Your browser is old and dusty. Try Google Chrome!

Details for sll0330

ORF sll0330
Accession NP_442032.1
Symbol
Category sepiapterine reductase
Definition Fatty acid, phospholipid and sterol metabolism
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Reverse -184 -191 8.39725 0.213
NP_441418.1_6 Reverse -204 -223 -23.01 0.19
NP_441453.1_7 Reverse -33 -40 14.1988 0.175
NP_441453.1_8 Reverse -231 -248 11.9369 0.205
NP_441818.1_9 Reverse -331 -350 -8.26035 0.276
NP_440120.1_4 Reverse -64 -78 15.2409 0.273
NP_440996.1_2 Reverse -239 -248 15.241 0.248
NP_442655.1_10 Reverse -153 -172 -18.1918 0.27
NP_441812.1_3 Forward -242 -228 7.27608 0.282
NP_440061.1_9 Forward -177 -163 11.7003 0.107
NP_441054.1_2 Reverse -98 -117 9.93088 0.284
NP_440761.1_4 Forward -328 -309 -4.6221 0.132
NP_442581.1_1 Reverse -102 -116 8.94771 0.235
NP_440735.1_10 Forward -389 -375 15.2409 0.214
NP_440304.1_4 Forward -325 -315 5.19158 0.223
NP_440916.1_1 Forward -77 -63 10.521 0.206
NP_440916.1_1 Forward -249 -235 8.94771 0.257
NP_440893.1_3 Forward -176 -157 4.71854 0.262
NP_442110.1_7 Forward -141 -127 0.0979218 0.267
NP_441082.1_10 Reverse -332 -345 12.3107 0.236
NP_441925.1_4 Forward -363 -344 1.37531 0.155
NP_441738.1_2 Forward -172 -165 6.72528 0.236
NP_440178.1_7 Forward -273 -254 -22.0267 0.249
NP_442570.1_3 Forward -137 -118 -5.31042 0.242
NP_442462.1_2 Reverse -245 -264 4.81767 0.234
NP_441716.1_1 Forward -175 -161 7.76774 0.16
NP_441716.1_1 Forward -393 -379 5.60446 0.224
NP_442111.1_3 Forward -304 -291 17.8233 0.144
NP_440747.1_10 Reverse -381 -393 -11.7607 0.142
NP_442760.1_4 Forward -381 -362 10.9142 0.222
NP_441012.1_4 Forward -220 -207 18.1122 0.11
NP_441012.1_4 Reverse -209 -222 7.49244 0.272
NP_443018.1_3 Forward -240 -233 10.4622 0.103
NP_443018.1_3 Reverse -233 -240 4.36568 0.254
NP_441634.1_9 Forward -292 -273 17.8948 0.104
NP_440376.1_1 Forward -393 -384 4.42462 0.159
NP_443065.1_1 Reverse -345 -364 12.0942 0.285
NP_442687.1_7 Reverse -383 -393 5.48657 0.2
NP_442485.1_3 Reverse -202 -221 -3.04881 0.272
NP_441422.1_7 Forward -274 -257 -6.84433 0.254
NP_442782.1_2 Forward -323 -309 5.70279 0.239
NP_442496.1_5 Reverse -370 -388 6.214 0.284
NP_441256.1_8 Forward -318 -299 11.3075 0.164
NP_440203.1_5 Reverse -317 -327 10.4026 0.225
NP_443001.1_7 Reverse -27 -46 3.34271 0.279
NP_439990.1_8 Forward -91 -72 1.86774 0.283
NP_440153.1_8 Forward -356 -343 5.23083 0.18
NP_441591.1_10 Reverse -154 -173 6.88262 0.275
NP_440858.1_1 Forward -313 -294 -5.9004 0.281
NP_442119.1_6 Forward -224 -205 5.01433 0.256
NP_442064.1_1 Forward -246 -227 0.786102 0.146
NP_440993.1_2 Forward -38 -22 4.0901 0.256
NP_441099.1_5 Forward -289 -270 -10.817 0.262
NP_442032.1_1 Forward -299 -281 17.9154 0.265
NP_441646.1_1 Reverse -377 -396 -1.67217 0.293
NP_441550.1_8 Forward -243 -233 7.25606 0.169
NP_441916.1_10 Reverse -376 -395 3.93269 0.225
NP_441369.1_1 Reverse -234 -253 -8.85033 0.104
NP_442281.1_1 Reverse -227 -241 2.45727 0.266
NP_442012.1_1 Forward -181 -162 -0.983855 0.272
NP_441556.1_10 Forward -180 -166 10.1245 0.275
NP_442982.1_5 Reverse -101 -120 1.57275 0.231
NP_441751.2_8 Forward -392 -378 -1.96703 0.132
NP_442554.1_8 Reverse -233 -243 8.53483 0.074
NP_442554.1_8 Forward -221 -211 1.94665 0.288
NP_442142.1_4 Forward -168 -155 4.24695 0.227
NP_442142.1_4 Reverse -311 -324 3.46031 0.255
NP_443009.1_5 Reverse -313 -324 3.79477 0.278
NP_442301.1_4 Reverse -300 -319 13.3716 0.291
NP_441715.1_4 Forward -164 -154 4.99491 0.24
NP_440279.1_2 Forward -227 -208 6.68596 0.246
NP_441468.1_1 Reverse -233 -240 4.07068 0.263
NP_441015.1_10 Forward -328 -309 -11.7019 0.3
NP_442253.1_5 Reverse -375 -392 -0.944468 0.234
NP_441826.1_2 Reverse -378 -392 0.294584 0.19
NP_443058.1_7 Forward -242 -223 5.01433 0.25
NP_442808.1_1 Forward -354 -344 1.84789 0.281
NP_440346.1_6 Forward -82 -72 13.8557 0.291
NP_440558.1_2 Reverse -375 -394 -6.49039 0.275
NP_441878.1_6 Forward -223 -213 0.766681 0.134
NP_441878.1_6 Reverse -165 -175 -7.39479 0.222
NP_441878.1_6 Reverse -182 -192 -7.59145 0.245
NP_441878.1_10 Reverse -237 -251 11.2093 0.289
NP_441590.1_4 Forward -351 -332 2.45694 0.295
NP_442494.1_6 Forward -167 -148 9.14423 0.294
NP_441238.1_10 Forward -136 -122 12.8809 0.292
NP_442998.1_5 Reverse -237 -247 11.8781 0.176
NP_441799.1_1 Reverse -200 -214 5.30886 0.214
NP_441007.1_10 Forward -328 -315 0.117615 0.25
NP_442334.1_2 Forward -202 -185 -9.79426 0.297
NP_441559.1_8 Forward -398 -384 -5.80194 0.27
NP_441559.1_8 Forward -292 -278 -7.37523 0.291
NP_441559.1_8 Forward -217 -203 -7.47356 0.294
NP_442860.1_7 Forward -90 -72 7.74031 0.283
NP_441866.1_4 Reverse -73 -86 17.2327 0.231
NP_442967.1_4 Reverse -267 -286 12.8808 0.231
NP_441464.1_8 Forward -356 -342 7.37441 0.21
NP_441464.1_10 Reverse -340 -354 9.83269 0.262
NP_441464.1_10 Reverse -342 -356 8.94771 0.267
NP_442386.1_9 Forward -242 -233 7.2758 0.219
NP_442386.1_10 Reverse -368 -381 5.91914 0.262
NP_441340.1_5 Reverse -233 -240 4.07068 0.239
NP_441340.1_9 Reverse -237 -247 8.25522 0.256
NP_440168.1_9 Reverse -345 -364 -3.54046 0.296
NP_442506.1_2 Reverse -221 -240 2.65439 0.278
NP_440161.1_3 Reverse -312 -331 9.24257 0.251
NP_440586.1_1 Forward -400 -381 -4.72043 0.278
NP_440586.1_8 Forward -240 -233 7.61025 0.227
NP_440586.1_8 Reverse -214 -221 5.8403 0.283
NP_440192.1_5 Reverse -340 -359 10.4225 0.172
NP_440969.1_3 Forward -173 -155 13.883 0.214
NP_440027.1_3 Forward -175 -157 2.87 0.284
NP_439996.1_6 Reverse -340 -359 7.81612 0.257
NP_440372.1_2 Reverse -233 -240 4.07068 0.262
NP_442722.1_10 Forward -43 -24 23.9922 0.0179
NP_440819.1_5 Reverse -237 -245 7.59091 0.272
NP_441018.1_7 Forward -327 -308 8.84924 0.239
NP_442262.1_10 Forward -240 -233 10.6589 0.14
NP_441689.1_5 Reverse -230 -240 7.84605 0.185
NP_440163.1_10 Reverse -210 -220 18.4663 0.0762
NP_440163.1_10 Forward -219 -209 10.8948 0.187
NP_440282.1_3 Forward -203 -184 -2.26216 0.298
NP_441965.1_10 Reverse -163 -179 3.69678 0.256
NP_440297.1_9 Forward -191 -181 1.06167 0.282
NP_440297.1_9 Forward -221 -211 -0.41329 0.283
NP_441592.1_4 Reverse -213 -232 1.96607 0.207
NP_440894.1_10 Reverse -21 -40 8.35759 0.178
NP_440999.1_9 Forward -217 -203 -2.75368 0.276
NP_440600.1_4 Forward -249 -231 -3.02911 0.216
NP_442033.1_6 Reverse -357 -376 19.764 0.0826
NP_442033.1_10 Forward -167 -148 -11.8986 0.26
NP_442033.1_10 Reverse -312 -331 -13.6686 0.287
NP_441543.1_3 Forward -355 -341 11.5037 0.181
NP_442845.1_2 Reverse -226 -240 7.57108 0.195
NP_443064.1_6 Forward -393 -383 9.94905 0.187
NP_442337.1_8 Reverse -332 -351 -0.4922 0.274
NP_440710.1_1 Forward -364 -346 -8.43732 0.264
NP_443062.1_1 Forward -241 -223 9.71601 0.129
NP_443062.1_6 Forward -69 -50 1.0811 0.28
NP_440516.1_6 Forward -222 -208 14.1586 0.188
NP_442428.1_5 Reverse -233 -240 4.46401 0.267
NP_440673.1_3 Forward -239 -232 13.2155 0.0426
NP_440673.1_3 Reverse -316 -323 8.98723 0.203
NP_442219.1_8 Reverse -374 -393 10.3897 0.205
NP_441884.1_9 Reverse -267 -286 -22.125 0.275
NP_441719.1_2 Forward -244 -230 17.4811 0.191
NP_441719.1_6 Forward -390 -371 5.70185 0.288
NP_441733.1_8 Reverse -358 -377 12.0942 0.25
NP_441004.1_4 Forward -129 -119 14.0414 0.179
NP_441004.1_4 Reverse -78 -88 9.22315 0.259
NP_442813.1_4 Forward -243 -224 1.67108 0.197
NP_442813.1_4 Forward -242 -223 -6.88371 0.299
NP_442873.1_5 Forward -378 -359 7.4718 0.277
NP_441115.1_4 Forward -324 -306 9.45814 0.213
NP_441545.1_1 Forward -290 -271 1.27776 0.252
NP_441668.1_4 Forward -251 -232 -1.08219 0.267
NP_441349.1_4 Reverse -273 -292 5.01433 0.138
NP_442843.1_1 Reverse -233 -252 1.47442 0.165
NP_442843.1_1 Reverse -98 -117 -6.78538 0.245
NP_441124.1_5 Reverse -237 -247 12.7217 0.215
NP_440431.1_3 Forward -91 -72 -7.86702 0.218
NP_442006.1_2 Reverse -157 -174 -17.1691 0.27
NP_440483.1_4 Reverse -160 -179 9.93088 0.268
NP_442243.1_1 Forward -129 -111 4.93494 0.193
NP_442348.1_2 Forward -62 -53 12.8811 0.218
NP_441432.1_8 Forward -324 -315 5.40793 0.158
NP_443024.1_3 Reverse -104 -114 15.2213 0.255
NP_442815.1_2 Reverse -268 -286 16.6371 0.0672
NP_440913.1_1 Forward -325 -307 5.82068 0.234
NP_442489.1_7 Forward -393 -384 -1.6719 0.235
NP_442913.1_10 Reverse -198 -217 1.0811 0.147
NP_439956.1_7 Forward -329 -310 8.35759 0.257
NP_442346.1_5 Forward -324 -314 10.8948 0.0813
NP_442346.1_5 Reverse -212 -222 5.19158 0.256
NP_442346.1_5 Forward -357 -347 4.50326 0.286
NP_440545.1_3 Forward -196 -179 -2.22277 0.181
NP_441050.1_5 Forward -327 -309 -1.25915 0.262
NP_440224.1_4 Forward -394 -375 2.65439 0.225
NP_441973.1_1 Forward -294 -279 -0.0201027 0.253
NP_442140.1_3 Reverse -214 -224 6.96153 0.156
NP_441239.1_9 Reverse -211 -223 2.98891 0.3
NP_440156.1_4 Forward -77 -67 12.9592 0.176
NP_440624.1_5 Forward -308 -290 8.72786 0.262
NP_440624.1_5 Forward -86 -68 7.18536 0.298
NP_441017.1_6 Forward -45 -31 11.2087 0.273
NP_442052.1_8 Forward -224 -214 14.238 0.253
NP_440546.1_4 Reverse -213 -223 10.2399 0.109
NP_440401.1_9 Reverse -123 -130 14.5917 0.287
NP_441582.1_5 Forward -177 -158 5.30853 0.216
NP_442402.1_4 Forward -253 -234 -8.75273 0.284
NP_441848.1_7 Forward -302 -283 -2.65624 0.27
NP_441084.1_6 Reverse -230 -244 10.3137 0.248
NP_442039.1_7 Reverse -234 -244 10.6981 0.257
NP_440505.1_3 Reverse -36 -46 5.5849 0.222
NP_441102.1_2 Reverse -15 -34 11.7008 0.215
NP_440914.1_1 Reverse -232 -242 8.71269 0.186
NP_442533.1_6 Reverse -213 -222 4.62128 0.179
NP_442533.1_6 Forward -241 -232 2.65466 0.246
NP_442232.1_3 Forward -230 -211 -7.17871 0.194
NP_442269.1_10 Forward -322 -303 7.96426 0.194
NP_441028.1_6 Forward -73 -63 10.4026 0.203
NP_441028.1_6 Forward -383 -373 3.8145 0.281
NP_441527.1_4 Reverse -229 -248 -3.00842 0.164
NP_440115.1_6 Forward -326 -316 5.19158 0.265
NP_440007.1_9 Reverse -228 -242 7.76774 0.2
NP_441106.1_1 Reverse -231 -240 4.71961 0.21
NP_440886.1_7 Forward -166 -156 7.64939 0.0865
NP_442717.1_2 Reverse -62 -81 -0.000545616 0.211
NP_442717.1_5 Forward -70 -51 8.16093 0.292
NP_440767.1_5 Reverse -59 -78 9.14423 0.243
NP_442264.1_2 Reverse -203 -220 7.31533 0.242
NP_440841.1_4 Reverse -230 -249 -10.817 0.288
NP_442615.1_1 Forward -231 -213 -6.37237 0.244
NP_441962.1_4 Forward -227 -208 -8.16202 0.196
NP_440387.1_1 Forward -393 -377 -5.15301 0.217
NP_441174.1_1 Reverse -157 -172 15.6145 0.231
NP_440467.1_8 Forward -368 -349 19.5673 0.0614
NP_441425.1_4 Reverse -236 -250 15.8309 0.282
NP_442437.1_3 Forward -172 -153 12.7816 0.166
NP_442323.1_7 Reverse -309 -328 8.55343 0.163
NP_441510.2_7 Reverse -53 -67 14.2569 0.28
NP_440293.1_3 Reverse -336 -355 -2.85214 0.241
NP_440766.1_4 Reverse -154 -168 4.81781 0.121
NP_442930.1_1 Forward -78 -68 14.0409 0.239
NP_442930.1_1 Forward -248 -238 9.41933 0.287
NP_440457.1_1 Reverse -343 -355 2.30059 0.214
NP_441440.1_8 Forward -137 -124 15.1623 0.299
NP_440554.1_4 Forward -240 -230 12.2714 0.0344
NP_441397.1_8 Reverse -235 -248 18.5872 0.142
NP_441397.1_8 Forward -306 -293 11.8073 0.289
NP_440679.1_10 Forward -220 -201 -14.9469 0.25
NP_439962.1_4 Forward -169 -150 -6.88371 0.285
NP_441105.1_3 Forward -203 -184 -5.01543 0.211
NP_440172.1_1 Forward -323 -313 2.7333 0.268
NP_442371.1_1 Reverse -64 -74 13.5492 0.206
NP_441226.1_7 Forward -240 -233 11.2485 0.0971
NP_441766.1_2 Forward -241 -232 3.24465 0.227
NP_440416.1_9 Forward -182 -163 -19.2734 0.272
NP_442154.1_1 Reverse -336 -354 -9.91228 0.195
NP_442154.1_1 Reverse -345 -363 -16.8938 0.246
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTAGGAGGCGTTTACCATGCTCCCCATGCATCAGTGCCAGTCAAGCCACCACACCCCAGACTGAAGAACTATTCGAGGCAATGGTTCGGGGTCTAGGTCAAAAATTATGCCCGTCATTGTCTGGAGCACCGTTTGTCTCCCCTTGGTTCGTTAATTTTTCCCATCGCTTTTAGGTTGAACCATGGCCGTGATTTCTAGGTAGGCCTAGGTCATAGCACTGTCTTGTCCATTCCCCGCTAGCACCTGGAATGCAAAGTTAGTGCCCCGCTTTGGGGTTACGGAGAACCAATTTCTCCAATATCGTACTTAACCCATTAACCCAAAAATTTCTCCCTGTCGGCATTTGTTCCGTATCTATTCCCAGGGAGAACACGCCTCATATTCCATAGGAGGTAAGCA

CDS

ATGAATTTACTCAACAAAACTGCTTTAGTGACCGGATCTTCCCGGGGCATCGGCCGGGCAATCGCCGAAGAACTAGCCAAACAAGGTCTGGGAAAAATTATCCTTGTGGCCCGTAACCACGCCAGTCTGCAAACATTGGCTGACGAATTAGAACAACGACATCCCGGATTACAGGCCATTGCCTTGCCCCTGGACCTAACCCAACCCGTGGCCGTCAACACGGCGATCGCCAGAACTTGGCGGGACCATGGCCCCATCCATTTGCTGGTTAACTGTGCCGGGGTTGCCCACCAAAATCCCTTTCTCCATAGCCGCTTCCCGGAAGTTTACCAAGAAATTTCCCTTAACCTAATGGGTCTGTATTGCATCACCCGTTGCGTGGCCCGACGCATGGTCTCCCAAAAAGAGGGCACCATTGTCAACGTTTCTAGTTTGATGGGCAAAGTGGCGGCCCCCACCATGGCCACCTATTCCGCCACTAAGTTTGCCATTCTCGGCTTTAGCCAAGCTCTGCGGGGAGAACTGGCCCGCCATAACATCGCTGTGGTTACCCTGCTACCCACCCTGACCGACACGGATATGGCCAAGGGTTTACAAAAATTCCGCTGGGTCAGAGCCATGACCGCCGGTCGAGTGGCCCAATCCTTAGTCAAAGGTTTAAAACAAAACCGTAGTGAAATTTTGGTGGGTTGGCAGAGTCATCTGGCTGTGTGGTGCCAACGGTTTGCCCCCCAATTATTGGAACGGGTACTGCTGTTGGCTACCCCCCAATCGGTTTGA

Protein

MNLLNKTALVTGSSRGIGRAIAEELAKQGLGKIILVARNHASLQTLADELEQRHPGLQAIALPLDLTQPVAVNTAIARTWRDHGPIHLLVNCAGVAHQNPFLHSRFPEVYQEISLNLMGLYCITRCVARRMVSQKEGTIVNVSSLMGKVAAPTMATYSATKFAILGFSQALRGELARHNIAVVTLLPTLTDTDMAKGLQKFRWVRAMTAGRVAQSLVKGLKQNRSEILVGWQSHLAVWCQRFAPQLLERVLLLATPQSV