Your browser is old and dusty. Try Google Chrome!

Details for sll0359

ORF sll0359
Accession NP_441848.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441976.1_2 Reverse -354 -373 8.4551 0.298
NP_442655.1_2 Reverse -130 -149 3.83436 0.23
NP_442655.1_2 Forward -196 -177 3.44104 0.243
NP_441900.1_2 Reverse -344 -362 -5.58642 0.288
NP_442972.1_1 Reverse -202 -220 8.63517 0.287
NP_440304.1_4 Forward -392 -382 3.71661 0.293
NP_442742.1_9 Reverse -94 -113 -6.49039 0.223
NP_441109.1_3 Reverse -352 -371 11.5033 0.194
NP_441925.1_2 Reverse -54 -73 2.16274 0.268
NP_440769.1_8 Forward -111 -92 10.8159 0.187
NP_441434.1_6 Reverse -50 -60 14.1397 0.288
NP_441434.1_8 Reverse -27 -46 12.6389 0.154
NP_441738.1_2 Reverse -347 -354 9.77352 0.143
NP_441738.1_2 Reverse -310 -317 6.72528 0.236
NP_441327.1_1 Forward -314 -295 3.73283 0.276
NP_441327.1_5 Forward -64 -55 16.6177 0.111
NP_440343.1_3 Reverse -355 -373 11.1298 0.154
NP_440343.1_9 Forward -378 -359 7.7676 0.278
NP_441130.1_10 Reverse -343 -357 4.81781 0.265
NP_441854.1_10 Forward -370 -351 0.392778 0.282
NP_442145.1_4 Reverse -231 -250 3.00757 0.299
NP_443018.1_3 Reverse -119 -126 10.2655 0.107
NP_441634.1_9 Reverse -155 -174 8.16011 0.294
NP_441857.1_6 Forward -369 -359 13.5497 0.269
NP_442687.1_7 Forward -391 -381 4.3066 0.255
NP_442946.1_7 Reverse -169 -184 12.2259 0.284
NP_441846.1_10 Forward -379 -360 -5.70374 0.19
NP_441846.1_10 Forward -363 -344 -15.9302 0.256
NP_441846.1_10 Forward -384 -365 -23.6983 0.295
NP_442958.1_3 Forward -365 -346 -1.08219 0.27
NP_441763.1_10 Reverse -199 -218 5.50519 0.284
NP_440141.1_8 Forward -331 -312 4.12936 0.293
NP_441478.1_3 Reverse -369 -388 17.0107 0.138
NP_441127.1_1 Reverse -223 -237 8.65272 0.288
NP_442836.1_10 Forward -369 -359 9.02648 0.289
NP_440373.1_1 Reverse -381 -398 21.8683 0.124
NP_439905.1_1 Forward -126 -113 6.31247 0.293
NP_439990.1_5 Reverse -376 -389 5.42749 0.295
NP_442690.1_1 Reverse -15 -34 -7.08038 0.173
NP_442690.1_1 Reverse -14 -33 -10.522 0.215
NP_442690.1_1 Forward -221 -202 -15.8318 0.28
NP_442690.1_1 Reverse -188 -207 -15.9302 0.282
NP_442690.1_1 Reverse -255 -274 -16.5201 0.289
NP_440858.1_1 Forward -127 -108 -5.80207 0.281
NP_443055.1_6 Forward -135 -117 0.706727 0.24
NP_441429.1_4 Forward -392 -373 9.24175 0.236
NP_441099.1_8 Reverse -26 -44 14.5713 0.158
NP_441654.1_6 Forward -26 -8 18.3364 0.14
NP_441752.1_6 Reverse -341 -360 5.60432 0.211
NP_440569.1_10 Reverse -314 -333 5.20389 0.24
NP_440569.1_10 Reverse -5 -24 2.24364 0.295
NP_439966.1_7 Reverse -352 -362 6.27276 0.185
NP_442941.1_3 Reverse -166 -176 5.5849 0.107
NP_440983.1_5 Forward -396 -377 -6.68705 0.278
NP_441076.1_3 Reverse -323 -342 10.52 0.275
NP_441514.1_6 Forward -318 -311 12.8221 0.252
NP_441079.1_1 Forward -372 -353 17.404 0.208
NP_441087.1_6 Reverse -307 -325 -3.91481 0.296
NP_441860.1_1 Forward -114 -100 13.6102 0.296
NP_441860.1_6 Forward -73 -54 15.8021 0.29
NP_441556.1_10 Reverse -376 -390 15.2833 0.145
NP_441071.1_2 Forward -26 -7 17.7133 0.231
NP_441071.1_2 Reverse -238 -257 13.0342 0.291
NP_440919.1_7 Forward -218 -200 9.40362 0.193
NP_440777.1_9 Forward -37 -18 15.0441 0.0719
NP_440777.1_9 Forward -113 -94 3.83436 0.272
NP_440379.1_5 Forward -372 -353 -6.98204 0.24
NP_439939.1_3 Forward -281 -262 -4.13045 0.293
NP_441015.1_10 Forward -370 -351 1.27776 0.16
NP_441015.1_10 Forward -373 -354 -9.24366 0.281
NP_441244.1_1 Forward -277 -259 12.9005 0.294
NP_441876.1_9 Reverse -386 -396 13.4509 0.267
NP_441826.1_2 Forward -92 -78 -4.22864 0.293
NP_441330.1_1 Reverse -370 -389 -15.2418 0.27
NP_441764.1_8 Forward -64 -54 12.4592 0.284
NP_442868.1_6 Forward -392 -382 4.40493 0.178
NP_441251.1_8 Forward -39 -26 13.3352 0.254
NP_440785.1_1 Forward -68 -49 5.70265 0.119
NP_441612.1_2 Forward -252 -242 10.8728 0.21
NP_442227.1_2 Reverse -309 -328 -2.26216 0.272
NP_443058.1_7 Reverse -369 -388 6.19431 0.233
NP_440871.1_2 Forward -382 -363 12.4875 0.267
NP_441849.1_1 Reverse -226 -245 18.6823 0.183
NP_441906.1_2 Forward -151 -132 0.293673 0.3
NP_442542.1_9 Forward -361 -347 4.52221 0.294
NP_442050.1_1 Forward -391 -372 10.1275 0.243
NP_442342.1_1 Forward -395 -381 17.1423 0.259
NP_441114.1_3 Forward -154 -145 7.27622 0.247
NP_442777.1_3 Reverse -352 -370 -0.0799167 0.298
NP_440084.1_8 Forward -28 -14 12.8075 0.24
NP_440738.1_5 Forward -152 -133 1.57275 0.289
NP_441739.1_2 Reverse -170 -186 2.31948 0.288
NP_441308.1_8 Forward -176 -166 9.41981 0.226
NP_442192.1_4 Forward -242 -223 11.3067 0.274
NP_442183.1_1 Forward -286 -272 6.48943 0.171
NP_441116.1_10 Reverse -20 -39 6.09597 0.257
NP_441819.1_5 Reverse -15 -34 13.3207 0.218
NP_441549.1_9 Reverse -355 -373 -4.30741 0.198
NP_442347.1_2 Reverse -317 -326 6.29291 0.175
NP_442888.1_6 Forward -146 -127 3.83436 0.24
NP_441633.1_3 Reverse -379 -392 -6.2739 0.242
NP_442998.1_5 Forward -63 -53 13.0581 0.158
NP_442998.1_5 Forward -104 -94 10.1081 0.225
NP_442998.1_5 Forward -64 -54 9.61647 0.238
NP_442998.1_5 Forward -201 -191 9.51814 0.238
NP_440899.1_8 Forward -229 -210 -7.86702 0.246
NP_441362.1_5 Forward -343 -325 12.6721 0.193
NP_441559.1_8 Forward -160 -146 -6.29359 0.276
NP_441113.1_3 Forward -393 -379 14.3553 0.28
NP_441494.1_6 Reverse -253 -266 6.60746 0.28
NP_442993.1_1 Reverse -47 -63 -11.0529 0.233
NP_440677.1_1 Reverse -246 -265 7.17762 0.243
NP_440570.1_5 Reverse -371 -390 -2.16383 0.277
NP_441750.1_7 Forward -400 -390 14.7297 0.254
NP_441340.1_9 Forward -27 -17 11.7259 0.236
NP_441340.1_9 Forward -64 -54 8.25522 0.256
NP_442950.1_1 Forward -342 -323 0.196116 0.206
NP_440586.1_8 Reverse -119 -126 9.08521 0.178
NP_442959.1_5 Forward -61 -42 5.99764 0.262
NP_439937.1_8 Forward -365 -346 -1.47551 0.249
NP_439937.1_9 Forward -128 -111 -9.00826 0.179
NP_439937.1_9 Reverse -199 -216 -12.3515 0.271
NP_440271.1_9 Reverse -97 -116 15.7324 0.235
NP_441138.1_5 Reverse -32 -45 8.56056 0.238
NP_440819.1_5 Forward -64 -56 7.68924 0.266
NP_440139.1_6 Forward -380 -361 15.7324 0.155
NP_440210.1_10 Reverse -304 -323 4.42355 0.296
NP_442262.1_10 Reverse -119 -126 9.18389 0.211
NP_440163.1_10 Forward -124 -114 7.84651 0.299
NP_440189.1_10 Forward -138 -119 6.98095 0.242
NP_442750.1_3 Reverse -123 -142 -11.8986 0.267
NP_440350.1_5 Reverse -21 -40 -3.83545 0.269
NP_440888.1_2 Reverse -359 -373 7.96378 0.175
NP_440888.1_2 Reverse -345 -359 6.98048 0.212
NP_442454.1_2 Reverse -232 -251 7.20922 0.291
NP_442454.1_2 Reverse -9 -28 6.44528 0.294
NP_440237.1_5 Reverse -22 -36 20.3534 0.0485
NP_440575.1_1 Reverse -328 -347 -3.73788 0.299
NP_441304.1_10 Reverse -252 -261 12.8811 0.276
NP_442637.1_7 Reverse -26 -45 13.1758 0.0583
NP_443064.1_6 Reverse -165 -175 8.49468 0.287
NP_440071.1_6 Forward -327 -313 13.2231 0.297
NP_442204.1_5 Forward -400 -381 1.76941 0.228
NP_440516.1_8 Forward -354 -345 -0.295266 0.232
NP_440618.1_1 Forward -67 -48 -5.40875 0.224
NP_442120.1_10 Forward -390 -371 -5.60541 0.202
NP_440673.1_3 Reverse -260 -267 8.29892 0.221
NP_440673.1_3 Forward -133 -126 8.29892 0.221
NP_441884.1_2 Reverse -67 -81 14.1444 0.272
NP_441004.1_1 Forward -396 -377 -13.7669 0.261
NP_440296.1_10 Forward -371 -352 -13.2752 0.269
NP_442694.1_9 Forward -275 -256 10.4225 0.24
NP_442694.1_9 Reverse -43 -62 9.43923 0.244
NP_441851.1_10 Reverse -253 -263 7.35486 0.142
NP_442515.1_1 Forward -346 -332 0.0979218 0.203
NP_441982.1_6 Forward -202 -193 13.5358 0.274
NP_440431.1_3 Reverse -2 -21 -5.60541 0.183
NP_440431.1_4 Forward -37 -18 -4.63178 0.226
NP_440040.1_8 Forward -70 -51 6.63627 0.214
NP_441539.1_1 Forward -25 -11 11.2087 0.285
NP_441432.1_9 Reverse -23 -36 8.21054 0.292
NP_440313.1_1 Forward -129 -110 19.6656 0.104
NP_440759.1_6 Forward -391 -372 2.45773 0.28
NP_442815.1_2 Forward -211 -193 5.42735 0.227
NP_441945.1_10 Reverse -77 -96 7.27595 0.284
NP_441023.1_1 Forward -368 -350 11.8189 0.237
NP_441022.1_1 Forward -115 -106 12.6973 0.232
NP_441022.1_1 Forward -24 -15 12.4095 0.232
NP_441022.1_1 Reverse -14 -23 12.4095 0.232
NP_441022.1_1 Forward -38 -29 10.8747 0.284
NP_442849.1_1 Forward -327 -313 9.93102 0.215
NP_442346.1_5 Forward -268 -258 5.38824 0.248
NP_440545.1_3 Forward -372 -355 -5.86102 0.262
NP_440486.1_6 Forward -187 -168 7.37428 0.271
NP_442027.1_1 Reverse -42 -60 20.6498 0.105
NP_442311.1_5 Forward -161 -142 0.196116 0.277
NP_441585.1_5 Reverse -353 -372 1.86696 0.283
NP_440449.1_6 Forward -94 -76 4.55984 0.296
NP_441329.1_1 Reverse -23 -42 9.11906 0.224
NP_441329.1_6 Forward -39 -20 12.0793 0.106
NP_442404.1_9 Reverse -203 -217 21.2384 0.0804
NP_440224.1_1 Reverse -364 -383 -3.24547 0.257
NP_440017.1_2 Forward -269 -250 4.03023 0.278
NP_442140.1_3 Forward -126 -116 4.89658 0.238
NP_440875.1_9 Reverse -356 -366 7.30133 0.269
NP_442568.1_8 Forward -38 -24 10.0294 0.257
NP_440604.1_6 Forward -286 -267 -3.93378 0.236
NP_442643.1_3 Forward -389 -370 -5.99873 0.261
NP_442643.1_5 Forward -90 -71 -0.590531 0.257
NP_442216.1_4 Forward -262 -254 8.37716 0.255
NP_440546.1_6 Forward -378 -359 11.1109 0.245
NP_443033.1_3 Reverse -352 -371 11.2092 0.268
NP_440024.1_1 Reverse -34 -53 12.0942 0.192
NP_442479.1_5 Reverse -181 -200 6.71222 0.252
NP_442402.1_1 Reverse -356 -375 9.24257 0.271
NP_442402.1_4 Reverse -195 -214 -0.197979 0.189
NP_441848.1_4 Forward -207 -191 16.9089 0.151
NP_441848.1_4 Forward -34 -18 8.60108 0.288
NP_441848.1_5 Forward -253 -234 18.3136 0.188
NP_441848.1_6 Forward -233 -214 24.483 0.0145
NP_442039.1_7 Forward -125 -115 13.353 0.211
NP_442039.1_10 Reverse -194 -212 16.4396 0.218
NP_441811.1_8 Reverse -252 -266 7.07942 0.259
NP_442829.1_2 Forward -37 -21 13.2627 0.287
NP_440160.1_2 Forward -104 -85 -9.14533 0.293
NP_440505.1_7 Reverse -377 -396 2.0644 0.237
NP_441701.1_3 Reverse -249 -266 7.512 0.259
NP_441252.1_6 Reverse -144 -151 14.3954 0.168
NP_441252.1_6 Forward -327 -320 11.6422 0.288
NP_441011.1_8 Forward -173 -164 5.21127 0.278
NP_442533.1_1 Forward -377 -358 -7.17871 0.188
NP_442533.1_1 Forward -361 -342 -17.5035 0.289
NP_442533.1_6 Reverse -359 -368 2.94966 0.232
NP_440263.1_5 Forward -216 -202 8.55439 0.294
NP_442322.1_4 Reverse -356 -373 2.20142 0.21
NP_442322.1_4 Reverse -350 -367 -9.89323 0.297
NP_441028.1_6 Reverse -81 -91 6.17443 0.232
NP_441028.1_6 Reverse -193 -203 4.89613 0.275
NP_441028.1_6 Reverse -56 -66 4.7978 0.277
NP_441028.1_6 Reverse -317 -327 3.51951 0.292
NP_442202.1_10 Forward -128 -114 8.16106 0.255
NP_441527.1_4 Forward -37 -18 -0.812105 0.146
NP_441527.1_4 Forward -36 -17 -1.28956 0.146
NP_441527.1_4 Forward -38 -19 -2.72194 0.161
NP_441527.1_4 Forward -40 -21 -11.8892 0.284
NP_441527.1_4 Forward -39 -20 -11.9847 0.285
NP_440007.1_9 Forward -178 -164 6.88276 0.216
NP_441961.1_4 Forward -371 -352 5.30933 0.27
NP_441106.1_9 Reverse -28 -38 15.6147 0.286
NP_441869.1_2 Reverse -24 -43 12.3892 0.232
NP_441286.1_1 Reverse -380 -392 -6.15587 0.251
NP_440886.1_7 Reverse -390 -400 9.02601 0.0805
NP_440886.1_10 Reverse -379 -398 10.2251 0.215
NP_442072.1_9 Reverse -146 -164 -22.9903 0.271
NP_441753.1_10 Reverse -117 -136 3.24438 0.219
NP_441403.1_4 Reverse -193 -211 12.0155 0.282
NP_441403.1_4 Reverse -110 -128 11.5239 0.282
NP_440907.2_4 Reverse -51 -70 11.0646 0.299
NP_440666.1_3 Reverse -308 -327 13.0775 0.107
NP_442842.1_7 Reverse -43 -62 14.5524 0.283
NP_442211.1_3 Forward -390 -371 10.6817 0.257
NP_441901.1_9 Reverse -44 -63 12.1925 0.147
NP_441963.1_2 Forward -397 -378 4.03102 0.215
NP_441431.1_2 Reverse -115 -129 6.19383 0.279
NP_441993.1_1 Forward -92 -73 7.89159 0.159
NP_440358.1_8 Forward -81 -62 -1.47551 0.274
NP_440492.1_9 Forward -117 -103 9.50399 0.295
NP_440287.1_5 Reverse -308 -327 7.17681 0.286
NP_442087.1_7 Reverse -18 -37 -4.03287 0.292
NP_440766.1_5 Forward -203 -191 9.9476 0.275
NP_440766.1_5 Forward -66 -54 6.50989 0.299
NP_440422.1_10 Reverse -17 -36 5.07958 0.279
NP_441133.1_1 Forward -368 -349 12.8808 0.252
NP_441489.1_3 Reverse -6 -20 7.93745 0.244
NP_442936.1_10 Reverse -13 -27 12.2307 0.216
NP_442862.1_1 Reverse -342 -361 9.0459 0.269
NP_442862.1_3 Reverse -191 -208 13.2152 0.177
NP_442862.1_3 Forward -217 -200 7.512 0.255
NP_442862.1_3 Forward -206 -189 5.64371 0.268
NP_441275.1_6 Forward -395 -382 19.9805 0.156
NP_441173.1_9 Reverse -194 -202 12.1137 0.21
NP_440191.1_4 Reverse -26 -36 13.342 0.282
NP_440750.1_5 Forward -37 -23 12.6843 0.163
NP_440750.1_5 Forward -36 -22 4.91614 0.294
NP_442275.1_1 Reverse -359 -378 3.04771 0.284
NP_441207.1_7 Forward -38 -24 15.4514 0.179
NP_441207.1_7 Forward -316 -302 8.67452 0.282
NP_442495.1_4 Forward -369 -359 12.6647 0.218
NP_442788.1_5 Reverse -252 -271 14.5524 0.284
NP_442015.1_10 Reverse -173 -186 4.64084 0.166
NP_440305.1_1 Forward -36 -22 17.3912 0.133
NP_442252.1_4 Forward -373 -354 16.5191 0.221
NP_443052.1_9 Reverse -310 -329 -4.6221 0.259
NP_442116.1_6 Forward -111 -94 13.803 0.172
NP_442154.1_1 Forward -371 -353 -16.6971 0.244
NP_442226.1_7 Reverse -205 -223 17.2262 0.207
NP_442564.1_10 Forward -258 -244 8.94771 0.296
NP_440261.1_5 Reverse -382 -395 -4.60227 0.158
NP_440261.1_10 Reverse -226 -240 11.996 0.266
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GACGGTTGGGGGCAACAGCAAAGGACTGGGGAGGAGCTGGGCTGGAGGCGAACTGGGTGAGAACCATAAAATCTTGGGGAACAGGGGAATGTTAATGAACACATGACATGCATAGGATAGCGAATTGATTTAAAGCAATGATTCCCCCTGAGATAAATATATTTTGACCCACTGCTCCGCTTAATTTTGGCGCTAATCTGGGCAAAAATTCGTTGGTTTTCGGAAAGGTGAACCCGTAGCTAGCTTGTATTGCCCAAACCTAACTCATCATTGCTCCATGGCGGCCAAAAATCTTTAGGACAAAACTCGCCAGAGGTCAAGGCTTGATTTTTTCAGAGGGAAAAATTCCTCGGCTAAATAATCAAAAAGTTGAAAAAAAAAGTTTTTCAGCTAAGGTTTG

CDS

ATGTTATATTTTATCTTATGTAGACTTTTGAAAAAAACAAGTCCCCGCAATCAAGCATCATTCAACGGAAAAAATAATCCTATGCCAAACGCCTCCACCGCACTAACCGGCAAAGCATTACTCAATAAAGTTAAAGAACTATCCCATCTGCCCCGTCGAGAAACGGCAAAAGCCTGTGGTTACTACTCTACTTCTAAGGAAGGACAAGTACGCGTAAATTTGACCGACTTCTATGACGCAGTGCTAGCGGCCAAAGGGGTTCCCCTCGATCCCTCTGGTACCAAAGATGGTCGGGGTCGTGAACCGACATTTCGTGTTAGTGTCCACAAAAATGGACAGATTGTTATCGGATCCACCTACACCCAAGAAATGGGTCTTAAGTCCGGTGATGAGTTCGAGATCAAGCTCGGTTACAAGCATATTCATCTGAAGCAAATTACCGATAGCGATGACGAAGAGGAAGTATAA

Protein

MLYFILCRLLKKTSPRNQASFNGKNNPMPNASTALTGKALLNKVKELSHLPRRETAKACGYYSTSKEGQVRVNLTDFYDAVLAAKGVPLDPSGTKDGRGREPTFRVSVHKNGQIVIGSTYTQEMGLKSGDEFEIKLGYKHIHLKQITDSDDEEEV