Your browser is old and dusty. Try Google Chrome!

Details for sll0361

ORF sll0361
Accession NP_441846.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -110 -124 3.34284 0.165
NP_441061.1_2 Reverse -308 -322 0.491246 0.207
NP_441061.1_2 Reverse -193 -207 -0.590395 0.234
NP_441061.1_2 Reverse -366 -380 -2.16369 0.285
NP_440795.1_7 Forward -117 -110 14.6904 0.0123
NP_440795.1_7 Reverse -110 -117 14.6904 0.0123
NP_441418.1_6 Forward -291 -272 -23.9933 0.199
NP_441418.1_6 Reverse -109 -128 -27.8282 0.203
NP_441418.1_6 Forward -118 -99 -29.7948 0.238
NP_442291.1_5 Forward -119 -103 3.00846 0.116
NP_440295.1_2 Forward -44 -25 10.1275 0.21
NP_440897.1_6 Reverse -109 -128 1.6703 0.17
NP_441453.1_4 Reverse -109 -117 16.539 0.00633
NP_441453.1_4 Forward -118 -110 16.539 0.00633
NP_441453.1_4 Forward -201 -193 5.52596 0.127
NP_442151.1_6 Reverse -109 -123 17.5025 0.00997
NP_442151.1_6 Forward -118 -104 6.19444 0.244
NP_441818.1_9 Forward -328 -309 1.47442 0.191
NP_441818.1_9 Reverse -193 -212 -1.96717 0.201
NP_440226.1_1 Forward -118 -99 12.5858 0.0435
NP_440226.1_1 Forward -201 -182 4.71934 0.181
NP_442623.1_3 Reverse -18 -37 -11.4069 0.245
NP_440996.1_3 Forward -131 -113 20.6687 0.034
NP_442744.1_9 Reverse -103 -117 12.3505 0.288
NP_442173.1_1 Forward -117 -109 15.4574 0.00633
NP_442173.1_1 Reverse -110 -118 15.4574 0.00633
NP_442752.1_4 Forward -118 -111 13.8055 0.0199
NP_442752.1_4 Reverse -109 -116 13.8055 0.0199
NP_443027.1_4 Reverse -107 -117 16.2046 0.0437
NP_443027.1_4 Forward -28 -18 6.56821 0.275
NP_441812.1_3 Forward -119 -105 18.5841 0.0479
NP_442975.1_10 Reverse -105 -119 20.3534 0.00216
NP_442975.1_10 Forward -122 -108 10.2254 0.056
NP_440784.1_7 Forward -117 -110 15.9687 0.0123
NP_440784.1_7 Reverse -110 -117 15.9687 0.0123
NP_440061.1_9 Reverse -107 -121 7.96378 0.185
NP_441476.1_5 Forward -385 -366 -6.49039 0.274
NP_442074.1_5 Forward -156 -137 14.6508 0.27
NP_442062.1_8 Reverse -109 -119 17.3846 0.00193
NP_442062.1_8 Forward -118 -108 10.3048 0.0493
NP_440304.1_4 Reverse -107 -117 19.9412 0.00364
NP_440304.1_4 Forward -120 -110 1.84832 0.299
NP_442242.1_4 Forward -117 -110 14.3954 0.0124
NP_442242.1_4 Reverse -110 -117 14.3954 0.0124
NP_440044.1_8 Forward -117 -98 1.27776 0.178
NP_440044.1_8 Reverse -110 -129 0.58944 0.195
NP_441781.1_7 Reverse -109 -128 4.32602 0.186
NP_441781.1_7 Reverse -365 -384 -0.983855 0.268
NP_439918.1_2 Forward -328 -309 -1.96717 0.24
NP_439918.1_2 Reverse -193 -212 -3.63879 0.258
NP_441208.1_9 Forward -121 -107 7.27608 0.223
NP_441594.1_6 Forward -377 -358 4.42435 0.221
NP_442110.1_7 Reverse -109 -123 1.76955 0.222
NP_441082.1_10 Forward -265 -252 9.2624 0.252
NP_441925.1_4 Reverse -303 -322 -13.2759 0.257
NP_441083.1_3 Reverse -170 -180 11.9759 0.296
NP_441083.1_5 Reverse -109 -119 20.3345 0.00053
NP_441083.1_5 Forward -118 -108 11.2881 0.0159
NP_442827.1_8 Forward -126 -107 5.11187 0.125
NP_441738.1_2 Forward -116 -109 15.28 0.0102
NP_441738.1_2 Reverse -111 -118 15.28 0.0102
NP_441558.1_5 Reverse -107 -126 22.7139 0.00172
NP_440209.1_1 Reverse -109 -117 18.1123 0.00295
NP_440209.1_1 Forward -118 -110 18.1123 0.00295
NP_442889.1_8 Reverse -106 -120 17.8952 0.014
NP_440447.1_6 Forward -126 -108 7.39397 0.14
NP_441713.1_1 Forward -124 -105 -8.55534 0.153
NP_440178.1_7 Forward -119 -100 -12.2919 0.118
NP_442570.1_3 Forward -256 -237 -7.86702 0.279
NP_439953.1_2 Forward -187 -169 10.2456 0.266
NP_441716.1_1 Reverse -172 -186 7.66941 0.163
NP_442111.1_4 Forward -119 -105 9.93102 0.0575
NP_442111.1_4 Reverse -108 -122 8.35772 0.0758
NP_440343.1_6 Forward -260 -241 10.0292 0.291
NP_440906.1_5 Forward -117 -110 15.8704 0.0124
NP_440906.1_5 Reverse -110 -117 15.8704 0.0124
NP_440012.1_6 Forward -129 -110 6.19431 0.299
NP_440747.1_10 Forward -121 -109 14.887 0.00223
NP_440747.1_10 Reverse -106 -118 -2.02597 0.0196
NP_441486.1_1 Reverse -106 -120 5.80112 0.0344
NP_441486.1_1 Forward -121 -107 4.22782 0.0475
NP_441486.1_1 Reverse -189 -203 -2.65535 0.175
NP_442634.1_4 Forward -120 -106 -1.96703 0.149
NP_440842.1_10 Reverse -235 -249 1.96621 0.281
NP_441014.1_10 Forward -119 -100 2.35861 0.216
NP_442848.1_1 Reverse -103 -117 -1.27871 0.263
NP_442848.1_1 Forward -124 -110 -1.67204 0.263
NP_442848.1_5 Forward -182 -164 4.24738 0.276
NP_443018.1_3 Forward -117 -110 14.8871 0.0123
NP_443018.1_3 Reverse -110 -117 14.8871 0.0123
NP_443018.1_3 Forward -200 -193 10.6589 0.0967
NP_443018.1_3 Reverse -193 -200 4.16902 0.278
NP_441634.1_1 Forward -252 -233 -3.44213 0.275
NP_441634.1_8 Forward -249 -235 4.12949 0.135
NP_440376.1_1 Forward -118 -109 19.4693 0.000692
NP_440376.1_1 Reverse -109 -118 19.4693 0.000692
NP_441588.1_4 Reverse -111 -121 15.9097 0.0369
NP_442687.1_7 Reverse -108 -118 9.02648 0.0994
NP_442687.1_7 Forward -119 -109 8.92815 0.0994
NP_442485.1_3 Reverse -233 -252 -3.54046 0.276
NP_441846.1_2 Forward -211 -192 14.6499 0.19
NP_441846.1_10 Forward -271 -252 29.1054 0.00016
NP_440642.1_10 Reverse -170 -184 1.27731 0.296
NP_442296.1_5 Reverse -310 -329 4.12936 0.251
NP_442296.1_9 Reverse -226 -245 -3.83545 0.259
NP_442658.1_1 Reverse -107 -117 13.0576 0.04
NP_442658.1_1 Forward -120 -110 6.76441 0.214
NP_442782.1_2 Forward -195 -181 4.52282 0.252
NP_442205.1_9 Reverse -103 -119 4.18844 0.159
NP_440656.1_8 Reverse -98 -117 1.47442 0.124
NP_441414.1_9 Reverse -109 -128 -0.197208 0.0875
NP_441414.1_9 Forward -300 -281 -6.98204 0.208
NP_443061.1_4 Reverse -324 -343 8.45592 0.205
NP_441487.1_9 Forward -119 -100 -0.983855 0.27
NP_442937.1_5 Forward -123 -104 15.4374 0.0581
NP_441958.1_5 Reverse -108 -118 21.2195 0.000805
NP_441958.1_5 Forward -119 -109 12.2714 0.00183
NP_441137.1_2 Forward -251 -237 16.5303 0.269
NP_440203.1_5 Reverse -294 -304 8.63269 0.29
NP_443001.1_7 Reverse -193 -212 6.98095 0.25
NP_441162.1_7 Reverse -359 -378 17.3057 0.0976
NP_439990.1_5 Forward -123 -110 11.0324 0.128
NP_442911.1_2 Forward -128 -109 -3.3438 0.111
NP_442911.1_2 Reverse -99 -118 -10.227 0.273
NP_441580.1_6 Forward -129 -110 1.86774 0.117
NP_440153.1_5 Forward -117 -103 8.16106 0.149
NP_442119.1_6 Forward -120 -101 7.27595 0.21
NP_442064.1_4 Forward -128 -109 10.7167 0.195
NP_443055.1_6 Reverse -164 -182 -2.04653 0.287
NP_440993.1_2 Reverse -104 -120 6.45005 0.218
NP_441348.1_7 Forward -258 -239 6.98095 0.289
NP_441099.1_5 Forward -128 -109 5.99764 0.0469
NP_442002.1_9 Reverse -130 -137 9.77388 0.258
NP_441294.1_7 Reverse -322 -336 10.2105 0.205
NP_441504.1_2 Forward -396 -379 16.6568 0.0961
NP_441646.1_1 Reverse -165 -184 -1.57384 0.291
NP_442438.1_10 Forward -123 -109 1.08123 0.206
NP_441752.1_6 Reverse -146 -165 -1.57384 0.29
NP_441000.1_6 Reverse -224 -238 1.96621 0.156
NP_442771.1_1 Forward -255 -237 -8.92897 0.21
NP_442771.1_1 Reverse -163 -181 -10.0106 0.239
NP_440147.1_4 Forward -120 -107 10.7374 0.0355
NP_440147.1_4 Reverse -107 -120 3.75586 0.181
NP_440147.1_4 Forward -100 -87 3.16588 0.193
NP_441550.1_8 Forward -120 -110 14.6309 0.0132
NP_441550.1_8 Reverse -107 -117 13.0576 0.0273
NP_441550.1_8 Reverse -190 -200 4.69947 0.291
NP_441916.1_7 Forward -118 -108 18.9579 0.00144
NP_441916.1_7 Reverse -109 -119 10.3048 0.0261
NP_441916.1_10 Reverse -101 -120 4.81767 0.221
NP_440206.1_4 Reverse -253 -272 -1.96793 0.293
NP_441041.1_4 Reverse -109 -128 9.0459 0.0331
NP_441041.1_4 Reverse -366 -385 -13.3736 0.285
NP_442396.1_5 Forward -122 -109 12.114 0.0913
NP_442004.1_6 Reverse -109 -123 8.94771 0.14
NP_440703.1_9 Forward -180 -167 7.39353 0.259
NP_441725.1_4 Reverse -104 -118 1.96562 0.3
NP_441725.1_5 Forward -117 -107 11.1898 0.0247
NP_441725.1_5 Reverse -110 -120 2.04498 0.115
NP_439966.1_7 Reverse -107 -117 14.8275 0.0177
NP_439966.1_7 Forward -120 -110 7.25606 0.15
NP_439966.1_7 Reverse -364 -374 5.48612 0.22
NP_439966.1_9 Forward -346 -337 4.52295 0.253
NP_442941.1_3 Forward -117 -107 19.9412 0.00262
NP_442941.1_3 Reverse -110 -120 11.0914 0.0116
NP_440289.1_2 Reverse -106 -119 3.85419 0.0735
NP_440983.1_5 Reverse -109 -128 2.65439 0.199
NP_440260.1_8 Forward -127 -109 2.28076 0.182
NP_440260.1_8 Forward -256 -238 -3.22577 0.25
NP_442281.1_1 Forward -206 -192 13.8636 0.0233
NP_442281.1_1 Reverse -104 -118 9.24208 0.0726
NP_442281.1_1 Forward -123 -109 7.57046 0.0969
NP_442281.1_1 Reverse -309 -323 2.5556 0.263
NP_440177.1_9 Reverse -101 -120 11.8975 0.243
NP_442012.1_1 Forward -278 -259 0.982764 0.226
NP_441087.1_6 Forward -40 -22 -2.9315 0.296
NP_441556.1_4 Reverse -112 -131 17.8141 0.113
NP_441556.1_10 Forward -240 -226 10.2218 0.273
NP_440498.1_1 Reverse -100 -118 5.23069 0.109
NP_442982.1_5 Reverse -99 -118 -2.0655 0.281
NP_443030.1_4 Forward -387 -368 -2.65548 0.251
NP_442068.1_4 Reverse -283 -302 10.9134 0.164
NP_441644.1_6 Forward -118 -108 19.0557 0.000803
NP_441644.1_6 Reverse -109 -119 17.3841 0.00127
NP_441644.1_6 Forward -201 -191 10.5993 0.0628
NP_441644.1_6 Forward -32 -22 6.0761 0.167
NP_440652.1_10 Forward -189 -170 3.14605 0.283
NP_442215.1_2 Forward -337 -321 -5.15301 0.246
NP_442215.1_2 Forward -210 -194 -7.41462 0.294
NP_442177.1_5 Reverse -202 -216 10.226 0.229
NP_442029.1_6 Forward -276 -257 4.22769 0.271
NP_442247.1_8 Forward -120 -106 8.35772 0.273
NP_440253.1_2 Forward -118 -100 4.54237 0.102
NP_440929.1_8 Forward -118 -109 19.2726 0.000701
NP_440929.1_8 Reverse -109 -118 19.2726 0.000701
NP_442933.1_10 Forward -118 -109 17.601 0.00325
NP_442933.1_10 Reverse -109 -118 17.601 0.00325
NP_441751.2_8 Forward -117 -103 -1.67204 0.13
NP_442554.1_8 Forward -117 -107 16.9913 0.0065
NP_442554.1_8 Reverse -110 -120 15.3197 0.00882
NP_442554.1_8 Forward -379 -369 2.04498 0.285
NP_442554.1_9 Forward -232 -213 12.2158 0.281
NP_441762.1_7 Reverse -108 -120 0.530633 0.0747
NP_441762.1_7 Forward -119 -107 -6.94252 0.284
NP_442142.1_4 Reverse -106 -119 5.62358 0.187
NP_442142.1_4 Forward -121 -108 3.55864 0.251
NP_442292.1_1 Reverse -110 -119 18.486 0.00229
NP_442292.1_1 Forward -117 -108 17.5026 0.00435
NP_442476.1_6 Reverse -110 -124 2.94952 0.169
NP_440895.1_6 Forward -124 -111 8.77074 0.246
NP_443009.1_5 Forward -119 -108 14.5128 0.02
NP_443009.1_5 Reverse -108 -119 10.1862 0.0792
NP_442301.1_2 Reverse -309 -328 3.53858 0.293
NP_442408.2_1 Forward -118 -99 -5.40875 0.27
NP_441715.1_4 Forward -117 -107 14.238 0.0295
NP_441715.1_4 Reverse -110 -120 7.94484 0.107
NP_441715.1_4 Reverse -283 -293 5.48657 0.2
NP_440279.1_2 Forward -258 -239 4.62101 0.298
NP_441198.1_8 Reverse -107 -117 13.2713 0.108
NP_440464.1_10 Reverse -110 -120 13.0082 0.169
NP_441468.1_1 Forward -117 -110 15.8704 0.0124
NP_441468.1_1 Reverse -110 -117 15.8704 0.0124
NP_441468.1_1 Forward -200 -193 3.97235 0.277
NP_441020.2_6 Forward -120 -103 10.0686 0.154
NP_441673.1_1 Forward -118 -109 20.8459 0.000698
NP_441673.1_1 Reverse -109 -118 20.8459 0.000698
NP_442253.1_5 Reverse -168 -185 2.89044 0.152
NP_442253.1_5 Forward -184 -167 0.432165 0.203
NP_441426.1_3 Reverse -291 -310 13.7649 0.256
NP_441330.1_1 Reverse -104 -123 7.07928 0.0252
NP_441764.1_8 Reverse -12 -22 14.5647 0.284
NP_442868.1_6 Forward -120 -110 9.81313 0.038
NP_442868.1_6 Reverse -107 -117 1.06167 0.205
NP_441612.1_2 Reverse -109 -119 8.54929 0.21
NP_441612.1_2 Forward -181 -171 7.96841 0.239
NP_442427.1_8 Reverse -100 -119 6.58763 0.236
NP_441911.1_10 Reverse -380 -399 7.59493 0.274
NP_442808.1_1 Reverse -108 -118 8.73102 0.0481
NP_442808.1_1 Forward -119 -109 8.63269 0.0481
NP_442808.1_1 Reverse -290 -300 4.01116 0.212
NP_441101.1_10 Reverse -221 -240 -7.96535 0.295
NP_440145.1_3 Reverse -99 -118 3.53937 0.103
NP_442718.1_2 Reverse -14 -33 -3.44213 0.291
NP_442050.1_5 Reverse -107 -117 18.0724 0.00365
NP_442050.1_5 Forward -120 -110 7.64939 0.243
NP_441114.1_3 Reverse -173 -182 7.86621 0.231
NP_440558.1_2 Reverse -168 -187 13.1758 0.072
NP_440558.1_2 Forward -184 -165 6.88262 0.127
NP_440558.1_2 Reverse -100 -119 -2.55715 0.229
NP_441878.1_6 Reverse -108 -118 10.5014 0.0176
NP_441878.1_6 Forward -119 -109 10.4031 0.0176
NP_441036.1_8 Reverse -108 -118 15.713 0.00724
NP_441036.1_8 Forward -119 -109 8.33817 0.174
NP_442650.1_2 Reverse -109 -123 8.55439 0.13
NP_441557.1_5 Forward -118 -109 19.9609 0.000699
NP_441557.1_5 Reverse -109 -118 19.9609 0.000699
NP_442777.1_10 Reverse -312 -331 13.5691 0.272
NP_442419.1_2 Forward -123 -104 -1.96717 0.246
NP_441308.1_8 Reverse -107 -117 13.353 0.218
NP_440101.1_3 Forward -258 -239 0.982764 0.287
NP_441564.1_2 Reverse -88 -107 -0.197208 0.216
NP_442183.1_1 Forward -118 -104 19.0758 0.0065
NP_442183.1_1 Reverse -109 -123 7.76774 0.131
NP_442397.1_9 Reverse -109 -128 3.04771 0.264
NP_440356.1_1 Reverse -289 -308 17.4032 0.165
NP_441459.1_8 Forward -125 -112 11.1307 0.286
NP_441549.1_9 Forward -298 -280 -2.43913 0.198
NP_441467.1_5 Reverse -128 -138 16.893 0.222
NP_442347.1_2 Reverse -110 -119 12.4878 0.056
NP_442347.1_2 Forward -117 -108 3.34298 0.284
NP_442645.1_2 Reverse -101 -120 -13.9635 0.168
NP_442645.1_2 Forward -126 -107 -22.125 0.29
NP_442965.1_2 Reverse -84 -103 -7.37537 0.268
NP_442888.1_6 Reverse -247 -266 1.76941 0.277
NP_441037.1_4 Forward -120 -110 7.9999 0.237
NP_441037.1_4 Reverse -107 -117 7.31769 0.237
NP_442508.1_8 Reverse -191 -208 10.8552 0.266
NP_442508.1_8 Reverse -114 -131 9.08529 0.292
NP_441633.1_3 Forward -120 -107 1.00259 0.11
NP_441633.1_3 Forward -293 -280 -6.96221 0.283
NP_440136.1_1 Forward -87 -71 12.7425 0.238
NP_440136.1_2 Forward -117 -110 15.9687 0.0123
NP_440136.1_2 Reverse -110 -117 15.9687 0.0123
NP_442998.1_5 Reverse -243 -253 10.7964 0.204
NP_442998.1_5 Reverse -390 -400 8.53483 0.261
NP_442998.1_10 Forward -116 -109 15.5754 0.0102
NP_442998.1_10 Reverse -111 -118 15.5754 0.0102
NP_442998.1_10 Reverse -188 -195 7.21728 0.144
NP_440899.1_1 Reverse -308 -327 8.70022 0.23
NP_440899.1_1 Reverse -98 -117 8.30985 0.231
NP_440899.1_8 Forward -144 -125 -5.31042 0.231
NP_440899.1_8 Forward -106 -87 -8.45701 0.254
NP_440299.1_1 Forward -122 -109 22.7331 0.000547
NP_440299.1_1 Forward -30 -17 12.5067 0.0369
NP_440299.1_1 Reverse -105 -118 3.95196 0.224
NP_441799.1_1 Reverse -105 -119 11.2087 0.0606
NP_441799.1_1 Forward -122 -108 7.96378 0.128
NP_441007.1_10 Forward -123 -110 1.00259 0.209
NP_441007.1_10 Reverse -104 -117 0.904263 0.212
NP_442334.1_2 Forward -184 -167 -5.86102 0.214
NP_442334.1_2 Forward -301 -284 -6.746 0.264
NP_440256.1_1 Forward -121 -102 4.52268 0.0435
NP_440256.1_1 Reverse -189 -208 -0.0988766 0.0893
NP_440256.1_1 Reverse -106 -125 -1.08219 0.0997
NP_441559.1_8 Reverse -257 -271 -6.29359 0.276
NP_441270.1_5 Reverse -192 -211 11.5304 0.289
NP_440915.1_6 Forward -122 -108 12.4876 0.0208
NP_440915.1_6 Forward -264 -250 -0.0987402 0.182
NP_442855.1_8 Forward -187 -168 16.8141 0.234
NP_441179.1_9 Reverse -34 -44 16.7941 0.236
NP_442785.1_7 Reverse -107 -121 10.4227 0.228
NP_441704.1_8 Forward -129 -110 12.585 0.122
NP_442866.1_1 Forward -340 -321 -9.34199 0.292
NP_440306.1_5 Reverse -2 -21 -0.787193 0.274
NP_442993.1_1 Forward -118 -102 0.0585348 0.0668
NP_442993.1_1 Forward -260 -244 -1.61309 0.0952
NP_442993.1_1 Forward -375 -359 -9.5779 0.188
NP_442993.1_1 Forward -374 -358 -12.9212 0.282
NP_440677.1_6 Forward -303 -284 9.83255 0.27
NP_442386.1_9 Forward -119 -110 13.8639 0.0289
NP_442386.1_9 Forward -202 -193 10.8157 0.116
NP_442386.1_9 Forward -182 -173 6.68581 0.219
NP_442386.1_9 Reverse -108 -117 6.39082 0.219
NP_442386.1_9 Reverse -237 -246 5.0142 0.27
NP_441340.1_5 Forward -117 -110 15.6737 0.0124
NP_441340.1_5 Reverse -110 -117 15.6737 0.0124
NP_441340.1_5 Reverse -193 -200 11.3472 0.0526
NP_442484.1_2 Forward -129 -110 19.5673 0.0181
NP_440327.1_6 Reverse -193 -212 5.50599 0.26
NP_442240.1_1 Forward -34 -15 4.22689 0.273
NP_442950.1_1 Reverse -63 -82 4.71934 0.178
NP_440586.1_8 Forward -117 -110 13.2151 0.026
NP_440586.1_8 Reverse -110 -117 13.2151 0.026
NP_440586.1_8 Forward -200 -193 5.74197 0.283
NP_442251.1_6 Forward -117 -110 15.2804 0.0124
NP_442251.1_6 Reverse -110 -117 15.2804 0.0124
NP_442251.1_6 Reverse -283 -290 8.10225 0.245
NP_440192.1_5 Forward -329 -310 14.4541 0.116
NP_440684.1_9 Forward -124 -110 8.16106 0.235
NP_441262.1_3 Reverse -109 -116 14.7888 0.0223
NP_441262.1_3 Forward -118 -111 14.7888 0.0223
NP_443051.1_1 Reverse -108 -117 19.5676 0.00335
NP_443051.1_1 Forward -119 -110 10.4228 0.00754
NP_439996.1_6 Forward -329 -310 7.71894 0.257
NP_441232.1_10 Forward -129 -110 0.58944 0.296
NP_439937.1_9 Reverse -171 -188 -15.6947 0.287
NP_441657.1_5 Reverse -182 -201 -0.197208 0.238
NP_440926.1_9 Reverse -69 -88 9.73422 0.275
NP_440408.1_7 Reverse -17 -36 9.14423 0.264
NP_440408.1_7 Reverse -186 -205 8.16093 0.282
NP_440408.1_7 Reverse -103 -122 7.17762 0.291
NP_440439.1_1 Reverse -106 -119 1.78924 0.143
NP_440372.1_2 Forward -117 -110 16.3621 0.0124
NP_440372.1_2 Reverse -110 -117 16.3621 0.0124
NP_441789.1_7 Reverse -253 -272 4.42355 0.193
NP_441789.1_7 Reverse -290 -309 -3.93454 0.28
NP_441789.1_7 Reverse -252 -271 -4.81951 0.288
NP_441803.1_2 Forward -246 -227 3.24438 0.194
NP_441803.1_2 Reverse -104 -123 0.196116 0.258
NP_439977.1_5 Forward -124 -105 2.94938 0.164
NP_441572.1_7 Reverse -308 -327 -4.32711 0.232
NP_440267.1_2 Reverse -104 -118 10.0287 0.153
NP_442384.1_10 Reverse -109 -122 17.7189 0.00567
NP_442384.1_10 Forward -118 -105 6.80412 0.0939
NP_442114.1_8 Reverse -5 -19 3.93223 0.281
NP_441877.1_5 Forward -291 -272 0.392778 0.276
NP_441877.1_7 Reverse -104 -123 3.34192 0.218
NP_441018.1_7 Forward -332 -313 8.94757 0.239
NP_441018.1_7 Forward -190 -171 6.39097 0.289
NP_442790.1_4 Forward -300 -281 -9.34199 0.183
NP_442262.1_10 Forward -117 -110 14.1988 0.0123
NP_442262.1_10 Reverse -110 -117 14.1988 0.0123
NP_442262.1_10 Forward -200 -193 12.0355 0.062
NP_441689.1_5 Reverse -107 -117 17.8758 0.0158
NP_441689.1_5 Forward -120 -110 5.78111 0.197
NP_440344.1_10 Forward -125 -108 -0.157821 0.0391
NP_442910.1_1 Forward -279 -260 0.294447 0.168
NP_442910.1_1 Forward -125 -106 -6.39206 0.254
NP_440562.1_10 Reverse -350 -368 12.0155 0.206
NP_441965.1_3 Forward -128 -109 3.83436 0.181
NP_441965.1_10 Reverse -288 -304 10.4816 0.107
NP_441965.1_10 Reverse -106 -122 4.48343 0.238
NP_440297.1_8 Forward -188 -170 10.9339 0.254
NP_440297.1_9 Forward -117 -107 9.22315 0.0917
NP_440297.1_9 Reverse -110 -120 -0.118297 0.282
NP_440297.1_9 Forward -200 -190 -0.511621 0.289
NP_440297.1_9 Forward -233 -223 -0.609952 0.292
NP_440350.1_2 Forward -202 -183 6.88262 0.248
NP_441592.1_4 Reverse -109 -128 2.94938 0.186
NP_441592.1_4 Reverse -238 -257 -4.13045 0.296
NP_441896.1_3 Forward -127 -108 -1.47551 0.26
NP_440937.1_5 Forward -341 -322 13.1758 0.275
NP_440937.1_5 Reverse -192 -211 10.3242 0.275
NP_440999.1_9 Forward -295 -281 3.34284 0.131
NP_440888.1_2 Forward -118 -104 13.9619 0.022
NP_440888.1_2 Reverse -109 -123 11.602 0.0635
NP_440888.1_2 Reverse -172 -186 6.29216 0.241
NP_440803.1_10 Forward -262 -243 19.469 0.168
NP_440600.1_4 Reverse -101 -119 -5.48739 0.28
NP_440600.1_4 Forward -126 -108 -7.84733 0.294
NP_440491.1_1 Reverse -147 -166 6.7221 0.289
NP_440052.1_5 Forward -129 -110 -0.4922 0.191
NP_442033.1_7 Reverse -161 -180 16.368 0.277
NP_441543.1_2 Reverse -110 -119 16.9127 0.00359
NP_441543.1_2 Forward -117 -108 15.9293 0.00518
NP_442845.1_2 Forward -124 -110 15.2409 0.0752
NP_442845.1_2 Forward -253 -239 5.99778 0.219
NP_442845.1_2 Forward -334 -320 3.73617 0.279
NP_442845.1_2 Reverse -103 -117 3.34284 0.294
NP_441469.1_8 Reverse -108 -117 6.5879 0.227
NP_441469.1_8 Forward -119 -110 6.48957 0.227
NP_441469.1_8 Forward -235 -226 5.70292 0.257
NP_443064.1_6 Reverse -109 -119 12.5669 0.0796
NP_443064.1_6 Forward -118 -108 10.8217 0.13
NP_441306.1_10 Reverse -122 -136 11.9953 0.263
NP_442578.1_7 Forward -117 -110 14.5921 0.026
NP_442578.1_7 Reverse -110 -117 14.5921 0.026
NP_440710.1_1 Reverse -101 -119 4.14905 0.113
NP_440071.1_2 Forward -184 -170 18.4858 0.24
NP_440071.1_4 Forward -353 -334 11.9958 0.265
NP_440220.1_4 Forward -58 -39 -2.8529 0.282
NP_441462.1_2 Forward -118 -108 20.2362 0.000805
NP_441462.1_2 Reverse -109 -119 11.5831 0.00406
NP_443062.1_1 Forward -118 -100 8.64343 0.15
NP_441601.1_2 Reverse -283 -302 -4.72043 0.289
NP_441410.1_4 Forward -256 -237 15.6332 0.183
NP_440519.1_6 Forward -37 -23 14.5526 0.29
NP_442204.1_1 Reverse -105 -116 0.0586712 0.284
NP_442204.1_1 Reverse -270 -281 -0.137991 0.286
NP_440504.1_7 Forward -186 -167 -2.85214 0.244
NP_441351.1_8 Reverse -236 -255 7.37428 0.192
NP_441351.1_8 Reverse -107 -126 0.982764 0.276
NP_440516.1_8 Forward -118 -109 16.9127 0.00442
NP_440516.1_8 Reverse -109 -118 16.9127 0.00442
NP_442428.1_5 Forward -117 -110 15.8704 0.0124
NP_442428.1_5 Reverse -110 -117 15.8704 0.0124
NP_442428.1_5 Forward -233 -226 7.90559 0.0969
NP_442428.1_5 Forward -200 -193 4.36568 0.271
NP_441790.1_10 Reverse -263 -282 16.3224 0.207
NP_441867.1_2 Forward -344 -325 -6.58872 0.189
NP_440603.1_9 Forward -252 -233 9.53756 0.217
NP_440673.1_2 Forward -128 -109 9.41407 0.245
NP_440673.1_3 Forward -116 -109 12.4288 0.0426
NP_440673.1_3 Reverse -111 -118 12.4288 0.0426
NP_440673.1_3 Forward -30 -23 6.23397 0.283
NP_441052.1_2 Reverse -109 -119 19.9412 0.00106
NP_441052.1_2 Forward -118 -108 10.4031 0.0285
NP_441052.1_2 Reverse -291 -301 2.7333 0.193
NP_441052.1_2 Reverse -172 -182 2.33998 0.209
NP_442219.1_8 Forward -128 -109 7.20077 0.275
NP_442219.1_9 Reverse -110 -119 17.7976 0.00718
NP_442219.1_9 Forward -117 -108 8.25953 0.0681
NP_440436.1_4 Reverse -110 -119 17.2072 0.00233
NP_440436.1_4 Forward -117 -108 9.24241 0.0871
NP_440436.1_4 Forward -393 -384 5.50585 0.195
NP_440436.1_4 Reverse -193 -202 4.42421 0.265
NP_440314.1_9 Forward -117 -98 3.93269 0.0822
NP_440648.1_1 Reverse -150 -169 12.2908 0.116
NP_441719.1_2 Forward -121 -107 16.4239 0.191
NP_441719.1_4 Forward -117 -110 16.3621 0.0124
NP_441719.1_4 Reverse -110 -117 16.3621 0.0124
NP_441004.1_1 Forward -276 -257 -8.752 0.202
NP_441004.1_1 Forward -277 -258 -15.1435 0.273
NP_441004.1_5 Forward -304 -290 8.55439 0.274
NP_442813.1_5 Forward -258 -239 2.55606 0.275
NP_442366.1_3 Reverse -164 -182 -1.55415 0.215
NP_442366.1_3 Reverse -191 -209 -1.94747 0.219
NP_442366.1_5 Forward -121 -111 15.4175 0.0374
NP_442873.1_3 Reverse -253 -272 8.35677 0.201
NP_442206.1_7 Forward -182 -163 9.0459 0.295
NP_443054.1_2 Reverse -107 -121 1.57289 0.245
NP_440508.1_2 Forward -192 -173 13.0964 0.281
NP_441851.1_10 Forward -119 -109 15.8113 0.00552
NP_441851.1_10 Reverse -108 -118 8.53483 0.114
NP_441851.1_10 Reverse -28 -38 7.55152 0.137
NP_442001.1_4 Reverse -317 -336 12.9783 0.189
NP_442622.1_1 Forward -134 -115 -12.8819 0.281
NP_442856.1_7 Forward -243 -224 -6.29373 0.297
NP_441668.1_4 Forward -194 -175 -1.7705 0.28
NP_442515.1_1 Forward -119 -105 11.996 0.0362
NP_442515.1_1 Reverse -325 -339 -1.37704 0.253
NP_442515.1_1 Reverse -108 -122 -4.22864 0.298
NP_441349.1_10 Reverse -99 -118 5.99764 0.0388
NP_441409.1_6 Forward -124 -105 -8.65367 0.172
NP_442314.1_3 Reverse -340 -354 14.0609 0.277
NP_440432.1_9 Forward -117 -102 5.97809 0.0486
NP_442843.1_1 Forward -200 -181 -0.885524 0.192
NP_442843.1_1 Forward -316 -297 -10.3253 0.277
NP_440474.1_8 Forward -117 -103 4.8172 0.266
NP_440396.1_10 Reverse -327 -343 10.2842 0.236
NP_440726.1_2 Reverse -275 -294 3.83436 0.226
NP_441477.1_4 Forward -178 -159 12.7825 0.28
NP_440431.1_3 Reverse -108 -127 -1.67217 0.16
NP_442450.1_5 Reverse -107 -117 9.41981 0.115
NP_442450.1_5 Forward -120 -110 7.55152 0.13
NP_442168.1_5 Reverse -264 -283 -3.93378 0.297
NP_440954.1_1 Forward -260 -241 -11.8003 0.295
NP_442006.1_2 Reverse -80 -97 -9.40093 0.197
NP_441570.1_1 Forward -118 -100 0.609134 0.0379
NP_441570.1_1 Reverse -109 -127 -6.86402 0.0823
NP_441570.1_1 Forward -201 -183 -7.749 0.0949
NP_441078.1_4 Forward -118 -109 19.6659 0.0007
NP_441078.1_4 Reverse -109 -118 19.6659 0.0007
NP_442729.1_7 Forward -295 -277 14.1788 0.183
NP_442729.1_8 Forward -122 -109 9.36073 0.125
NP_442443.1_4 Reverse -388 -398 15.1225 0.179
NP_440526.1_3 Reverse -110 -121 1.04151 0.267
NP_441432.1_8 Reverse -108 -117 16.8143 0.00595
NP_441432.1_8 Forward -119 -110 16.8143 0.00595
NP_441432.1_8 Reverse -22 -31 2.75299 0.287
NP_442320.1_8 Forward -124 -110 15.7325 0.0102
NP_442320.1_8 Reverse -103 -117 3.8345 0.0578
NP_442320.1_8 Forward -207 -193 -6.39192 0.283
NP_442344.1_7 Reverse -110 -129 -5.01543 0.168
NP_442344.1_7 Forward -117 -98 -6.58872 0.171
NP_441732.1_2 Reverse -105 -121 -7.0213 0.0614
NP_441732.1_2 Forward -122 -106 -16.4611 0.167
NP_440760.1_1 Reverse -109 -128 4.62101 0.0156
NP_442797.1_7 Reverse -256 -274 -0.275845 0.282
NP_442510.1_5 Forward -127 -108 14.3558 0.22
NP_440713.1_4 Forward -128 -109 4.22769 0.231
NP_442489.1_7 Forward -118 -109 20.1576 0.000695
NP_442489.1_7 Reverse -109 -118 20.1576 0.000695
NP_442079.1_7 Reverse -110 -129 2.26107 0.232
NP_442079.1_7 Forward -200 -181 0.0977854 0.287
NP_442079.1_7 Forward -117 -98 -0.000545616 0.287
NP_440559.1_1 Reverse -110 -119 17.4043 0.00658
NP_440559.1_1 Forward -117 -108 8.65285 0.0586
NP_441659.2_8 Forward -118 -108 20.9245 0.000805
NP_441659.2_8 Reverse -109 -119 18.1713 0.00133
NP_441659.2_8 Forward -201 -191 -0.314959 0.298
NP_442913.1_10 Reverse -100 -119 -0.39387 0.159
NP_442008.1_2 Forward -315 -296 3.04771 0.266
NP_440708.1_6 Reverse -293 -312 -8.26035 0.258
NP_442346.1_1 Reverse -193 -212 11.5042 0.27
NP_442346.1_5 Forward -119 -109 16.6963 0.00248
NP_442346.1_5 Reverse -108 -118 16.303 0.00248
NP_440352.1_5 Reverse -380 -399 15.7705 0.117
NP_440545.1_3 Forward -122 -105 -5.66436 0.256
NP_440545.1_4 Forward -165 -146 18.584 0.184
NP_440545.1_5 Reverse -168 -185 7.41366 0.21
NP_440025.1_3 Forward -113 -99 14.5801 0.235
NP_440459.1_2 Forward -127 -110 9.57695 0.224
NP_440010.1_2 Forward -206 -187 16.1249 0.298
NP_441047.1_2 Reverse -110 -129 -2.75381 0.281
NP_441833.1_4 Forward -117 -110 15.9687 0.0124
NP_441833.1_4 Reverse -110 -117 15.9687 0.0124
NP_442799.1_4 Reverse -363 -382 7.47261 0.286
NP_441895.1_10 Reverse -96 -115 -27.7299 0.29
NP_442162.1_9 Forward -117 -110 16.2637 0.0124
NP_442162.1_9 Reverse -110 -117 16.2637 0.0124
NP_440671.1_4 Reverse -103 -117 6.48943 0.245
NP_440671.1_4 Forward -207 -193 5.21113 0.289
NP_440671.1_9 Forward -50 -37 23.3237 0.0642
NP_441915.1_4 Forward -248 -229 8.25844 0.293
NP_441915.1_4 Forward -247 -228 6.1935 0.293
NP_442140.1_3 Reverse -110 -120 12.2714 0.0632
NP_442140.1_3 Reverse -372 -382 7.74818 0.13
NP_442140.1_3 Forward -246 -236 4.89658 0.238
NP_442021.1_3 Forward -124 -105 -6.58872 0.257
NP_440875.1_9 Forward -29 -19 7.496 0.262
NP_441813.1_5 Reverse -107 -117 15.9097 0.01
NP_441813.1_5 Forward -120 -110 8.63316 0.0367
NP_441813.1_5 Forward -203 -193 3.51995 0.167
NP_440590.1_4 Reverse -110 -123 17.6205 0.00882
NP_440590.1_4 Forward -374 -361 -5.88057 0.293
NP_440567.1_1 Reverse -110 -124 14.4542 0.0187
NP_442497.1_10 Forward -117 -108 17.601 0.00813
NP_442497.1_10 Reverse -110 -119 10.4228 0.0087
NP_440821.1_4 Reverse -107 -117 11.0914 0.0146
NP_440821.1_4 Forward -120 -110 9.41981 0.0286
NP_441239.1_9 Reverse -107 -119 12.1337 0.0494
NP_441239.1_9 Forward -203 -191 5.84051 0.206
NP_441239.1_9 Forward -120 -108 3.38223 0.285
NP_441727.1_3 Forward -125 -106 19.0757 0.103
NP_441892.1_1 Reverse -299 -316 -3.79607 0.249
NP_441892.1_1 Forward -309 -292 -5.27103 0.276
NP_442270.1_9 Forward -129 -110 -5.70374 0.207
NP_442643.1_3 Forward -201 -182 -7.76869 0.292
NP_441017.1_6 Forward -205 -191 15.4369 0.103
NP_441017.1_6 Reverse -105 -119 11.2087 0.273
NP_442629.1_5 Forward -190 -176 16.6175 0.222
NP_440863.1_1 Reverse -79 -93 12.8375 0.276
NP_442216.1_4 Forward -107 -99 8.08217 0.255
NP_440949.1_7 Forward -209 -190 8.84842 0.271
NP_440354.1_7 Reverse -186 -204 5.82068 0.297
NP_440546.1_4 Forward -118 -108 13.5365 0.0459
NP_440546.1_4 Reverse -109 -119 10.046 0.109
NP_440462.1_6 Reverse -107 -117 16.893 0.00853
NP_440462.1_6 Forward -203 -193 2.04498 0.294
NP_440462.1_6 Forward -120 -110 1.35667 0.294
NP_440868.1_4 Reverse -105 -117 5.84051 0.0879
NP_440868.1_4 Forward -122 -110 -0.944332 0.284
NP_442479.1_9 Forward -53 -34 -4.6221 0.261
NP_441582.1_5 Forward -293 -274 3.34192 0.266
NP_441474.1_1 Reverse -293 -312 4.03023 0.221
NP_442402.1_9 Reverse -162 -181 9.63589 0.277
NP_441084.1_6 Reverse -107 -121 16.8098 0.0523
NP_441084.1_6 Reverse -272 -286 10.7015 0.231
NP_440696.1_3 Forward -327 -309 0.0191479 0.237
NP_440696.1_3 Forward -257 -239 -3.02911 0.282
NP_442039.1_4 Forward -117 -110 15.1821 0.0124
NP_442039.1_4 Reverse -110 -117 15.1821 0.0124
NP_442039.1_7 Forward -245 -235 14.6313 0.211
NP_442679.1_1 Reverse -86 -105 -0.590531 0.221
NP_442380.1_5 Forward -59 -40 16.4192 0.23
NP_441926.1_3 Forward -118 -102 14.9065 0.0428
NP_440825.1_7 Reverse -110 -120 12.9096 0.152
NP_442837.1_3 Forward -117 -110 15.7721 0.0124
NP_442837.1_3 Reverse -110 -117 15.7721 0.0124
NP_441760.1_4 Forward -317 -299 8.37728 0.266
NP_442053.1_1 Forward -118 -109 18.3876 0.0007
NP_442053.1_1 Reverse -109 -118 18.3876 0.0007
NP_440505.1_3 Reverse -107 -117 15.123 0.014
NP_440505.1_3 Forward -120 -110 9.22315 0.122
NP_440505.1_3 Reverse -342 -352 9.02648 0.128
NP_441102.1_1 Reverse -193 -212 23.4022 0.0146
NP_441203.1_1 Forward -117 -98 -7.86702 0.137
NP_441203.1_1 Reverse -166 -185 -15.2418 0.22
NP_442844.1_5 Forward -21 -2 7.57013 0.259
NP_442532.1_7 Forward -118 -104 1.96621 0.258
NP_441408.2_7 Reverse -107 -126 1.47442 0.215
NP_440914.1_1 Reverse -109 -119 17.5935 0.000537
NP_440914.1_1 Forward -118 -108 16.3248 0.00196
NP_440914.1_1 Forward -201 -191 10.9573 0.116
NP_440914.1_1 Reverse -385 -395 7.15123 0.249
NP_441011.1_8 Forward -117 -108 16.6177 0.00602
NP_441011.1_8 Reverse -110 -119 8.25953 0.144
NP_441011.1_8 Reverse -193 -202 5.01461 0.289
NP_442101.1_10 Reverse -101 -120 -7.08038 0.209
NP_442533.1_6 Forward -118 -109 17.2076 0.00137
NP_442533.1_6 Reverse -109 -118 17.2076 0.00137
NP_442533.1_6 Reverse -172 -181 6.48957 0.109
NP_442541.1_10 Reverse -171 -185 2.94893 0.254
NP_442541.1_10 Forward -247 -233 1.27731 0.287
NP_442232.1_3 Reverse -25 -44 -12.8819 0.282
NP_441482.1_7 Reverse -103 -117 13.6676 0.0135
NP_441482.1_7 Forward -124 -110 -0.983719 0.0612
NP_441482.1_7 Reverse -274 -288 -11.7018 0.281
NP_441482.1_7 Reverse -219 -233 -11.9968 0.288
NP_439944.1_9 Forward -117 -107 17.6796 0.00347
NP_439944.1_9 Reverse -110 -120 10.5014 0.0887
NP_441028.1_6 Forward -107 -97 7.15773 0.23
NP_440116.1_5 Forward -121 -104 7.31533 0.155
NP_440116.1_8 Reverse -110 -129 -2.16383 0.126
NP_440116.1_8 Reverse -193 -212 -3.3438 0.151
NP_440116.1_8 Forward -117 -98 -3.44213 0.154
NP_441527.1_7 Forward -27 -8 8.25844 0.284
NP_440007.1_9 Forward -205 -191 3.53951 0.269
NP_440007.1_9 Reverse -362 -376 0.589577 0.294
NP_441170.1_4 Forward -127 -109 14.9655 0.155
NP_441972.1_5 Reverse -110 -129 8.06259 0.0748
NP_441106.1_1 Reverse -108 -117 18.486 0.0028
NP_441106.1_1 Forward -119 -110 9.63616 0.0311
NP_441106.1_1 Forward -202 -193 4.52295 0.219
NP_440429.1_4 Reverse -158 -177 11.3075 0.296
NP_439903.1_6 Reverse -106 -125 14.7483 0.0698
NP_442588.1_5 Reverse -376 -395 9.0459 0.269
NP_441286.1_1 Forward -119 -107 14.3953 0.00424
NP_441286.1_1 Reverse -108 -120 3.48056 0.0467
NP_442674.1_3 Forward -308 -289 10.52 0.174
NP_441385.1_1 Forward -263 -248 16.0078 0.28
NP_440670.1_8 Forward -118 -109 18.3876 0.000699
NP_440670.1_8 Reverse -109 -118 18.3876 0.000699
NP_441647.1_8 Reverse -168 -187 13.7649 0.258
NP_440886.1_7 Reverse -108 -118 8.04271 0.0805
NP_440886.1_7 Forward -119 -109 7.94438 0.0805
NP_440886.1_7 Reverse -290 -300 5.19112 0.194
NP_440268.1_10 Reverse -300 -314 17.2075 0.239
NP_440513.1_7 Reverse -300 -319 12.4875 0.296
NP_440223.1_7 Reverse -239 -253 14.4542 0.218
NP_442022.1_4 Forward -259 -240 5.70265 0.279
NP_440907.2_8 Forward -117 -107 9.51767 0.103
NP_440907.2_8 Reverse -110 -120 7.64939 0.117
NP_440326.1_5 Forward -120 -107 15.2606 0.179
NP_440841.1_4 Reverse -107 -126 -0.000545616 0.128
NP_442459.1_2 Reverse -31 -50 14.5524 0.178
NP_441463.1_3 Forward -128 -109 -0.4922 0.133
NP_441463.1_3 Reverse -194 -213 -4.03212 0.191
NP_441463.1_3 Reverse -99 -118 -8.55534 0.271
NP_441463.1_6 Reverse -107 -121 6.99573 0.265
NP_441626.1_2 Forward -117 -110 15.7721 0.0124
NP_441626.1_2 Reverse -110 -117 15.7721 0.0124
NP_442365.1_7 Forward -122 -103 -3.73712 0.222
NP_442794.1_1 Forward -122 -110 19.1152 0.00716
NP_442615.1_1 Forward -127 -109 -0.570838 0.118
NP_442615.1_1 Reverse -100 -118 -1.94747 0.136
NP_441962.1_4 Forward -123 -104 -6.98204 0.184
NP_440387.1_1 Forward -118 -102 15.9882 0.00482
NP_440387.1_1 Reverse -109 -125 6.05672 0.0293
NP_440387.1_1 Forward -294 -278 1.5335 0.102
NP_441431.1_3 Forward -193 -174 6.39097 0.254
NP_441488.1_8 Forward -123 -109 10.2254 0.146
NP_441993.1_1 Forward -124 -105 10.9128 0.122
NP_441993.1_1 Forward -317 -298 6.52718 0.179
NP_441993.1_1 Forward -270 -251 0.972113 0.288
NP_440114.1_10 Forward -118 -104 15.3392 0.0264
NP_442090.1_10 Forward -246 -233 10.2457 0.288
NP_441510.2_7 Reverse -17 -31 15.3386 0.28
NP_441510.2_7 Forward -207 -193 9.93039 0.281
NP_441237.1_9 Reverse -110 -120 14.828 0.0242
NP_440643.1_6 Reverse -104 -123 6.19431 0.214
NP_442867.1_8 Forward -388 -369 12.2908 0.197
NP_442867.1_8 Forward -286 -267 7.47261 0.244
NP_440457.1_1 Forward -264 -252 11.052 0.092
NP_440457.1_1 Reverse -105 -117 0.137309 0.25
NP_440213.1_5 Forward -129 -110 7.07928 0.297
NP_442940.1_2 Reverse -109 -128 -1.27885 0.298
NP_442680.1_5 Reverse -87 -106 0.462991 0.266
NP_441984.1_3 Reverse -105 -123 10.3439 0.187
NP_441889.1_4 Forward -262 -243 9.53756 0.101
NP_441889.1_4 Reverse -156 -175 3.83436 0.234
NP_440473.1_9 Forward -302 -283 -6.68705 0.236
NP_442509.1_9 Reverse -109 -119 8.14104 0.192
NP_442509.1_9 Forward -118 -108 8.04271 0.192
NP_442509.1_9 Forward -375 -365 7.45273 0.219
NP_442509.1_9 Reverse -149 -159 6.17443 0.286
NP_442582.1_8 Forward -262 -244 9.0656 0.213
NP_442514.1_5 Reverse -229 -248 -9.83437 0.298
NP_440554.1_4 Forward -117 -107 16.1063 0.0189
NP_440554.1_4 Reverse -193 -203 4.0116 0.205
NP_442862.1_3 Forward -288 -271 7.31533 0.258
NP_441885.1_5 Reverse -109 -119 20.9245 0.000538
NP_441885.1_5 Forward -118 -108 11.3864 0.00668
NP_440628.1_1 Reverse -8 -18 13.0046 0.292
NP_442341.1_7 Reverse -108 -122 8.94771 0.0801
NP_442341.1_9 Reverse -107 -121 9.24208 0.155
NP_440423.1_6 Reverse -81 -100 -19.6667 0.243
NP_443000.1_7 Reverse -107 -117 17.4829 0.00719
NP_443000.1_7 Forward -120 -110 10.3048 0.0345
NP_440507.2_3 Reverse -100 -119 7.17681 0.286
NP_441842.1_10 Forward -125 -111 11.3077 0.134
NP_441842.1_10 Reverse -82 -96 10.226 0.167
NP_440275.1_3 Reverse -107 -117 9.12481 0.055
NP_440275.1_3 Forward -120 -110 8.04317 0.0602
NP_440091.1_1 Reverse -105 -117 -0.354346 0.273
NP_441902.1_3 Reverse -98 -108 13.2732 0.23
NP_440679.1_10 Forward -298 -279 -11.5053 0.182
NP_441190.1_2 Reverse -103 -122 0.392778 0.266
NP_442234.1_1 Reverse -15 -34 5.211 0.281
NP_440149.1_8 Reverse -186 -205 4.03102 0.0873
NP_440149.1_8 Reverse -109 -128 2.3594 0.111
NP_441105.1_3 Forward -129 -110 11.6025 0.0363
NP_440216.1_1 Forward -118 -104 5.01447 0.0225
NP_440216.1_1 Reverse -109 -123 -10.6202 0.145
NP_440216.1_9 Reverse -240 -249 8.25953 0.286
NP_440172.1_1 Forward -118 -108 17.5813 0.00421
NP_440172.1_1 Reverse -109 -119 15.0247 0.00945
NP_440172.1_1 Forward -291 -281 2.33998 0.279
NP_442015.1_10 Forward -122 -109 11.229 0.0372
NP_441226.1_7 Forward -117 -110 14.4934 0.0123
NP_441226.1_7 Reverse -110 -117 14.4934 0.0123
NP_441226.1_7 Reverse -193 -200 12.4284 0.0404
NP_441111.1_7 Forward -117 -109 18.7023 0.00294
NP_441111.1_7 Reverse -110 -118 18.7023 0.00294
NP_441766.1_2 Forward -118 -109 17.5026 0.00297
NP_441766.1_2 Reverse -109 -118 17.5026 0.00297
NP_442417.1_5 Forward -118 -104 10.1277 0.124
NP_440416.1_1 Forward -118 -99 -12.6852 0.272
NP_443052.1_8 Reverse -99 -118 -3.93378 0.109
NP_443052.1_9 Forward -100 -81 2.3594 0.172
NP_443052.1_9 Forward -239 -220 -5.80207 0.274
NP_442154.1_1 Forward -255 -237 1.29745 0.0951
NP_442154.1_1 Forward -308 -290 -16.9921 0.247
NP_442154.1_1 Forward -327 -309 -17.0904 0.249
NP_440988.1_10 Reverse -21 -35 10.6108 0.187
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CATTTTTGCCATCCTTCATCTGCTATGGGAACGGCGTTTAACAGCTTACCAACTGCCAGGATTGTGGTTATTGGGCATGGTATTGCTGTGGGCCCGTCTGGTGGATGGCGGTAATCTCGCCCTAGCTTGGGGACTCCACGGGGGGTGGGTTTTTGCCCTGGCGGCCTGTGATGCCACTGGTTTAATTACCTATCCCAACACCGATGGCAATATTTGGGTGGGCAAGGCCAATCAACCTTTAGCCGGTTTAGCTGGCATTATTTGTTTGCTCCTCACTGCTTTGGCGATCGCCTTATTTCCCCATCTATCTCCCCTCTAGCCAGGATTTTAACTCCCTAATTGAACCGAATGATTTTGCTATGATGGTTCCCCGTTGCCATCTTTTCTCTACTTTGTCCCT

CDS

ATGCCAATGTCCCCATCAGTAAGATTTACTGGCTTTCTTCCCCGCCGATTAATGGGCCTTAGTTGGGGCGTTATTTTAATGCTGGCATTGAATCAGGGCTTAATTAGTTGCGGGGCTAGCAAAGCGGATCAATGCCGACAGCTAATTTTAATTACCAAACAAATGGCAGAGGAAGGGGCAAAATATCGAGATACCACCTCAACGGAAGAAGTGCTGAACATGGCCGATGCCTTCGATGCCACCGCCACAAAAATAGAACGACTCAACCTTGAAGATCCAGTGCTAGCTAACTATCAAGGGGAATTGGTCAGTATTTACCAGGGCAATGCGGAGGCCACCCGCACCATGGTCAAAGCCCTGGAAAGTAAAGATATTTTGACGGCCCAGCTTGCCCAAAAACAGGTAGCTACCATTGGCCAGCAGGAGCAACAGGTGATCACCAACATCAATGTCCATTGTCAACAGCCCTAG

Protein

MPMSPSVRFTGFLPRRLMGLSWGVILMLALNQGLISCGASKADQCRQLILITKQMAEEGAKYRDTTSTEEVLNMADAFDATATKIERLNLEDPVLANYQGELVSIYQGNAEATRTMVKALESKDILTAQLAQKQVATIGQQEQQVITNINVHCQQP