Your browser is old and dusty. Try Google Chrome!

Details for sll0364

ORF sll0364
Accession NP_441842.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -254 -240 9.14437 0.0795
NP_441061.1_2 Forward -296 -282 2.06454 0.179
NP_441061.1_2 Reverse -177 -191 -1.77037 0.272
NP_440795.1_7 Forward -296 -289 14.6904 0.0123
NP_440795.1_7 Reverse -289 -296 14.6904 0.0123
NP_441418.1_6 Forward -297 -278 -1.67217 0.0147
NP_441418.1_6 Reverse -288 -307 -20.3551 0.111
NP_441418.1_6 Reverse -333 -352 -28.2215 0.203
NP_442657.1_1 Reverse -9 -26 13.994 0.196
NP_440815.1_6 Forward -22 -3 14.9348 0.212
NP_442291.1_5 Forward -72 -56 4.58176 0.0889
NP_441453.1_4 Reverse -288 -296 16.539 0.00633
NP_441453.1_4 Forward -297 -289 16.539 0.00633
NP_441453.1_4 Reverse -62 -70 7.19758 0.0757
NP_441453.1_4 Forward -71 -63 6.80426 0.121
NP_441453.1_7 Forward -253 -246 11.6422 0.298
NP_442151.1_6 Forward -297 -283 19.4691 0.0045
NP_442151.1_6 Reverse -288 -302 18.1908 0.00782
NP_441818.1_1 Forward -296 -285 9.79292 0.232
NP_441818.1_9 Forward -161 -142 -0.39387 0.196
NP_441818.1_9 Forward -155 -136 -4.03212 0.234
NP_441818.1_9 Reverse -210 -229 -10.227 0.292
NP_440226.1_1 Forward -297 -278 6.58763 0.125
NP_440226.1_1 Forward -71 -52 6.09597 0.137
NP_440226.1_1 Reverse -288 -307 5.80098 0.145
NP_441630.1_3 Reverse -280 -299 7.57094 0.122
NP_442623.1_3 Reverse -289 -308 -10.4236 0.181
NP_442623.1_3 Forward -296 -277 -18.1918 0.263
NP_442623.1_3 Reverse -63 -82 -19.2734 0.284
NP_441098.1_3 Reverse -4 -23 -4.10925 0.28
NP_441098.1_3 Forward -35 -16 -7.36319 0.288
NP_440150.1_6 Forward -287 -268 3.6377 0.245
NP_440996.1_4 Forward -368 -358 17.5813 0.15
NP_442655.1_1 Reverse -283 -302 0.687771 0.24
NP_443002.1_5 Reverse -177 -195 10.2448 0.259
NP_442173.1_1 Forward -296 -288 15.4574 0.00633
NP_442173.1_1 Reverse -289 -297 15.4574 0.00633
NP_442173.1_1 Forward -70 -62 7.68924 0.142
NP_442173.1_1 Reverse -63 -71 5.72262 0.203
NP_442173.1_1 Forward -66 -58 5.0343 0.24
NP_442752.1_4 Forward -297 -290 13.8055 0.0199
NP_442752.1_4 Reverse -288 -295 13.8055 0.0199
NP_442752.1_4 Forward -71 -64 13.8055 0.0199
NP_442752.1_4 Forward -155 -148 7.6106 0.151
NP_442752.1_4 Forward -281 -274 4.95566 0.26
NP_443027.1_4 Forward -299 -289 7.25653 0.24
NP_441812.1_3 Forward -72 -58 10.6193 0.222
NP_442975.1_10 Forward -301 -287 10.8154 0.0516
NP_442975.1_10 Reverse -284 -298 10.5204 0.0541
NP_442975.1_10 Reverse -329 -343 5.60385 0.216
NP_442975.1_10 Reverse -58 -72 1.47397 0.297
NP_440784.1_7 Forward -296 -289 15.9687 0.0123
NP_440784.1_7 Reverse -289 -296 15.9687 0.0123
NP_440784.1_7 Forward -70 -63 6.23397 0.241
NP_440784.1_7 Reverse -63 -70 6.13563 0.241
NP_440061.1_9 Forward -299 -285 11.897 0.105
NP_440061.1_9 Reverse -270 -284 11.602 0.107
NP_440061.1_9 Forward -398 -384 8.25877 0.177
NP_441054.1_2 Reverse -36 -55 9.93088 0.284
NP_441054.1_4 Forward -77 -59 -0.7675 0.187
NP_441145.1_10 Forward -209 -190 19.3707 0.15
NP_441476.1_5 Reverse -145 -164 -5.99873 0.271
NP_442074.1_5 Forward -221 -202 16.5191 0.237
NP_440878.1_9 Reverse -278 -297 -2.75381 0.276
NP_442062.1_3 Reverse -6 -25 -2.95047 0.273
NP_442062.1_8 Forward -297 -287 17.3846 0.00193
NP_442062.1_8 Reverse -288 -298 10.3048 0.0493
NP_442062.1_8 Forward -71 -61 7.55152 0.0946
NP_442062.1_8 Reverse -62 -72 5.09324 0.184
NP_442062.1_8 Reverse -58 -68 2.83163 0.293
NP_440304.1_4 Forward -299 -289 10.8948 0.051
NP_440304.1_4 Forward -278 -268 4.79825 0.246
NP_440304.1_4 Reverse -286 -296 1.84832 0.299
NP_442242.1_4 Forward -296 -289 14.3954 0.0124
NP_442242.1_4 Reverse -289 -296 14.3954 0.0124
NP_442242.1_4 Reverse -63 -70 10.8555 0.127
NP_440044.1_8 Forward -296 -277 -1.18052 0.238
NP_440044.1_8 Reverse -63 -82 -2.55715 0.264
NP_440044.1_8 Forward -70 -51 -2.95047 0.274
NP_439918.1_3 Reverse -285 -304 10.3242 0.249
NP_441200.1_4 Reverse -296 -315 10.2259 0.204
NP_441200.1_4 Reverse -223 -242 6.98095 0.272
NP_441208.1_9 Reverse -285 -299 8.65272 0.219
NP_442110.1_7 Reverse -288 -302 12.3893 0.0586
NP_442110.1_7 Forward -297 -283 9.63603 0.0715
NP_442110.1_7 Reverse -333 -347 1.17956 0.236
NP_442259.1_10 Reverse -262 -280 13.9821 0.105
NP_440856.1_4 Forward -328 -309 4.916 0.0969
NP_440856.1_4 Forward -304 -285 -0.39387 0.177
NP_441083.1_5 Forward -297 -287 20.3345 0.00053
NP_441083.1_5 Reverse -288 -298 11.2881 0.0159
NP_441083.1_5 Reverse -62 -72 1.74999 0.198
NP_442827.1_8 Reverse -280 -299 11.2084 0.0546
NP_441738.1_2 Forward -295 -288 15.28 0.0102
NP_441738.1_2 Reverse -290 -297 15.28 0.0102
NP_441738.1_2 Reverse -64 -71 15.28 0.0102
NP_441558.1_5 Forward -299 -280 6.78429 0.202
NP_440209.1_1 Reverse -288 -296 18.1123 0.00295
NP_440209.1_1 Forward -297 -289 18.1123 0.00295
NP_440209.1_1 Forward -71 -63 8.57422 0.0425
NP_440209.1_1 Reverse -62 -70 5.32929 0.139
NP_442889.1_8 Forward -300 -286 9.43874 0.0989
NP_440808.1_8 Reverse -331 -350 17.699 0.0735
NP_440447.1_1 Forward -302 -284 3.65739 0.251
NP_441713.1_1 Forward -303 -284 -15.9302 0.275
NP_441770.1_4 Reverse -379 -398 3.83436 0.12
NP_441716.1_1 Forward -297 -283 6.6861 0.191
NP_441716.1_1 Forward -155 -141 4.03116 0.259
NP_442111.1_4 Reverse -287 -301 20.3541 0.00311
NP_442111.1_4 Forward -298 -284 7.07942 0.105
NP_440343.1_9 Forward -165 -146 7.27595 0.284
NP_440906.1_5 Forward -296 -289 15.8704 0.0124
NP_440906.1_5 Reverse -289 -296 15.8704 0.0124
NP_440906.1_5 Forward -70 -63 6.23397 0.234
NP_440906.1_5 Reverse -63 -70 6.13563 0.241
NP_440747.1_10 Forward -300 -288 15.2803 0.0019
NP_440747.1_10 Reverse -285 -297 14.9853 0.00221
NP_440747.1_10 Forward -74 -62 -4.58258 0.109
NP_440747.1_10 Reverse -59 -71 -12.1541 0.227
NP_440747.1_10 Forward -252 -240 -12.2524 0.254
NP_442973.1_5 Forward -306 -287 16.2241 0.103
NP_441486.1_1 Reverse -285 -299 15.4376 0.00596
NP_441486.1_1 Forward -300 -286 6.19444 0.0344
NP_441486.1_1 Forward -74 -60 -2.45868 0.175
NP_441486.1_1 Reverse -59 -73 -5.01529 0.218
NP_442145.1_4 Forward -24 -5 2.33913 0.299
NP_442634.1_4 Reverse -286 -300 -1.27871 0.149
NP_442634.1_4 Reverse -331 -345 -3.83532 0.17
NP_441265.1_3 Forward -303 -289 2.94952 0.181
NP_441667.1_1 Forward -25 -10 14.303 0.284
NP_440470.1_5 Reverse -17 -36 7.78217 0.269
NP_440403.1_4 Forward -290 -271 -9.047 0.268
NP_440842.1_10 Reverse -243 -257 3.53951 0.255
NP_442848.1_1 Reverse -282 -296 -0.688726 0.263
NP_442848.1_5 Forward -244 -226 -2.63579 0.286
NP_443018.1_3 Forward -296 -289 14.8871 0.0123
NP_443018.1_3 Reverse -289 -296 14.8871 0.0123
NP_443018.1_3 Forward -70 -63 12.6255 0.0471
NP_443018.1_3 Reverse -63 -70 5.25066 0.214
NP_441634.1_9 Reverse -262 -281 10.4217 0.252
NP_440376.1_1 Forward -297 -288 19.4693 0.000692
NP_440376.1_1 Reverse -288 -297 19.4693 0.000692
NP_440376.1_1 Forward -249 -240 1.57302 0.246
NP_440376.1_1 Forward -283 -274 0.196389 0.283
NP_440376.1_1 Forward -71 -62 -0.000272808 0.285
NP_440376.1_1 Reverse -62 -71 -0.0986038 0.285
NP_440376.1_1 Forward -92 -83 -0.393597 0.289
NP_441588.1_4 Reverse -64 -74 18.1713 0.0143
NP_441588.1_4 Forward -295 -285 8.92815 0.14
NP_441588.1_4 Reverse -290 -300 7.05986 0.178
NP_442687.1_7 Forward -298 -288 9.02648 0.0994
NP_442687.1_7 Reverse -287 -297 8.92815 0.0994
NP_442687.1_7 Reverse -211 -221 6.07655 0.179
NP_442191.1_4 Forward -104 -90 12.7383 0.192
NP_442191.1_4 Forward -290 -276 11.187 0.268
NP_441013.1_2 Reverse -277 -295 -3.12744 0.289
NP_440667.1_2 Reverse -210 -229 -8.65367 0.29
NP_441950.1_7 Forward -191 -172 1.37609 0.175
NP_442658.1_1 Forward -299 -289 13.0576 0.04
NP_442658.1_1 Reverse -202 -212 8.3377 0.199
NP_442658.1_1 Reverse -286 -296 6.76441 0.214
NP_442658.1_1 Reverse -331 -341 6.17443 0.235
NP_441855.2_4 Forward -305 -286 11.2584 0.221
NP_442782.1_2 Reverse -41 -55 8.84938 0.198
NP_442544.1_2 Reverse -280 -294 -0.0987402 0.217
NP_440184.1_1 Forward -32 -13 4.88593 0.22
NP_441487.1_9 Reverse -263 -282 -0.590531 0.259
NP_442321.1_1 Forward -299 -280 -4.13045 0.214
NP_441958.1_5 Forward -298 -288 21.2195 0.000805
NP_441958.1_5 Reverse -287 -297 12.2714 0.00183
NP_441958.1_5 Reverse -61 -71 1.65166 0.0872
NP_441958.1_5 Forward -72 -62 1.55333 0.095
NP_441127.1_1 Forward -215 -201 10.1277 0.259
NP_442486.1_6 Forward -354 -335 -3.3438 0.266
NP_442836.1_10 Reverse -165 -175 10.4031 0.269
NP_440203.1_5 Reverse -291 -301 13.4509 0.115
NP_440203.1_5 Forward -294 -284 13.3526 0.116
NP_440269.1_1 Forward -161 -143 15.3588 0.286
NP_440984.1_7 Reverse -283 -297 11.6026 0.122
NP_440984.1_7 Forward -302 -288 9.73436 0.127
NP_439990.1_5 Forward -302 -289 8.08242 0.181
NP_442690.1_1 Reverse -17 -36 -9.24366 0.195
NP_442690.1_1 Forward -371 -352 -15.3402 0.28
NP_442690.1_1 Reverse -7 -26 -15.7335 0.28
NP_442911.1_2 Forward -307 -288 5.99764 0.0305
NP_442911.1_2 Reverse -278 -297 -10.6203 0.284
NP_440153.1_5 Forward -296 -282 3.93283 0.199
NP_443055.1_6 Reverse -69 -87 -0.374908 0.259
NP_443055.1_6 Reverse -274 -292 -0.473239 0.261
NP_440993.1_2 Forward -347 -331 6.64671 0.21
NP_440993.1_2 Forward -302 -286 3.69678 0.256
NP_440993.1_3 Forward -307 -288 9.43841 0.124
NP_440602.1_2 Forward -76 -57 7.47261 0.226
NP_442210.1_9 Reverse -284 -302 12.1139 0.209
NP_441099.1_5 Reverse -278 -297 -11.8003 0.29
NP_441654.1_7 Forward -53 -34 15.9216 0.155
NP_441294.1_7 Reverse -284 -298 13.6661 0.0583
NP_441294.1_7 Forward -301 -287 9.15464 0.256
NP_441646.1_1 Forward -304 -285 -1.96717 0.298
NP_442438.1_10 Reverse -283 -297 8.35772 0.0782
NP_442438.1_10 Forward -302 -288 1.76955 0.188
NP_442431.1_10 Forward -158 -140 6.41066 0.191
NP_442431.1_10 Forward -170 -152 6.31233 0.194
NP_441456.1_6 Forward -125 -106 9.93088 0.294
NP_441000.1_6 Forward -72 -58 -5.70361 0.29
NP_442771.1_1 Reverse -331 -349 -9.32229 0.223
NP_440147.1_4 Forward -299 -286 12.999 0.0326
NP_440147.1_4 Reverse -286 -299 10.8357 0.0353
NP_440147.1_4 Forward -73 -60 7.00078 0.0778
NP_440147.1_4 Reverse -56 -69 4.8375 0.146
NP_441550.1_8 Forward -299 -289 15.3192 0.0132
NP_441550.1_8 Reverse -286 -296 14.6309 0.0132
NP_441550.1_8 Forward -73 -63 5.38779 0.252
NP_441916.1_7 Reverse -288 -298 18.9579 0.00144
NP_441916.1_7 Forward -297 -287 10.3048 0.0261
NP_441916.1_7 Reverse -62 -72 7.74818 0.0608
NP_441916.1_7 Forward -71 -61 7.15819 0.0745
NP_441916.1_7 Forward -67 -57 4.89658 0.154
NP_441916.1_10 Forward -350 -331 2.94938 0.236
NP_441041.1_4 Reverse -333 -352 -6.98204 0.179
NP_441041.1_4 Forward -297 -278 -12.7836 0.274
NP_441041.1_7 Forward -300 -288 14.4144 0.0348
NP_442396.1_5 Reverse -223 -236 7.09911 0.215
NP_442004.1_6 Forward -297 -283 8.75105 0.14
NP_442004.1_6 Reverse -288 -302 3.8345 0.231
NP_441725.1_4 Forward -314 -300 8.16044 0.205
NP_441725.1_4 Forward -302 -288 3.93223 0.278
NP_441725.1_4 Reverse -57 -71 3.93223 0.278
NP_441725.1_5 Forward -296 -286 2.04498 0.115
NP_441725.1_5 Reverse -289 -299 1.94665 0.115
NP_441725.1_8 Reverse -143 -162 7.17762 0.296
NP_439966.1_7 Reverse -286 -296 7.25606 0.15
NP_439966.1_7 Forward -299 -289 6.27276 0.185
NP_440736.1_6 Reverse -351 -370 11.7992 0.293
NP_442941.1_3 Forward -296 -286 11.0914 0.0116
NP_442941.1_3 Reverse -289 -299 11.0914 0.0116
NP_442941.1_3 Forward -70 -60 6.96153 0.0903
NP_442941.1_3 Reverse -63 -73 1.25834 0.15
NP_440289.1_2 Forward -300 -287 -4.89726 0.294
NP_440983.1_5 Reverse -240 -259 -4.6221 0.26
NP_441076.1_8 Reverse -358 -371 17.9155 0.246
NP_440260.1_8 Reverse -279 -297 -4.8974 0.273
NP_441514.1_6 Reverse -299 -306 12.8221 0.252
NP_442281.1_1 Forward -302 -288 17.6002 0.00542
NP_442281.1_1 Forward -76 -62 10.5204 0.0576
NP_442281.1_1 Reverse -283 -297 8.94708 0.0747
NP_442281.1_1 Reverse -53 -67 5.30886 0.163
NP_441334.1_7 Forward -299 -280 -2.55715 0.0713
NP_441334.1_7 Reverse -286 -305 -19.9617 0.275
NP_442172.1_1 Reverse -7 -26 12.3837 0.237
NP_442256.1_2 Reverse -286 -304 0.904127 0.115
NP_442256.1_2 Forward -299 -281 -5.09406 0.214
NP_442256.1_2 Reverse -60 -78 -9.22396 0.254
NP_440437.1_1 Forward -303 -284 0.294447 0.172
NP_442012.1_1 Forward -303 -284 12.7825 0.0664
NP_442012.1_1 Reverse -282 -301 7.66927 0.108
NP_441556.1_7 Forward -106 -87 -1.08295 0.3
NP_441556.1_10 Reverse -283 -297 17.8141 0.0841
NP_440498.1_1 Forward -351 -333 -1.06249 0.222
NP_442982.1_5 Forward -307 -288 7.86593 0.12
NP_440375.1_8 Reverse -63 -82 -0.39387 0.266
NP_441644.1_6 Reverse -288 -298 19.0557 0.000803
NP_441644.1_6 Forward -297 -287 17.3841 0.00127
NP_441644.1_6 Reverse -317 -327 8.43603 0.0998
NP_441644.1_6 Reverse -62 -72 6.0761 0.167
NP_441644.1_6 Reverse -333 -343 3.8145 0.261
NP_443049.1_6 Forward -72 -62 12.3241 0.24
NP_440867.1_10 Forward -222 -203 3.83436 0.283
NP_442215.1_2 Reverse -286 -302 18.2498 0.013
NP_442215.1_2 Forward -299 -283 9.00665 0.0605
NP_442177.1_5 Reverse -336 -350 8.35772 0.278
NP_442029.1_6 Reverse -283 -302 11.1109 0.166
NP_442029.1_6 Reverse -234 -253 7.66927 0.223
NP_442029.1_6 Forward -302 -283 6.29264 0.242
NP_442247.1_7 Reverse -285 -304 18.7807 0.0348
NP_440929.1_8 Forward -297 -288 19.2726 0.000701
NP_440929.1_8 Reverse -288 -297 19.2726 0.000701
NP_440780.1_1 Forward -30 -11 13.7982 0.234
NP_442933.1_10 Forward -297 -288 17.601 0.00325
NP_442933.1_10 Reverse -288 -297 17.601 0.00325
NP_442933.1_10 Reverse -62 -71 15.1427 0.00958
NP_442933.1_10 Forward -71 -62 7.96454 0.0937
NP_442933.1_10 Forward -67 -58 5.40793 0.19
NP_441751.2_8 Reverse -63 -77 -5.40861 0.206
NP_442554.1_8 Reverse -289 -299 16.4013 0.0065
NP_442554.1_8 Forward -296 -286 15.3197 0.00882
NP_442554.1_8 Reverse -63 -73 5.48657 0.146
NP_442075.1_1 Forward -292 -273 6.4893 0.269
NP_441762.1_7 Forward -298 -286 0.530633 0.0747
NP_441762.1_7 Reverse -287 -299 0.333971 0.0747
NP_441762.1_7 Reverse -61 -73 -7.53251 0.293
NP_442142.1_4 Forward -300 -287 11.6217 0.054
NP_442142.1_4 Forward -74 -61 5.91857 0.178
NP_442142.1_4 Reverse -143 -156 4.73861 0.212
NP_442142.1_4 Forward -390 -377 4.05029 0.234
NP_442142.1_4 Reverse -285 -298 3.65697 0.248
NP_442292.1_1 Forward -296 -287 18.486 0.00229
NP_442292.1_1 Reverse -289 -298 17.5026 0.00435
NP_442292.1_1 Reverse -63 -72 8.65285 0.0335
NP_441711.1_4 Reverse -279 -298 3.44104 0.245
NP_441523.1_6 Forward -301 -282 3.53937 0.272
NP_443009.1_5 Reverse -287 -298 14.5128 0.02
NP_443009.1_5 Forward -298 -287 10.1862 0.0792
NP_443009.1_5 Forward -72 -61 3.69644 0.282
NP_442301.1_2 Forward -115 -96 4.12856 0.284
NP_442408.2_1 Forward -297 -278 -3.54046 0.245
NP_442408.2_1 Reverse -288 -307 -6.39206 0.282
NP_441715.1_4 Forward -296 -286 7.94484 0.107
NP_441715.1_4 Reverse -289 -299 7.35486 0.108
NP_441715.1_4 Forward -70 -60 5.78156 0.18
NP_440357.1_6 Reverse -146 -165 19.6656 0.0484
NP_441448.1_1 Reverse -255 -274 7.17762 0.236
NP_441448.1_7 Forward -289 -270 10.6192 0.24
NP_441198.1_5 Reverse -64 -77 12.7034 0.216
NP_441198.1_5 Forward -295 -282 11.9167 0.245
NP_441198.1_8 Forward -299 -289 12.783 0.116
NP_440464.1_10 Forward -296 -286 13.0082 0.169
NP_440464.1_10 Reverse -63 -73 11.8623 0.275
NP_441758.1_10 Forward -36 -17 14.3549 0.0678
NP_441468.1_1 Forward -296 -289 15.8704 0.0124
NP_441468.1_1 Reverse -289 -296 15.8704 0.0124
NP_441468.1_1 Forward -70 -63 6.13563 0.209
NP_441468.1_1 Reverse -63 -70 6.0373 0.223
NP_441020.2_6 Reverse -286 -303 12.5269 0.0925
NP_441020.2_6 Reverse -331 -348 6.33202 0.267
NP_441015.1_10 Forward -302 -283 -0.0988766 0.168
NP_441015.1_10 Reverse -283 -302 -2.0655 0.178
NP_441015.1_10 Forward -190 -171 -11.5053 0.298
NP_441673.1_1 Forward -297 -288 20.8459 0.000698
NP_441673.1_1 Reverse -288 -297 20.8459 0.000698
NP_441673.1_1 Forward -71 -62 1.27803 0.155
NP_441673.1_1 Reverse -62 -71 1.27803 0.155
NP_441826.1_2 Reverse -282 -296 5.40779 0.0975
NP_441826.1_2 Forward -303 -289 -1.77037 0.254
NP_441330.1_1 Forward -302 -283 -12.5869 0.183
NP_441393.1_2 Forward -294 -275 18.0198 0.171
NP_442868.1_6 Reverse -286 -296 9.81313 0.038
NP_442868.1_6 Forward -299 -289 0.963343 0.205
NP_442868.1_6 Forward -73 -63 0.0783647 0.248
NP_442677.1_5 Forward -297 -278 12.9791 0.267
NP_441612.1_2 Forward -297 -287 8.54929 0.21
NP_442019.1_2 Reverse -38 -57 17.8957 0.224
NP_442361.1_3 Forward -303 -290 17.7189 0.0481
NP_442361.1_3 Reverse -282 -295 9.45906 0.276
NP_442808.1_1 Forward -298 -288 8.73102 0.0481
NP_442808.1_1 Reverse -287 -297 8.63269 0.0481
NP_440031.1_2 Reverse -270 -289 12.1925 0.292
NP_442542.1_9 Reverse -281 -295 5.80051 0.256
NP_442050.1_5 Reverse -60 -70 10.9926 0.116
NP_442050.1_5 Forward -299 -289 9.22267 0.193
NP_442050.1_5 Reverse -286 -296 7.64939 0.243
NP_440385.1_6 Reverse -17 -36 10.9334 0.296
NP_441114.1_3 Forward -211 -202 6.5879 0.262
NP_440558.1_2 Forward -258 -239 -3.44213 0.236
NP_440558.1_2 Forward -285 -266 -3.73712 0.238
NP_440558.1_2 Reverse -172 -191 -4.42544 0.245
NP_440558.1_2 Reverse -143 -162 -6.39206 0.274
NP_442576.1_9 Forward -139 -125 15.9588 0.291
NP_442789.1_4 Forward -248 -229 -3.63879 0.252
NP_441518.1_3 Forward -81 -62 -12.1936 0.263
NP_441878.1_6 Forward -298 -288 10.5014 0.0176
NP_441878.1_6 Reverse -287 -297 10.4031 0.0176
NP_441878.1_10 Forward -244 -230 19.2725 0.268
NP_441036.1_8 Forward -298 -288 15.713 0.00724
NP_441036.1_8 Reverse -287 -297 8.33817 0.174
NP_441036.1_8 Reverse -61 -71 6.07655 0.242
NP_442650.1_2 Forward -297 -283 6.19444 0.134
NP_442650.1_2 Reverse -240 -254 5.1128 0.153
NP_441557.1_5 Forward -297 -288 19.9609 0.000699
NP_441557.1_5 Reverse -288 -297 19.9609 0.000699
NP_441557.1_5 Forward -71 -62 8.94785 0.0289
NP_441557.1_5 Reverse -62 -71 0.688044 0.128
NP_441557.1_8 Reverse -275 -285 13.7459 0.204
NP_441590.1_1 Reverse -146 -165 8.55425 0.291
NP_441590.1_4 Reverse -145 -164 2.06362 0.297
NP_441433.1_8 Forward -146 -127 -4.52377 0.294
NP_440101.1_3 Reverse -283 -302 1.17943 0.282
NP_441458.1_10 Forward -306 -287 6.4893 0.2
NP_442830.1_3 Forward -262 -244 24.8969 0.00642
NP_442183.1_1 Reverse -333 -347 6.19444 0.184
NP_442166.1_7 Reverse -289 -303 10.3243 0.19
NP_441549.1_9 Reverse -284 -302 -3.91409 0.198
NP_442347.1_2 Forward -296 -287 12.4878 0.056
NP_442347.1_2 Reverse -63 -72 12.2911 0.056
NP_442347.1_2 Reverse -289 -298 3.34298 0.284
NP_442645.1_2 Reverse -280 -299 -22.2233 0.29
NP_440547.1_8 Reverse -333 -352 14.0608 0.289
NP_441037.1_4 Forward -299 -289 15.0168 0.028
NP_441037.1_4 Reverse -286 -296 7.9999 0.237
NP_441633.1_3 Reverse -286 -299 1.10092 0.109
NP_441633.1_3 Forward -344 -331 -4.9956 0.22
NP_441633.1_3 Forward -299 -286 -5.97891 0.236
NP_440136.1_2 Forward -296 -289 15.9687 0.0123
NP_440136.1_2 Reverse -289 -296 15.9687 0.0123
NP_440136.1_2 Forward -70 -63 6.23397 0.171
NP_440136.1_2 Reverse -63 -70 6.13563 0.193
NP_442590.1_10 Reverse -282 -301 5.70265 0.258
NP_442590.1_10 Forward -297 -278 5.60432 0.258
NP_442590.1_10 Reverse -366 -385 3.6377 0.289
NP_441728.2_4 Forward -36 -17 18.1908 0.0876
NP_442998.1_10 Forward -295 -288 15.5754 0.0102
NP_442998.1_10 Reverse -290 -297 15.5754 0.0102
NP_442998.1_10 Reverse -64 -71 15.5754 0.0102
NP_440299.1_1 Reverse -284 -297 19.9798 0.00161
NP_440299.1_1 Forward -301 -288 13.195 0.0319
NP_441799.1_1 Reverse -284 -298 11.7003 0.054
NP_441799.1_1 Forward -301 -287 10.0287 0.0797
NP_441799.1_1 Reverse -58 -72 5.60385 0.201
NP_441799.1_1 Forward -75 -61 4.03056 0.269
NP_440640.1_6 Forward -296 -277 3.34271 0.223
NP_441007.1_5 Reverse -63 -82 9.53756 0.225
NP_441007.1_10 Forward -302 -289 1.29759 0.203
NP_441007.1_10 Reverse -283 -296 -0.669033 0.287
NP_442201.1_10 Reverse -277 -296 -14.3569 0.281
NP_442333.2_5 Reverse -277 -296 -5.70374 0.214
NP_440256.1_1 Forward -300 -281 10.7175 0.0172
NP_440256.1_1 Forward -74 -55 9.93088 0.0193
NP_440256.1_1 Reverse -285 -304 -2.26216 0.115
NP_440256.1_1 Reverse -374 -393 -2.85214 0.123
NP_441362.1_2 Reverse -350 -369 6.13106 0.243
NP_441512.1_4 Forward -301 -282 10.4225 0.237
NP_441559.1_8 Forward -302 -288 1.08123 0.156
NP_441559.1_8 Reverse -283 -297 -6.88358 0.281
NP_441559.1_8 Reverse -262 -276 -7.76856 0.299
NP_441270.1_5 Reverse -335 -354 10.9448 0.296
NP_440915.1_6 Reverse -284 -298 5.01447 0.0943
NP_440915.1_6 Forward -301 -287 3.73617 0.1
NP_442158.1_4 Forward -194 -184 10.3048 0.299
NP_442785.1_7 Forward -299 -285 17.6008 0.0996
NP_442785.1_7 Reverse -164 -178 9.34103 0.265
NP_441704.1_8 Reverse -277 -296 19.1731 0.0499
NP_442866.1_1 Reverse -328 -347 -5.40875 0.24
NP_441464.1_8 Forward -395 -381 13.7659 0.14
NP_441464.1_8 Reverse -173 -187 8.35772 0.198
NP_441464.1_8 Reverse -144 -158 5.89945 0.248
NP_441494.1_6 Forward -302 -289 6.01747 0.289
NP_442993.1_1 Reverse -97 -113 -13.0195 0.283
NP_440677.1_1 Forward -351 -332 9.83255 0.181
NP_442386.1_9 Reverse -287 -296 13.8639 0.0289
NP_442386.1_9 Forward -298 -289 6.39082 0.219
NP_441340.1_5 Forward -296 -289 15.6737 0.0124
NP_441340.1_5 Reverse -289 -296 15.6737 0.0124
NP_441340.1_5 Forward -70 -63 6.23397 0.132
NP_441340.1_5 Reverse -63 -70 5.84064 0.208
NP_441947.1_4 Forward -166 -147 10.1275 0.3
NP_442484.1_2 Reverse -277 -296 8.16093 0.144
NP_442484.1_2 Forward -308 -289 0.884433 0.242
NP_442484.1_2 Forward -104 -85 -0.787193 0.273
NP_442791.1_1 Reverse -145 -164 6.78429 0.25
NP_441132.1_10 Reverse -120 -139 22.8122 0.0624
NP_442240.1_1 Reverse -75 -94 3.63691 0.286
NP_442240.1_2 Reverse -289 -308 -19.6667 0.295
NP_440586.1_8 Forward -70 -63 14.69 0.026
NP_440586.1_8 Forward -296 -289 13.2151 0.026
NP_440586.1_8 Reverse -289 -296 13.2151 0.026
NP_442251.1_6 Forward -296 -289 15.2804 0.0124
NP_442251.1_6 Reverse -289 -296 15.2804 0.0124
NP_442251.1_6 Reverse -63 -70 12.0355 0.0627
NP_442251.1_6 Reverse -334 -341 8.69224 0.199
NP_442251.1_6 Forward -66 -59 8.69224 0.199
NP_441262.1_3 Reverse -288 -295 14.7888 0.0223
NP_441262.1_3 Forward -297 -290 14.7888 0.0223
NP_441262.1_3 Forward -71 -64 14.7888 0.0223
NP_441262.1_3 Forward -342 -335 5.15232 0.265
NP_441262.1_5 Forward -81 -62 2.85105 0.297
NP_440027.1_3 Reverse -143 -161 8.6715 0.191
NP_440027.1_3 Forward -297 -279 6.1149 0.23
NP_440027.1_3 Reverse -146 -164 1.5917 0.3
NP_443051.1_1 Forward -298 -289 19.5676 0.00335
NP_443051.1_1 Reverse -287 -296 10.4228 0.00754
NP_443051.1_1 Forward -72 -63 0.884706 0.125
NP_443051.1_1 Reverse -61 -70 0.393051 0.169
NP_441232.1_10 Forward -386 -367 3.14605 0.235
NP_439937.1_9 Reverse -145 -162 -4.78005 0.157
NP_441167.1_6 Reverse -73 -92 17.1082 0.158
NP_441167.1_7 Forward -163 -144 22.6156 0.0319
NP_440408.1_7 Forward -297 -278 17.2074 0.111
NP_440408.1_7 Reverse -137 -156 8.16093 0.282
NP_440408.1_7 Reverse -288 -307 7.96426 0.284
NP_440439.1_1 Reverse -285 -298 2.2809 0.136
NP_440439.1_1 Forward -300 -287 2.08423 0.138
NP_442239.1_8 Forward -159 -140 10.2259 0.245
NP_439943.1_7 Reverse -283 -302 8.25926 0.186
NP_440372.1_2 Forward -296 -289 16.3621 0.0124
NP_440372.1_2 Reverse -289 -296 16.3621 0.0124
NP_440372.1_2 Forward -70 -63 6.82395 0.0854
NP_440372.1_2 Reverse -63 -70 6.52896 0.188
NP_441803.1_2 Forward -302 -283 19.2723 0.0309
NP_441572.1_7 Forward -303 -284 -1.57384 0.188
NP_441572.1_7 Forward -99 -80 -4.03212 0.224
NP_440267.1_2 Reverse -57 -71 12.0937 0.125
NP_442887.1_5 Forward -268 -249 -10.3253 0.264
NP_442887.1_5 Reverse -168 -187 -11.5053 0.264
NP_442384.1_10 Forward -297 -284 18.9972 0.00338
NP_442384.1_10 Reverse -288 -301 15.4572 0.00986
NP_440364.1_6 Forward -261 -248 13.49 0.278
NP_441877.1_9 Reverse -14 -31 4.16874 0.284
NP_441018.1_7 Reverse -236 -255 7.66927 0.268
NP_441018.1_7 Reverse -224 -243 6.19431 0.297
NP_442790.1_4 Reverse -279 -298 -9.53865 0.187
NP_442790.1_4 Reverse -324 -343 -14.8485 0.282
NP_442262.1_10 Forward -296 -289 14.1988 0.0123
NP_442262.1_10 Reverse -289 -296 14.1988 0.0123
NP_442262.1_10 Forward -70 -63 12.9205 0.0422
NP_441689.1_5 Forward -299 -289 8.3377 0.132
NP_441689.1_5 Reverse -60 -70 8.04271 0.166
NP_441689.1_5 Reverse -286 -296 5.78111 0.197
NP_440163.1_10 Forward -287 -277 9.91146 0.217
NP_440344.1_10 Forward -304 -287 0.628827 0.0349
NP_440344.1_10 Reverse -281 -298 -10.3842 0.178
NP_440282.1_10 Reverse -184 -203 -5.70374 0.25
NP_440531.1_6 Reverse -280 -299 9.73422 0.0728
NP_442910.1_1 Forward -304 -285 -5.40875 0.254
NP_440562.1_10 Reverse -53 -71 5.52568 0.289
NP_441965.1_10 Reverse -285 -301 2.41848 0.288
NP_441640.1_8 Reverse -283 -302 -3.83545 0.259
NP_440297.1_9 Forward -296 -286 -0.118297 0.282
NP_440297.1_9 Reverse -289 -299 -0.216628 0.282
NP_442280.1_10 Forward -264 -246 6.23363 0.28
NP_441679.1_3 Reverse -277 -296 17.6007 0.0203
NP_440999.1_1 Forward -398 -379 6.68515 0.184
NP_440999.1_2 Reverse -312 -331 11.5042 0.211
NP_440999.1_9 Forward -301 -287 3.34284 0.131
NP_440999.1_9 Reverse -284 -298 -0.295402 0.203
NP_440888.1_2 Forward -297 -283 12.6836 0.0405
NP_440888.1_2 Reverse -288 -302 8.84875 0.145
NP_440888.1_2 Reverse -275 -289 8.65209 0.152
NP_440888.1_2 Forward -105 -91 7.17714 0.205
NP_440792.1_5 Reverse -63 -82 7.17762 0.237
NP_440600.1_4 Reverse -280 -298 14.6705 0.0557
NP_440600.1_4 Forward -305 -287 0.0191479 0.146
NP_440600.1_4 Reverse -54 -72 -1.94747 0.183
NP_442147.1_7 Forward -164 -145 11.4058 0.233
NP_440491.1_1 Reverse -285 -304 12.1797 0.157
NP_439969.1_3 Forward -160 -141 1.76941 0.252
NP_442948.1_2 Forward -72 -53 16.2241 0.101
NP_442277.1_4 Forward -306 -287 4.22689 0.2
NP_441543.1_2 Forward -296 -287 16.9127 0.00359
NP_441543.1_2 Reverse -289 -298 15.9293 0.00518
NP_441543.1_2 Forward -70 -61 11.0128 0.0598
NP_441543.1_2 Reverse -63 -72 7.07956 0.131
NP_442845.1_2 Forward -297 -283 7.37441 0.195
NP_442845.1_2 Reverse -282 -296 6.19444 0.215
NP_442845.1_2 Forward -303 -289 4.42448 0.259
NP_441469.1_8 Forward -298 -289 6.5879 0.227
NP_441469.1_8 Reverse -287 -296 6.48957 0.227
NP_442315.1_1 Forward -169 -151 4.44404 0.271
NP_443064.1_6 Forward -297 -287 12.5669 0.0796
NP_443064.1_6 Reverse -288 -298 10.8217 0.13
NP_443064.1_6 Reverse -62 -72 8.88251 0.262
NP_442578.1_7 Forward -70 -63 14.6904 0.026
NP_442578.1_7 Forward -296 -289 14.5921 0.026
NP_442578.1_7 Reverse -289 -296 14.5921 0.026
NP_441462.1_2 Reverse -288 -298 20.2362 0.000805
NP_441462.1_2 Forward -297 -287 11.5831 0.00406
NP_441462.1_2 Forward -71 -61 9.91146 0.0136
NP_441621.1_7 Reverse -286 -300 -5.21195 0.248
NP_443062.1_1 Reverse -62 -80 16.054 0.0326
NP_443062.1_1 Reverse -288 -306 6.20575 0.206
NP_442204.1_1 Forward -301 -290 18.2499 0.0189
NP_442204.1_1 Reverse -284 -295 6.94184 0.144
NP_442204.1_1 Forward -346 -335 -0.334653 0.295
NP_442204.1_2 Reverse -64 -83 8.45592 0.25
NP_442204.1_2 Forward -307 -288 6.4893 0.287
NP_441560.1_8 Forward -158 -139 12.9735 0.239
NP_440516.1_8 Forward -297 -288 16.9127 0.00442
NP_440516.1_8 Reverse -288 -297 16.9127 0.00442
NP_440516.1_8 Forward -71 -62 0.983037 0.13
NP_442428.1_5 Forward -296 -289 15.8704 0.0124
NP_442428.1_5 Reverse -289 -296 15.8704 0.0124
NP_442428.1_5 Forward -70 -63 6.13563 0.209
NP_442428.1_5 Reverse -63 -70 6.0373 0.212
NP_442120.1_10 Reverse -97 -116 -8.752 0.238
NP_440603.1_5 Forward -284 -265 10.0292 0.183
NP_440673.1_3 Forward -295 -288 12.4288 0.0426
NP_440673.1_3 Reverse -290 -297 12.4288 0.0426
NP_440673.1_3 Reverse -64 -71 12.4288 0.0426
NP_440673.1_3 Forward -65 -58 11.3472 0.085
NP_440673.1_7 Reverse -277 -296 10.9142 0.111
NP_441714.1_3 Forward -304 -286 16.7346 0.111
NP_441052.1_2 Forward -297 -287 19.9412 0.00106
NP_441052.1_2 Reverse -288 -298 10.4031 0.0285
NP_441052.1_2 Reverse -62 -72 1.65166 0.233
NP_442219.1_9 Forward -296 -287 17.7976 0.00718
NP_442219.1_9 Reverse -289 -298 8.25953 0.0681
NP_442219.1_9 Reverse -63 -72 7.96454 0.0696
NP_440436.1_4 Forward -296 -287 17.2072 0.00233
NP_440436.1_4 Reverse -289 -298 9.24241 0.0871
NP_440436.1_4 Reverse -63 -72 7.57079 0.124
NP_440436.1_4 Forward -341 -332 5.40752 0.204
NP_441884.1_9 Forward -300 -281 -3.04881 0.0594
NP_440648.1_1 Reverse -288 -307 5.70265 0.21
NP_442907.1_9 Reverse -144 -163 -1.37718 0.235
NP_441719.1_4 Forward -296 -289 16.3621 0.0124
NP_441719.1_4 Reverse -289 -296 16.3621 0.0124
NP_441719.1_4 Forward -70 -63 13.5105 0.026
NP_441719.1_4 Reverse -63 -70 6.52896 0.188
NP_441719.1_4 Reverse -59 -66 3.77569 0.285
NP_441004.1_1 Reverse -282 -301 -15.2418 0.273
NP_442366.1_3 Reverse -287 -305 13.6872 0.0245
NP_442366.1_3 Reverse -61 -79 0.314141 0.173
NP_442366.1_3 Forward -148 -130 -2.43913 0.228
NP_442366.1_3 Forward -68 -50 -3.71743 0.255
NP_442366.1_5 Reverse -285 -295 17.2858 0.0141
NP_442366.1_5 Forward -74 -64 14.8275 0.0375
NP_442366.1_5 Forward -300 -290 14.0409 0.0497
NP_442695.1_3 Forward -27 -13 15.3386 0.239
NP_440296.1_10 Forward -300 -281 -4.22878 0.209
NP_441115.1_4 Reverse -287 -305 10.9331 0.158
NP_441115.1_4 Forward -298 -280 10.7364 0.168
NP_442206.1_10 Reverse -333 -348 5.19144 0.178
NP_442206.1_10 Reverse -288 -303 4.1098 0.179
NP_440328.1_4 Reverse -282 -301 16.1257 0.0319
NP_440328.1_4 Forward -303 -284 3.83436 0.172
NP_440328.1_4 Forward -77 -58 2.85105 0.191
NP_441851.1_10 Reverse -287 -297 15.8113 0.00552
NP_441851.1_10 Forward -72 -62 13.0581 0.0372
NP_441851.1_10 Forward -298 -288 8.53483 0.114
NP_441851.1_10 Reverse -332 -342 4.40493 0.271
NP_442208.1_5 Forward -328 -309 -7.67036 0.274
NP_442208.1_5 Reverse -286 -305 -9.44032 0.295
NP_442622.1_1 Reverse -272 -291 0.687771 0.177
NP_441668.1_4 Reverse -218 -237 6.09597 0.163
NP_441668.1_4 Forward -307 -288 -0.0988766 0.248
NP_442515.1_1 Forward -396 -382 3.04785 0.125
NP_441396.1_5 Forward -193 -184 8.35786 0.224
NP_440593.1_3 Reverse -283 -302 10.2259 0.107
NP_440593.1_3 Forward -302 -283 -1.47551 0.211
NP_441046.1_2 Reverse -252 -271 -0.39387 0.28
NP_442689.1_8 Forward -367 -350 -1.92778 0.225
NP_441349.1_10 Forward -307 -288 -9.14533 0.284
NP_440389.1_5 Forward -304 -285 11.162 0.287
NP_440432.1_9 Forward -70 -55 1.65152 0.141
NP_440432.1_9 Forward -341 -326 -2.38005 0.17
NP_439960.1_10 Forward -256 -238 -4.40575 0.293
NP_442450.1_5 Forward -299 -289 7.64985 0.13
NP_442450.1_5 Reverse -286 -296 7.55152 0.13
NP_440588.1_2 Forward -306 -287 -1.37718 0.155
NP_440588.1_2 Forward -300 -281 -6.09707 0.269
NP_441031.1_1 Forward -27 -8 15.6921 0.086
NP_440040.1_6 Reverse -131 -150 9.0459 0.181
NP_440023.1_7 Reverse -20 -39 10.4225 0.265
NP_442006.1_2 Reverse -311 -328 -14.2191 0.203
NP_442006.1_2 Forward -291 -274 -16.2841 0.247
NP_442006.1_2 Forward -80 -63 -17.8574 0.283
NP_440483.1_1 Forward -289 -270 -4.22878 0.218
NP_442243.1_1 Forward -255 -237 -0.571569 0.252
NP_441570.1_1 Forward -297 -279 10.0489 0.0099
NP_441570.1_1 Reverse -288 -306 -10.4039 0.17
NP_441570.1_1 Reverse -333 -351 -10.8956 0.181
NP_441570.1_1 Forward -71 -53 -16.7954 0.254
NP_441078.1_4 Forward -297 -288 19.6659 0.0007
NP_441078.1_4 Reverse -288 -297 19.6659 0.0007
NP_441078.1_4 Reverse -62 -71 0.0980582 0.205
NP_441078.1_4 Forward -71 -62 0.0980582 0.205
NP_442443.1_1 Forward -163 -144 -4.13045 0.268
NP_440526.1_3 Forward -296 -285 0.943182 0.267
NP_440526.1_3 Reverse -63 -74 0.64819 0.273
NP_441432.1_8 Reverse -287 -296 16.8143 0.00595
NP_441432.1_8 Forward -298 -289 16.8143 0.00595
NP_441432.1_8 Forward -72 -63 7.27622 0.101
NP_441333.1_1 Reverse -15 -25 11.9712 0.241
NP_442320.1_8 Reverse -282 -296 -4.22864 0.151
NP_442320.1_8 Reverse -327 -341 -5.31028 0.217
NP_442320.1_8 Forward -77 -63 -6.09693 0.265
NP_442344.1_7 Reverse -63 -82 -9.24366 0.245
NP_441732.1_2 Forward -301 -285 21.298 0.00205
NP_441732.1_2 Reverse -284 -300 -7.51295 0.0859
NP_441732.1_2 Forward -346 -330 -17.5427 0.27
NP_441030.1_4 Forward -37 -18 21.151 0.0173
NP_440629.1_4 Reverse -313 -332 8.75091 0.264
NP_442003.1_4 Forward -296 -277 11.6025 0.277
NP_440760.1_1 Reverse -288 -307 -22.3217 0.253
NP_442797.1_7 Reverse -280 -298 1.00246 0.267
NP_440199.1_10 Forward -74 -64 7.25653 0.231
NP_441945.1_10 Reverse -371 -390 9.63589 0.258
NP_442353.1_4 Forward -325 -306 2.16195 0.236
NP_442353.1_4 Reverse -282 -301 1.17865 0.253
NP_442400.1_10 Forward -25 -12 7.51014 0.284
NP_442489.1_2 Forward -302 -283 6.98095 0.172
NP_442489.1_7 Forward -297 -288 20.1576 0.000695
NP_442489.1_7 Reverse -288 -297 20.1576 0.000695
NP_442489.1_7 Reverse -62 -71 7.57121 0.057
NP_442489.1_7 Forward -71 -62 0.589713 0.17
NP_442489.1_7 Reverse -333 -342 -1.6719 0.235
NP_440559.1_1 Forward -296 -287 17.4043 0.00658
NP_440559.1_1 Reverse -59 -68 11.1111 0.0586
NP_440559.1_1 Reverse -289 -298 8.65285 0.0586
NP_440559.1_1 Reverse -63 -72 7.76787 0.0918
NP_440559.1_1 Forward -70 -61 5.70292 0.137
NP_441659.2_8 Reverse -288 -298 20.9245 0.000805
NP_441659.2_8 Forward -297 -287 18.1713 0.00133
NP_441659.2_8 Reverse -62 -72 6.27322 0.0797
NP_441659.2_8 Forward -71 -61 1.74999 0.227
NP_441022.1_1 Forward -53 -44 13.8484 0.188
NP_441022.1_1 Reverse -43 -52 10.9707 0.284
NP_442913.1_10 Forward -306 -287 7.86593 0.0512
NP_442913.1_10 Reverse -279 -298 -0.197208 0.157
NP_442913.1_10 Forward -80 -61 -5.50708 0.268
NP_442913.1_10 Forward -258 -239 -5.80207 0.279
NP_442008.1_2 Forward -300 -281 6.09597 0.223
NP_442008.1_2 Reverse -285 -304 4.03102 0.245
NP_441800.1_3 Forward -260 -242 4.44404 0.289
NP_440779.1_5 Reverse -62 -79 -6.54933 0.193
NP_442346.1_5 Reverse -287 -297 16.6963 0.00248
NP_442346.1_5 Forward -298 -288 16.303 0.00248
NP_442346.1_5 Forward -72 -62 7.05986 0.183
NP_442346.1_5 Reverse -61 -71 4.3066 0.291
NP_440545.1_3 Reverse -284 -301 14.2968 0.0157
NP_440545.1_3 Forward -301 -284 7.61033 0.0489
NP_440545.1_3 Reverse -257 -274 -3.10775 0.199
NP_441856.1_3 Reverse -285 -304 -2.65548 0.269
NP_440025.1_1 Forward -75 -56 6.98095 0.243
NP_441629.1_3 Forward -333 -314 -3.14789 0.277
NP_440459.1_2 Reverse -279 -296 10.7569 0.192
NP_441653.1_1 Reverse -12 -26 18.1908 0.158
NP_440010.1_3 Forward -173 -154 -5.31042 0.25
NP_440010.1_3 Forward -104 -85 -7.57203 0.278
NP_442311.1_8 Reverse -134 -153 10.7175 0.278
NP_440847.1_5 Forward -175 -156 12.1925 0.281
NP_442603.1_7 Forward -297 -283 14.0603 0.0733
NP_441050.1_5 Reverse -224 -242 0.0191479 0.254
NP_440449.1_6 Forward -305 -287 6.21331 0.255
NP_440170.1_6 Forward -302 -283 12.6841 0.283
NP_441502.1_3 Reverse -286 -305 5.60432 0.287
NP_442732.1_2 Forward -28 -9 15.2287 0.249
NP_441833.1_4 Forward -296 -289 15.9687 0.0124
NP_441833.1_4 Reverse -289 -296 15.9687 0.0124
NP_441833.1_4 Reverse -63 -70 6.52896 0.0924
NP_441833.1_4 Forward -70 -63 6.23397 0.163
NP_441329.1_1 Reverse -13 -32 8.54611 0.225
NP_441329.1_6 Forward -29 -10 4.53544 0.201
NP_441895.1_2 Reverse -245 -264 -17.6018 0.234
NP_442162.1_9 Forward -296 -289 16.2637 0.0124
NP_442162.1_9 Reverse -289 -296 16.2637 0.0124
NP_442162.1_9 Forward -70 -63 6.62729 0.142
NP_442162.1_9 Reverse -63 -70 6.52896 0.178
NP_443026.1_5 Reverse -96 -115 2.0644 0.283
NP_442073.1_6 Forward -258 -239 -3.3438 0.291
NP_442140.1_3 Forward -296 -286 12.2714 0.0632
NP_442140.1_3 Reverse -289 -299 6.66654 0.159
NP_442140.1_3 Forward -341 -331 6.37155 0.172
NP_442021.1_3 Reverse -282 -301 -7.57203 0.275
NP_441671.1_10 Reverse -51 -70 0.58944 0.281
NP_441671.1_10 Forward -209 -190 0.491109 0.281
NP_440875.1_9 Reverse -290 -300 8.37203 0.233
NP_441813.1_5 Reverse -286 -296 8.63316 0.0367
NP_441813.1_5 Forward -299 -289 8.63316 0.0367
NP_441813.1_5 Reverse -60 -70 7.74818 0.0611
NP_440594.1_8 Reverse -59 -72 11.0318 0.153
NP_440152.1_1 Forward -175 -156 23.4022 0.00451
NP_440152.1_2 Forward -130 -111 25.0739 0.00158
NP_440152.1_3 Forward -196 -177 24.1889 0.021
NP_440152.1_4 Forward -253 -234 34.5136 0.000019
NP_440152.1_5 Forward -226 -207 24.6796 0.0179
NP_440152.1_8 Forward -289 -270 19.174 0.0148
NP_441259.1_8 Forward -326 -307 16.0265 0.208
NP_440590.1_4 Forward -296 -283 19.4888 0.00651
NP_440590.1_4 Reverse -289 -302 2.57589 0.0845
NP_440590.1_4 Reverse -147 -160 -1.55401 0.223
NP_440590.1_4 Forward -290 -277 -5.68391 0.286
NP_440590.1_4 Forward -164 -151 -5.88057 0.293
NP_440567.1_1 Forward -296 -282 14.3559 0.0187
NP_440567.1_1 Reverse -289 -303 12.9793 0.0213
NP_440567.1_1 Forward -66 -52 2.5562 0.17
NP_440567.1_1 Reverse -63 -77 1.17956 0.214
NP_442497.1_10 Reverse -289 -298 17.601 0.00813
NP_442497.1_10 Forward -296 -287 10.4228 0.0087
NP_442497.1_10 Forward -70 -61 5.99792 0.095
NP_442497.1_10 Reverse -63 -72 0.589713 0.153
NP_440821.1_4 Reverse -286 -296 9.41981 0.0286
NP_440821.1_4 Forward -299 -289 2.24165 0.131
NP_440821.1_4 Forward -73 -63 -0.314959 0.251
NP_440821.1_4 Reverse -331 -341 -0.806614 0.296
NP_440227.1_2 Reverse -351 -367 9.00665 0.29
NP_441239.1_9 Forward -299 -287 11.1504 0.0648
NP_441239.1_9 Forward -323 -311 9.67541 0.0987
NP_441239.1_9 Reverse -84 -96 8.39711 0.134
NP_441239.1_9 Reverse -286 -298 3.38223 0.285
NP_441239.1_9 Forward -344 -332 2.98891 0.3
NP_441951.1_4 Forward -297 -278 2.0644 0.283
NP_441951.1_4 Forward -104 -85 1.0811 0.288
NP_441009.1_4 Reverse -288 -307 10.6192 0.263
NP_441892.1_1 Reverse -279 -296 16.8534 0.0246
NP_441892.1_1 Forward -306 -289 8.98696 0.0757
NP_441892.1_1 Forward -80 -63 -3.99273 0.253
NP_440604.1_6 Reverse -288 -307 -2.65548 0.225
NP_442044.1_9 Reverse -333 -352 1.76941 0.287
NP_442270.1_9 Reverse -277 -296 -7.67036 0.214
NP_442629.1_3 Forward -166 -147 1.67108 0.284
NP_440833.1_6 Forward -312 -298 7.86545 0.278
NP_442216.1_4 Forward -308 -300 17.6202 0.23
NP_440354.1_5 Reverse -285 -304 6.88262 0.174
NP_442138.1_10 Reverse -333 -352 -7.17871 0.286
NP_442052.1_8 Reverse -202 -212 16.4013 0.207
NP_440546.1_4 Reverse -288 -298 13.5365 0.0459
NP_440546.1_4 Forward -297 -287 10.046 0.109
NP_440546.1_4 Forward -71 -61 7.13728 0.257
NP_440462.1_6 Forward -299 -289 10.5014 0.0396
NP_440462.1_6 Reverse -60 -70 8.4365 0.062
NP_440462.1_6 Reverse -286 -296 1.35667 0.294
NP_442611.1_1 Reverse -288 -307 -2.85214 0.295
NP_442144.1_1 Reverse -285 -301 15.1032 0.152
NP_440868.1_4 Reverse -284 -296 8.6921 0.0582
NP_440868.1_4 Reverse -58 -70 7.80712 0.0637
NP_440868.1_4 Forward -301 -289 6.1355 0.0878
NP_442499.1_3 Forward -363 -345 5.23069 0.282
NP_442479.1_9 Reverse -351 -370 -4.03212 0.25
NP_442402.1_4 Forward -305 -286 -6.88445 0.267
NP_441848.1_7 Forward -53 -34 -4.42619 0.292
NP_441084.1_6 Forward -344 -330 9.05325 0.295
NP_440653.1_10 Forward -296 -277 5.60432 0.227
NP_440653.1_10 Reverse -289 -308 4.32602 0.252
NP_440696.1_3 Forward -71 -53 3.06741 0.211
NP_442039.1_4 Forward -296 -289 15.1821 0.0124
NP_442039.1_4 Reverse -289 -296 15.1821 0.0124
NP_441811.1_8 Forward -158 -144 7.9644 0.241
NP_440825.1_7 Reverse -63 -73 13.0072 0.152
NP_440825.1_7 Forward -296 -286 12.9096 0.152
NP_442837.1_2 Reverse -132 -151 18.1907 0.174
NP_442837.1_3 Forward -296 -289 15.7721 0.0124
NP_442837.1_3 Reverse -289 -296 15.7721 0.0124
NP_442837.1_3 Reverse -63 -70 12.1338 0.0702
NP_442837.1_3 Forward -70 -63 6.0373 0.25
NP_442053.1_1 Forward -297 -288 18.3876 0.0007
NP_442053.1_1 Reverse -288 -297 18.3876 0.0007
NP_442053.1_1 Reverse -62 -71 6.8829 0.111
NP_440505.1_3 Reverse -286 -296 9.22315 0.122
NP_440505.1_3 Forward -299 -289 8.04317 0.147
NP_440505.1_7 Reverse -281 -300 10.6192 0.148
NP_441203.1_1 Reverse -289 -308 -3.44213 0.0699
NP_442532.1_2 Forward -27 -8 5.58586 0.204
NP_441408.2_7 Reverse -351 -370 -2.16383 0.265
NP_440914.1_1 Forward -297 -287 17.5935 0.000537
NP_440914.1_1 Reverse -288 -298 16.3248 0.00196
NP_440914.1_1 Reverse -62 -72 7.24882 0.242
NP_441011.1_8 Reverse -289 -298 16.6177 0.00602
NP_441011.1_8 Forward -296 -287 8.25953 0.144
NP_441011.1_8 Forward -70 -61 8.25953 0.144
NP_442101.1_10 Forward -305 -286 -7.37537 0.211
NP_442533.1_6 Forward -297 -288 17.2076 0.00137
NP_442533.1_6 Reverse -288 -297 17.2076 0.00137
NP_442533.1_6 Forward -71 -62 5.40793 0.14
NP_442533.1_6 Reverse -240 -249 4.81794 0.172
NP_442229.1_1 Reverse -286 -300 7.47213 0.196
NP_443016.1_1 Reverse -266 -285 -6.58872 0.263
NP_441482.1_4 Forward -114 -95 9.63589 0.296
NP_441482.1_7 Forward -303 -289 -0.983719 0.0612
NP_439944.1_9 Forward -296 -286 10.5014 0.0887
NP_439944.1_9 Reverse -289 -299 9.12481 0.1
NP_442269.1_10 Reverse -229 -248 1.76941 0.282
NP_441028.1_6 Reverse -276 -286 4.01116 0.278
NP_440116.1_5 Reverse -285 -302 12.6252 0.09
NP_440116.1_8 Reverse -63 -82 -8.752 0.26
NP_440115.1_6 Reverse -285 -295 8.33817 0.13
NP_440115.1_6 Forward -300 -290 7.35486 0.147
NP_440007.1_9 Forward -301 -287 2.75286 0.277
NP_441602.1_3 Reverse -283 -302 -3.04881 0.241
NP_441602.1_6 Reverse -162 -181 14.1591 0.277
NP_441972.1_5 Forward -296 -277 5.50599 0.0917
NP_441972.1_5 Reverse -289 -308 -9.047 0.278
NP_441106.1_1 Forward -298 -289 18.486 0.0028
NP_441106.1_1 Reverse -287 -296 9.63616 0.0311
NP_441106.1_1 Reverse -61 -70 7.96454 0.0647
NP_441106.1_1 Reverse -332 -341 5.21127 0.167
NP_439903.1_6 Forward -300 -281 3.24359 0.211
NP_439903.1_6 Forward -240 -221 0.195343 0.268
NP_441286.1_1 Reverse -287 -299 5.93884 0.0258
NP_441286.1_1 Forward -298 -286 3.48056 0.0467
NP_440670.1_8 Forward -297 -288 18.3876 0.000699
NP_440670.1_8 Reverse -288 -297 18.3876 0.000699
NP_440670.1_8 Reverse -333 -342 11.2095 0.0356
NP_440886.1_7 Forward -298 -288 8.04271 0.0805
NP_440886.1_7 Reverse -287 -297 7.94438 0.0805
NP_440828.1_4 Reverse -139 -158 -6.19614 0.267
NP_442614.1_2 Forward -297 -283 6.19444 0.291
NP_442072.1_3 Forward -352 -334 15.5727 0.258
NP_442072.1_9 Reverse -287 -305 -22.007 0.216
NP_441753.1_10 Forward -351 -332 3.73603 0.211
NP_440028.1_6 Reverse -30 -48 14.6705 0.218
NP_441808.1_8 Forward -161 -142 11.8975 0.219
NP_442022.1_4 Forward -197 -178 5.30933 0.291
NP_440907.2_8 Reverse -289 -299 15.9091 0.0161
NP_440907.2_8 Forward -296 -286 7.64939 0.117
NP_441463.1_2 Reverse -11 -29 9.40498 0.138
NP_441463.1_2 Reverse -21 -39 -0.398222 0.29
NP_441463.1_3 Forward -81 -62 -2.16383 0.151
NP_441463.1_3 Forward -352 -333 -10.0303 0.288
NP_441626.1_2 Forward -296 -289 15.7721 0.0124
NP_441626.1_2 Reverse -289 -296 15.7721 0.0124
NP_441626.1_2 Forward -70 -63 6.13563 0.177
NP_441626.1_2 Reverse -63 -70 5.93897 0.231
NP_441901.1_1 Reverse -314 -333 1.27776 0.245
NP_442794.1_1 Forward -301 -289 12.527 0.0721
NP_442794.1_1 Reverse -284 -296 12.4287 0.0721
NP_442615.1_1 Forward -306 -288 11.1305 0.0184
NP_442615.1_1 Reverse -49 -67 0.805796 0.0957
NP_441962.1_4 Forward -254 -235 -10.522 0.229
NP_441796.1_8 Forward -204 -186 15.4571 0.127
NP_440387.1_1 Reverse -288 -304 6.35172 0.0282
NP_440387.1_1 Forward -297 -281 5.36841 0.0325
NP_440387.1_1 Reverse -333 -349 -4.56302 0.19
NP_441431.1_2 Forward -300 -286 13.1753 0.0952
NP_441431.1_2 Reverse -285 -299 7.57046 0.238
NP_441431.1_2 Forward -70 -56 7.27547 0.244
NP_441431.1_2 Reverse -59 -73 6.98048 0.255
NP_441431.1_3 Forward -197 -178 2.65439 0.282
NP_441431.1_7 Forward -179 -160 15.3182 0.245
NP_441488.1_8 Forward -302 -288 12.782 0.146
NP_441488.1_8 Reverse -283 -297 12.192 0.146
NP_441993.1_1 Forward -332 -313 13.3492 0.0868
NP_441993.1_1 Forward -297 -278 2.72635 0.254
NP_441993.1_1 Reverse -282 -301 1.55686 0.274
NP_440143.1_9 Reverse -19 -38 0.785326 0.188
NP_440082.1_5 Reverse -12 -31 15.0377 0.269
NP_440114.1_10 Forward -71 -57 5.80112 0.292
NP_442323.1_7 Reverse -283 -302 6.09517 0.201
NP_440766.1_4 Forward -295 -281 2.35953 0.187
NP_440766.1_4 Forward -346 -332 1.67122 0.22
NP_441237.1_9 Forward -296 -286 14.828 0.0242
NP_441237.1_9 Reverse -63 -73 12.0747 0.139
NP_441311.1_2 Forward -303 -289 24.09 0.00121
NP_440457.1_1 Reverse -284 -296 0.137309 0.25
NP_440457.1_1 Forward -301 -289 -0.354346 0.262
NP_440213.1_5 Reverse -41 -60 7.27595 0.294
NP_440798.1_6 Reverse -289 -302 11.229 0.0624
NP_440798.1_6 Forward -296 -283 6.60746 0.14
NP_440801.1_8 Reverse -316 -335 -0.39387 0.265
NP_440942.1_6 Reverse -279 -298 6.29183 0.259
NP_440142.1_7 Reverse -289 -308 13.5691 0.179
NP_440142.1_7 Forward -296 -277 12.3892 0.2
NP_440473.1_1 Forward -300 -281 12.7999 0.213
NP_442509.1_9 Forward -297 -287 8.14104 0.192
NP_442509.1_9 Reverse -288 -298 8.04271 0.192
NP_441489.1_3 Forward -35 -21 8.31942 0.244
NP_442514.1_5 Forward -262 -243 -5.01617 0.254
NP_442514.1_5 Reverse -238 -257 -9.53937 0.296
NP_440554.1_4 Forward -70 -60 10.3048 0.0552
NP_440554.1_4 Reverse -289 -299 8.82982 0.0646
NP_440554.1_4 Reverse -87 -97 2.04498 0.279
NP_442862.1_3 Forward -271 -254 4.26707 0.29
NP_441885.1_5 Forward -297 -287 20.9245 0.000538
NP_441885.1_5 Reverse -288 -298 11.3864 0.00668
NP_441885.1_5 Reverse -62 -72 1.35667 0.11
NP_441885.1_5 Forward -71 -61 0.668351 0.133
NP_440478.1_4 Forward -301 -282 11.9958 0.239
NP_442341.1_7 Forward -298 -284 9.2427 0.0751
NP_442341.1_7 Reverse -287 -301 8.55439 0.0864
NP_442341.1_7 Reverse -271 -285 6.3911 0.127
NP_442341.1_9 Forward -299 -285 16.9119 0.0319
NP_442341.1_9 Reverse -286 -300 8.45543 0.17
NP_442341.1_9 Reverse -94 -108 4.8172 0.291
NP_441756.1_5 Forward -301 -282 -5.11376 0.298
NP_442395.2_4 Reverse -239 -258 2.26028 0.223
NP_440423.1_10 Forward -78 -59 9.53756 0.26
NP_443000.1_7 Forward -299 -289 10.6981 0.0345
NP_443000.1_7 Reverse -286 -296 10.3048 0.0345
NP_443000.1_7 Reverse -60 -70 9.81313 0.0431
NP_443000.1_7 Forward -73 -63 0.57002 0.294
NP_440076.1_5 Forward -291 -272 14.0599 0.239
NP_440552.1_8 Forward -31 -14 11.7022 0.245
NP_442513.1_5 Reverse -280 -299 9.24175 0.266
NP_441842.1_1 Forward -295 -282 13.49 0.147
NP_441842.1_3 Forward -203 -185 17.1287 0.193
NP_441842.1_7 Forward -326 -307 21.2381 0.148
NP_441842.1_10 Reverse -281 -295 16.5192 0.0311
NP_441842.1_10 Forward -78 -64 13.7659 0.0689
NP_441842.1_10 Forward -304 -290 12.1926 0.107
NP_440275.1_3 Forward -299 -289 9.02648 0.0563
NP_440275.1_3 Reverse -286 -296 8.04317 0.0602
NP_440275.1_3 Reverse -331 -341 5.28991 0.158
NP_442932.1_9 Reverse -80 -99 4.32602 0.285
NP_440091.1_1 Reverse -329 -341 -0.846001 0.293
NP_440091.1_1 Forward -75 -63 -0.846001 0.293
NP_441307.1_6 Forward -297 -278 7.27595 0.217
NP_443060.1_5 Reverse -174 -193 6.29183 0.24
NP_440679.1_10 Forward -162 -143 -18.9784 0.279
NP_440258.1_7 Reverse -9 -28 11.6018 0.287
NP_439962.1_4 Reverse -78 -97 -3.14714 0.246
NP_442495.1_4 Reverse -292 -302 13.4514 0.187
NP_440149.1_8 Forward -297 -278 15.3391 0.0228
NP_441105.1_3 Forward -308 -289 -0.39387 0.136
NP_441105.1_3 Forward -260 -241 -10.0303 0.3
NP_440216.1_1 Reverse -288 -302 7.37441 0.00942
NP_440216.1_1 Forward -297 -283 0.491246 0.0284
NP_440216.1_1 Forward -71 -57 -3.44199 0.082
NP_440216.1_9 Forward -346 -337 5.50626 0.292
NP_440172.1_1 Reverse -288 -298 17.5813 0.00421
NP_440172.1_1 Forward -297 -287 15.0247 0.00945
NP_440172.1_1 Forward -71 -61 10.1081 0.0551
NP_441008.1_4 Reverse -146 -165 14.7658 0.295
NP_442015.1_10 Reverse -284 -297 20.2755 0.00366
NP_442015.1_10 Forward -301 -288 12.2123 0.0372
NP_442015.1_10 Forward -253 -240 9.2624 0.0515
NP_442015.1_10 Forward -346 -333 0.904263 0.216
NP_441226.1_7 Forward -296 -289 14.4934 0.0123
NP_441226.1_7 Reverse -289 -296 14.4934 0.0123
NP_441226.1_7 Forward -290 -283 9.47853 0.147
NP_441226.1_7 Reverse -241 -248 8.59356 0.197
NP_440117.1_1 Forward -29 -10 -1.67217 0.258
NP_441757.1_3 Reverse -287 -306 1.47442 0.162
NP_441111.1_7 Forward -296 -288 18.7023 0.00294
NP_441111.1_7 Reverse -289 -297 18.7023 0.00294
NP_441111.1_7 Reverse -63 -71 8.86921 0.0589
NP_442379.1_10 Reverse -281 -298 -3.5994 0.264
NP_441766.1_2 Forward -297 -288 17.5026 0.00297
NP_441766.1_2 Reverse -288 -297 17.5026 0.00297
NP_441766.1_2 Forward -71 -62 8.1612 0.0645
NP_442417.1_5 Reverse -288 -302 15.0442 0.0589
NP_440416.1_1 Forward -71 -52 -12.1936 0.272
NP_440416.1_9 Forward -304 -285 4.22769 0.0355
NP_440416.1_9 Reverse -281 -300 -9.24366 0.129
NP_440416.1_9 Forward -78 -59 -16.7168 0.22
NP_443052.1_8 Reverse -52 -71 -10.3253 0.207
NP_443052.1_8 Reverse -310 -329 -11.3086 0.226
NP_442116.1_6 Reverse -352 -369 8.8374 0.238
NP_442116.1_6 Forward -28 -11 5.68616 0.291
NP_442154.1_1 Reverse -331 -349 -16.7954 0.245
NP_442154.1_1 Forward -193 -175 -16.8938 0.246
NP_442154.1_1 Reverse -69 -87 -17.7788 0.267
NP_442154.1_1 Forward -290 -272 -19.1554 0.291
NP_442154.1_6 Forward -96 -77 8.25926 0.209
NP_442226.1_8 Forward -368 -358 16.6963 0.164
NP_442226.1_8 Reverse -222 -232 14.9263 0.254
NP_442564.1_10 Forward -121 -107 12.0943 0.244
NP_440261.1_5 Reverse -289 -302 -1.06236 0.0655
NP_440261.1_5 Forward -296 -283 -2.53732 0.0924
NP_440988.1_10 Reverse -244 -258 7.22233 0.219
NP_440988.1_10 Reverse -238 -252 5.77014 0.24
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AACAGGGCCACACCACCATTGGGTAGGCTAGCAATTTTGGCTGTAACTTCAGCACCAATGCAATCGTCGCATTTGACCACCGGCTGGCCCAATAATTCCCCTAGGCGATCGCCAACGGGGGTGAGGCGCATGCTGTCCACTACTTTGCCCTTGGGACGGCCAAAATGACTGCCCAAAATAACTTTGGCGCCTTTGCTCAACAGGTCTTTGATGGTGGGTAAGGCTGCCCGAATCCTGGTGTCGTCGGTGATGCTGCCGTTATCTAGGGGCACATTAAAATCTACCCGGACAAAAACCCGTTTCCCTGCGAGGTCTGCCTCCGTCAAATTGGCGATCGATTGCTTAGACAAAACCTTTTCCTCCTAAATGTCAAATAAACTTAACAAAATTAAACCAGTCA

CDS

ATGTTACCGCCGACAATGGAAAGCCCCAAAATGACCTCCAATGATCGCATTCTGACCATTCTGCAACAGGACTACGCCAATTTTCCCTGGCACCAAACCTTCAGCATCTATGACCCAAACGTTTATTTTCAAGATCCTTTAAGCCAATTTCGGGGTTTGGCTCGATACGAAAAGATGATCCAATTCTTGGGTCGTTGGTTTCAGGCGATCGACCTACAGCTCCACGAGATTACCCAGGTGAACCAGGAAATTACCACCCGTTGGACCTTGAACTGGACTTCTCCCCTGCCCTGGAAACCGAGAATTGCCATCAGCGGCTGCAGTGAATTAACCCTAAATGAAGCTGGGTTAATCATTTCCCACATCGATTATTGGGATTGTTCCCCCTGGGATGTGGTGAAACAGCATTTTTCACGATAG

Protein

MLPPTMESPKMTSNDRILTILQQDYANFPWHQTFSIYDPNVYFQDPLSQFRGLARYEKMIQFLGRWFQAIDLQLHEITQVNQEITTRWTLNWTSPLPWKPRIAISGCSELTLNEAGLIISHIDYWDCSPWDVVKQHFSR