse -7 -26 2.9486 0.29
NP_440101.1_3 Forward -178 -159 5.11266 0.202
NP_441458.1_8 Reverse -131 -150 6.23263 0.251
NP_442183.1_1 Reverse -286 -300 13.3726 0.0437
NP_440356.1_10 Forward -87 -69 11.8189 0.253
NP_442444.1_9 Reverse -272 -291 12.4875 0.254
NP_442645.1_2 Forward -243 -224 -15.8318 0.213
NP_442888.1_6 Reverse -209 -228 4.81767 0.228
NP_442317.1_6 Reverse -334 -353 9.3409 0.211
NP_441633.1_3 Reverse -66 -79 -7.06055 0.288
NP_442998.1_5 Forward -356 -346 8.4365 0.263
NP_442998.1_10 Forward -293 -286 6.23397 0.157
NP_442333.2_5 Reverse -4 -23 -6.58872 0.227
NP_440256.1_1 Reverse -283 -302 1.0811 0.0789
NP_440256.1_1 Reverse -216 -235 -9.14533 0.275
NP_440256.1_1 Forward -189 -170 -10.227 0.297
NP_441229.1_4 Forward -88 -69 14.0608 0.293
NP_441559.1_4 Forward -26 -7 8.45592 0.102
NP_441559.1_8 Reverse -159 -173 -3.54032 0.205
NP_442302.1_8 Reverse -229 -248 17.5024 0.252
NP_440915.1_6 Forward -167 -153 -3.34366 0.293
NP_440717.1_3 Reverse -2 -16 7.27547 0.28
NP_441704.1_2 Reverse -370 -389 9.53674 0.157
NP_442993.1_1 Reverse -339 -355 -10.0696 0.206
NP_442386.1_9 Reverse -14 -23 8.06244 0.209
NP_442386.1_9 Forward -296 -287 6.88247 0.219
NP_441340.1_5 Reverse -287 -294 3.97235 0.274
NP_442791.1_4 Forward -232 -213 11.7008 0.292
NP_442506.1_2 Reverse -275 -294 4.916 0.269
NP_440586.1_9 Reverse -76 -95 6.39097 0.287
NP_441262.1_3 Reverse -286 -293 11.5438 0.0584
NP_440027.1_3 Reverse -5 -23 7.88485 0.202
NP_443051.1_1 Reverse -285 -294 6.78456 0.071
NP_439937.1_8 Forward -22 -3 -4.03212 0.276
NP_440770.1_4 Reverse -172 -191 19.5673 0.193
NP_440316.1_10 Reverse -83 -93 12.6647 0.214
NP_441803.1_2 Reverse -3 -22 7.47261 0.136
NP_441803.1_2 Forward -240 -221 0.786102 0.244
NP_442121.1_4 Forward -183 -164 -4.6221 0.27
NP_441877.1_9 Reverse -117 -134 4.3654 0.284
NP_441689.1_5 Reverse -284 -294 5.48612 0.251
NP_442244.1_7 Forward -373 -354 15.0441 0.187
NP_440282.1_3 Reverse -208 -227 0.0977854 0.281
NP_440531.1_6 Reverse -66 -85 -3.73712 0.27
NP_440487.1_1 Forward -208 -189 3.6377 0.13
NP_441896.1_1 Reverse -118 -137 7.57013 0.263
NP_441103.1_9 Forward -62 -52 13.0755 0.27
NP_440937.1_5 Reverse -193 -212 9.53756 0.275
NP_440999.1_9 Reverse -315 -329 5.1128 0.113
NP_440888.1_4 Forward -221 -207 18.2765 0.129
NP_442710.1_7 Forward -142 -123 -2.51336 0.243
NP_442315.1_2 Forward -28 -16 12.6253 0.291
NP_441621.1_7 Forward -297 -283 -4.52363 0.232
NP_442204.1_1 Reverse -282 -293 1.14031 0.28
NP_442780.1_1 Forward -133 -114 8.35759 0.273
NP_442872.1_1 Reverse -352 -371 -11.5053 0.249
NP_440516.1_8 Reverse -286 -295 -0.295266 0.232
NP_440783.1_5 Forward -234 -215 1.27776 0.19
NP_440673.1_3 Reverse -341 -348 10.5605 0.123
NP_441893.1_8 Forward -231 -212 17.3057 0.192
NP_441004.1_1 Forward -82 -63 -9.24366 0.206
NP_441004.1_1 Forward -29 -10 -13.4719 0.257
NP_441004.1_1 Reverse -75 -94 -16.5201 0.286
NP_440296.1_6 Reverse -134 -152 15.3762 0.283
NP_440296.1_10 Reverse -161 -180 -13.8652 0.269
NP_441851.1_6 Forward -137 -118 22.0909 0.0464
NP_441501.1_9 Forward -297 -278 15.5349 0.214
NP_442515.1_1 Forward -209 -195 -0.492064 0.224
NP_440593.1_9 Reverse -149 -163 8.65272 0.255
NP_440463.1_7 Reverse -151 -165 16.4209 0.239
NP_440940.1_7 Forward -87 -69 3.26332 0.274
NP_440726.1_2 Forward -99 -80 3.14605 0.243
NP_442335.1_7 Forward -294 -280 14.6503 0.204
NP_442006.1_2 Reverse -217 -234 -13.9242 0.198
NP_441432.1_8 Reverse -285 -294 4.42462 0.213
NP_442320.1_8 Forward -301 -287 -4.7203 0.185
NP_442320.1_9 Forward -27 -13 13.7659 0.246
NP_440913.1_3 Reverse -5 -18 13.294 0.298
NP_442489.1_7 Reverse -286 -295 -1.86856 0.259
NP_441022.1_1 Reverse -23 -32 10.8747 0.284
NP_442849.1_1 Forward -79 -65 10.1277 0.207
NP_442346.1_1 Forward -23 -4 12.9791 0.27
NP_442346.1_5 Forward -349 -339 9.22315 0.118
NP_441856.1_8 Reverse -212 -231 11.8975 0.274
NP_441923.1_6 Reverse -85 -99 7.76774 0.298
NP_440847.1_3 Reverse -7 -21 13.1753 0.219
NP_441888.1_7 Forward -168 -154 2.2612 0.225
NP_441888.1_7 Forward -97 -83 2.16287 0.225
NP_441895.1_2 Reverse -75 -94 -26.4516 0.24
NP_442162.1_9 Reverse -287 -294 9.28223 0.0694
NP_440671.1_4 Reverse -280 -294 9.34103 0.184
NP_441259.1_8 Forward -167 -148 12.7816 0.254
NP_440590.1_4 Forward -23 -10 -1.16069 0.212
NP_441239.1_9 Forward -297 -285 12.9203 0.0402
NP_441727.1_3 Reverse -332 -351 2.65439 0.299
NP_441541.1_1 Forward -136 -118 10.6971 0.0858
NP_441617.1_6 Forward -326 -307 -4.03212 0.265
NP_440546.1_8 Forward -165 -151 19.4691 0.237
NP_440868.1_4 Reverse -282 -294 2.79224 0.148
NP_442499.1_3 Reverse -145 -163 11.6222 0.204
NP_441249.1_8 Forward -222 -203 0.884433 0.284
NP_441084.1_6 Forward -350 -336 14.7737 0.0972
NP_442039.1_4 Reverse -287 -294 10.8555 0.109
NP_442380.1_10 Forward -24 -6 9.16393 0.262
NP_440160.1_1 Forward -139 -120 20.9652 0.0145
NP_440505.1_3 Reverse -284 -294 10.5014 0.105
NP_440505.1_7 Reverse -160 -179 5.89931 0.179
NP_441102.1_1 Forward -294 -275 6.29264 0.246
NP_440207.2_8 Forward -240 -221 13.9625 0.293
NP_442532.1_7 Reverse -286 -300 3.34284 0.201
NP_440009.1_4 Reverse -203 -222 8.35759 0.299
NP_440914.1_1 Reverse -15 -25 10.3717 0.142
NP_441482.1_7 Reverse -280 -294 -4.13031 0.147
NP_439944.1_9 Forward -347 -337 5.19158 0.27
NP_441028.1_6 Reverse -168 -178 12.6642 0.183
NP_441028.1_6 Forward -62 -52 12.6642 0.183
NP_441680.1_4 Reverse -359 -378 1.47442 0.246
NP_441602.1_3 Forward -29 -10 3.44104 0.175
NP_441106.1_3 Reverse -116 -135 12.3892 0.217
NP_442588.1_6 Reverse -80 -99 -1.7705 0.278
NP_441385.1_1 Forward -324 -309 14.4346 0.28
NP_440670.1_8 Reverse -286 -295 12.7828 0.0236
NP_441886.1_1 Reverse -187 -206 11.7008 0.0812
NP_440886.1_7 Forward -296 -286 5.09279 0.201
NP_442382.1_9 Reverse -160 -179 7.66846 0.29
NP_442213.1_5 Forward -28 -9 -0.885524 0.293
NP_441808.1_8 Forward -26 -7 11.9958 0.219
NP_441808.1_8 Forward -378 -359 6.58763 0.285
NP_441021.1_1 Reverse -340 -359 -11.8986 0.275
NP_441463.1_3 Forward -305 -286 -9.83364 0.286
NP_441463.1_6 Forward -350 -336 5.93276 0.287
NP_442467.1_3 Forward -29 -15 18.8541 0.146
NP_441962.1_4 Forward -353 -334 -4.13045 0.156
NP_440855.1_1 Forward -26 -7 3.83436 0.188
NP_442647.1_7 Reverse -10 -23 12.704 0.214
NP_441993.1_1 Reverse -231 -250 1.4594 0.276
NP_440114.1_10 Reverse -339 -353 8.65272 0.198
NP_440114.1_10 Reverse -286 -300 6.6861 0.26
NP_441510.2_6 Reverse -154 -173 11.7983 0.3
NP_440502.1_3 Forward -62 -52 14.6665 0.209
NP_442509.1_4 Forward -96 -77 17.6007 0.237
NP_440524.1_2 Reverse -221 -240 -2.85214 0.27
NP_440554.1_4 Forward -294 -284 3.61828 0.222
NP_441275.1_1 Reverse -117 -135 11.7205 0.0476
NP_442341.1_7 Forward -209 -195 1.47456 0.288
NP_440191.1_4 Forward -61 -51 15.3781 0.254
NP_443046.1_9 Forward -344 -326 2.57501 0.278
NP_439962.1_4 Forward -239 -220 -6.98204 0.286
NP_439962.1_4 Forward -100 -81 -8.26035 0.292
NP_441105.1_3 Reverse -328 -347 -10.0303 0.3
NP_440249.1_2 Forward -262 -252 13.9425 0.29
NP_441226.1_7 Forward -228 -221 6.82361 0.246
NP_441226.1_7 Reverse -220 -227 6.82361 0.246
NP_441766.1_2 Forward -295 -286 2.94966 0.245
NP_442969.1_4 Forward -160 -141 5.01433 0.274
NP_440416.1_9 Reverse -73 -92 -21.3384 0.294
NP_443052.1_8 Forward -355 -336 -13.4719 0.286
NP_443052.1_9 Forward -103 -84 -4.52377 0.258
NP_443052.1_9 Reverse -4 -23 -6.78538 0.289
NP_440591.1_9 Reverse -179 -197 5.03403 0.258
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCTGATTCACTAATTTACCGGTGTTCATGCCGTTATTGATGGAATGGGAAGAAGCAATGGTCACAATAAACTGGAGGTTATGGGTATGTTTTTTAGCCCTAATGCTCCAATCGCCTTGATTGTATCGAATGATGCAGTCTCTAAAATTGTATCCGTAAAAGACCTCTGCACCGCCGACGGGTCTGGATTATGGGCAATAATCACAGTCGAGCCAGACTACCCCTGGAGGTAAACTCCGGGGCTGGAGCCATAAAGATTAGGAATTCATTAAGAAATGTAACAATCGACGTTCTAGATCATACCACGCCCCCACTGTCCGGCAGGGTGAACAGAGGAGACTTTCCCCTGTTACAGTGTCAGTGACAAAACAACTTTTTGGCATCGGTGCAGGTGGTGAGCC

CDS

ATGGCGGCCCAGATCATTGAAATTCTTTCCCCGGAGGAAATCCGACGTACCCTTACCCGTCTGGCTTCCCAGGTAATTGAGAAAAATAGTGACCTGTCGGAGTTGGTCTTACTGGGGATCTACACCAGGGGAGTACCCCTCGCCCATCAGCTTGCCCAGCAAATTGAAATGTTGGAACAAGTTAAAGTCCCCGTTGGGGCGATCGATGTGACTCTCTACCGGGACGATTTAAAACGGATCAAAACCCGCACCCCGGCTAAAACCAAAATTCCCCTCAGTTTGACTGGCAAAAGGGTTGTATTGGTGGATGACGTAATTTATAAAGGCCGCACTATCCGGGCGGCACTCAATGCGGTGACAGAATATGGTCGTCCCCAGGTAATTCGTTTATTAACTTTGGTAGACCGGGGTCATCGAGAGTTACCCATCCATCCTGATTTTGTTGGCAAAATCCTGCCTACAGCGGCGGAGGAACAGGTGAAAGTATATTTACAGGATCCCGATGGTCGGGACACGGTGGAGTTAATTAAAGGTTAA

Protein

MAAQIIEILSPEEIRRTLTRLASQVIEKNSDLSELVLLGIYTRGVPLAHQLAQQIEMLEQVKVPVGAIDVTLYRDDLKRIKTRTPAKTKIPLSLTGKRVVLVDDVIYKGRTIRAALNAVTEYGRPQVIRLLTLVDRGHRELPIHPDFVGKILPTAAEEQVKVYLQDPDGRDTVELIKG