Your browser is old and dusty. Try Google Chrome!

Details for sll0328

ORF sll0328
Accession NP_442036.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -71 -57 0.196253 0.215
NP_441061.1_2 Reverse -64 -78 -2.06536 0.281
NP_441061.1_2 Forward -278 -264 -2.36035 0.29
NP_440795.1_7 Forward -266 -259 8.00392 0.218
NP_441418.1_6 Forward -72 -53 -13.9635 0.0792
NP_441418.1_6 Forward -249 -230 -21.1417 0.139
NP_441418.1_6 Reverse -63 -82 -22.9117 0.188
NP_441418.1_6 Reverse -51 -70 -29.8932 0.245
NP_442291.1_6 Forward -250 -236 20.1574 0.293
NP_441453.1_4 Reverse -26 -34 9.75419 0.0493
NP_441453.1_4 Reverse -63 -71 6.80426 0.121
NP_441453.1_4 Forward -72 -64 6.11594 0.121
NP_441453.1_4 Reverse -258 -266 3.756 0.288
NP_441623.1_1 Reverse -155 -173 -3.6191 0.262
NP_441960.1_3 Forward -248 -229 13.9873 0.243
NP_442151.1_6 Forward -93 -79 6.09611 0.248
NP_442151.1_10 Forward -268 -250 13.0972 0.289
NP_441818.1_6 Reverse -56 -70 12.1926 0.253
NP_441818.1_9 Forward -290 -271 12.1925 0.106
NP_441818.1_9 Forward -248 -229 3.24438 0.182
NP_441818.1_9 Forward -284 -265 -2.75381 0.209
NP_441818.1_9 Forward -62 -43 -4.13045 0.234
NP_441818.1_9 Forward -344 -325 -7.37537 0.272
NP_441818.1_9 Forward -254 -235 -7.86702 0.274
NP_441818.1_9 Forward -68 -49 -8.35868 0.277
NP_440226.1_1 Forward -72 -53 6.19431 0.135
NP_442169.1_1 Forward -132 -113 -1.96717 0.271
NP_442173.1_1 Forward -71 -63 12.0158 0.0316
NP_442173.1_1 Reverse -196 -204 5.0343 0.24
NP_442173.1_1 Forward -170 -162 5.0343 0.24
NP_442173.1_1 Reverse -64 -72 4.83764 0.241
NP_442173.1_1 Forward -251 -243 4.64098 0.26
NP_442752.1_4 Reverse -63 -70 13.8055 0.0199
NP_443027.1_4 Forward -269 -259 9.91146 0.147
NP_441812.1_1 Forward -398 -384 12.0937 0.255
NP_440784.1_7 Reverse -64 -71 6.23397 0.241
NP_440784.1_7 Forward -71 -64 6.13563 0.241
NP_442909.1_7 Forward -71 -57 11.897 0.131
NP_442909.1_7 Reverse -64 -78 9.04542 0.161
NP_442000.2_3 Forward -359 -340 11.4058 0.28
NP_440061.1_9 Forward -269 -255 11.9953 0.103
NP_440061.1_9 Forward -83 -69 9.53707 0.143
NP_440061.1_9 Reverse -24 -38 7.96378 0.185
NP_440110.1_8 Forward -230 -211 0.687771 0.211
NP_440110.1_8 Forward -266 -247 -2.65548 0.279
NP_441054.1_2 Forward -245 -226 9.93088 0.284
NP_441476.1_5 Reverse -223 -242 0.491109 0.19
NP_441476.1_5 Forward -77 -58 -0.295539 0.2
NP_441476.1_5 Reverse -58 -77 -2.0655 0.216
NP_441476.1_5 Reverse -343 -362 -2.85214 0.231
NP_441476.1_5 Forward -332 -313 -7.57203 0.29
NP_439979.1_2 Forward -66 -47 10.0292 0.208
NP_439979.1_2 Reverse -53 -72 6.68596 0.291
NP_440878.1_9 Reverse -152 -171 -0.590531 0.218
NP_441499.1_2 Forward -333 -314 22.3206 0.035
NP_442062.1_8 Forward -171 -161 5.78156 0.152
NP_442062.1_8 Forward -204 -194 4.20827 0.228
NP_442062.1_8 Reverse -258 -268 3.91327 0.243
NP_442062.1_8 Reverse -162 -172 3.91327 0.243
NP_440761.1_4 Forward -125 -106 -20.4534 0.287
NP_441859.1_3 Forward -73 -54 2.55527 0.258
NP_441859.1_3 Forward -82 -63 1.17865 0.293
NP_440304.1_4 Forward -173 -163 13.8447 0.051
NP_440304.1_4 Forward -359 -349 4.0116 0.281
NP_440044.1_8 Reverse -196 -215 -3.24547 0.281
NP_440044.1_9 Reverse -291 -310 7.57013 0.251
NP_440908.1_2 Reverse -239 -252 14.375 0.269
NP_439918.1_2 Forward -278 -259 4.52268 0.163
NP_439918.1_2 Forward -284 -265 -1.08219 0.236
NP_440307.1_2 Forward -289 -270 5.99764 0.209
NP_441594.1_6 Reverse -219 -238 9.14423 0.146
NP_441594.1_6 Reverse -54 -73 7.27595 0.175
NP_442196.1_10 Forward -188 -169 12.5858 0.217
NP_440370.1_10 Forward -81 -62 8.55425 0.241
NP_442110.1_7 Reverse -243 -257 10.9143 0.0644
NP_442110.1_7 Reverse -57 -71 0.687908 0.252
NP_442110.1_7 Forward -284 -270 -0.0987402 0.274
NP_441925.1_4 Reverse -223 -242 -8.35941 0.209
NP_441925.1_4 Reverse -229 -248 -16.1275 0.281
NP_441925.1_4 Reverse -325 -344 -17.6025 0.297
NP_440273.1_3 Forward -284 -265 5.40766 0.253
NP_440856.1_1 Forward -361 -342 -3.63879 0.231
NP_440856.1_4 Forward -274 -255 -1.96717 0.205
NP_440856.1_7 Forward -279 -260 -1.18052 0.182
NP_441083.1_3 Forward -289 -279 17.9741 0.0636
NP_441083.1_5 Forward -72 -62 8.82982 0.03
NP_441083.1_5 Reverse -26 -36 -0.511621 0.269
NP_441083.1_5 Reverse -63 -73 -0.904945 0.283
NP_442827.1_8 Reverse -55 -74 10.2251 0.0637
NP_441434.1_7 Forward -70 -56 7.66941 0.225
NP_441434.1_7 Reverse -164 -178 3.44117 0.242
NP_441141.1_2 Forward -73 -54 15.5349 0.186
NP_441738.1_2 Forward -70 -63 15.28 0.0102
NP_441738.1_4 Reverse -152 -171 5.11266 0.207
NP_440209.1_1 Reverse -63 -71 8.57422 0.0425
NP_440209.1_1 Forward -72 -64 5.52596 0.0821
NP_442889.1_8 Forward -96 -82 9.14375 0.103
NP_442889.1_8 Reverse -23 -37 5.01387 0.243
NP_442889.1_8 Reverse -255 -269 4.91554 0.247
NP_440178.1_7 Forward -172 -153 -14.9469 0.156
NP_440178.1_7 Forward -326 -307 -21.83 0.241
NP_442570.1_3 Forward -280 -261 -2.65548 0.212
NP_442570.1_3 Forward -275 -256 -6.29373 0.257
NP_440538.1_1 Forward -231 -213 19.882 0.25
NP_441716.1_1 Reverse -26 -40 6.19444 0.207
NP_441716.1_1 Reverse -323 -337 3.04785 0.282
NP_442111.1_4 Forward -73 -59 10.1277 0.0562
NP_441163.1_1 Forward -80 -63 3.87303 0.299
NP_441163.1_9 Reverse -234 -253 18.879 0.112
NP_440343.1_3 Reverse -271 -289 10.0481 0.176
NP_440343.1_9 Forward -156 -137 6.4893 0.3
NP_440906.1_5 Reverse -64 -71 6.23397 0.234
NP_440906.1_5 Forward -71 -64 6.13563 0.241
NP_440747.1_10 Forward -270 -258 -11.9574 0.178
NP_440747.1_10 Forward -38 -26 -12.4491 0.282
NP_441130.1_10 Forward -74 -60 18.4858 0.0133
NP_441880.2_10 Reverse -64 -82 12.9988 0.112
NP_442634.1_4 Reverse -256 -270 -4.52363 0.206
NP_441265.1_6 Reverse -350 -369 14.0599 0.224
NP_440403.1_4 Reverse -54 -73 -6.88371 0.236
NP_440403.1_4 Reverse -324 -343 -9.63698 0.279
NP_441695.1_4 Reverse -271 -289 13.1955 0.219
NP_441014.1_8 Reverse -232 -251 -1.57384 0.224
NP_442848.1_1 Reverse -57 -71 6.09611 0.0803
NP_441012.1_4 Forward -70 -57 10.8357 0.26
NP_441012.1_4 Forward -286 -273 6.4108 0.279
NP_443018.1_3 Forward -71 -64 11.7405 0.0655
NP_443018.1_3 Reverse -64 -71 5.44732 0.193
NP_443018.1_3 Forward -266 -259 4.07068 0.299
NP_441634.1_8 Reverse -268 -282 0.786239 0.217
NP_441634.1_8 Reverse -61 -75 -3.34366 0.295
NP_440376.1_1 Reverse -63 -72 5.99792 0.111
NP_440376.1_1 Forward -267 -258 3.93297 0.188
NP_440376.1_1 Forward -35 -26 2.65466 0.216
NP_440376.1_1 Forward -279 -270 -0.0986038 0.285
NP_440376.1_1 Forward -72 -63 -0.196935 0.285
NP_440376.1_1 Forward -231 -222 -0.491928 0.29
NP_442687.1_7 Forward -172 -162 8.04317 0.116
NP_442687.1_7 Reverse -257 -267 6.17489 0.178
NP_442687.1_7 Reverse -62 -72 4.50326 0.245
NP_442485.1_3 Reverse -61 -80 0.0977854 0.247
NP_442485.1_3 Forward -251 -232 -4.03212 0.277
NP_442485.1_3 Forward -284 -265 -4.91709 0.286
NP_442485.1_3 Reverse -244 -263 -5.01543 0.287
NP_442485.1_3 Forward -104 -85 -5.40875 0.291
NP_441846.1_10 Forward -344 -325 -14.6519 0.235
NP_441846.1_10 Forward -131 -112 -23.6 0.294
NP_441846.1_10 Forward -140 -121 -23.6983 0.295
NP_441013.1_2 Forward -73 -55 1.49411 0.248
NP_441422.1_7 Forward -74 -57 14.2968 0.0565
NP_441422.1_7 Forward -260 -243 -3.99273 0.238
NP_441422.1_7 Reverse -241 -258 -7.23765 0.258
NP_441950.1_7 Forward -240 -221 -7.67036 0.283
NP_441950.1_8 Forward -253 -239 6.78443 0.221
NP_441763.1_9 Reverse -354 -373 17.699 0.0896
NP_440887.1_10 Reverse -61 -80 22.1239 0.0807
NP_440360.1_4 Reverse -238 -257 8.75091 0.223
NP_442658.1_1 Reverse -61 -71 9.02601 0.169
NP_442658.1_1 Forward -74 -64 6.96107 0.214
NP_442658.1_1 Forward -173 -163 6.86274 0.214
NP_442658.1_1 Forward -359 -349 4.99446 0.288
NP_440141.1_8 Reverse -54 -73 8.25926 0.23
NP_441855.2_4 Forward -179 -160 10.2943 0.257
NP_440656.1_8 Forward -215 -196 9.63589 0.0567
NP_441414.1_9 Reverse -63 -82 -6.09707 0.187
NP_441487.1_9 Reverse -242 -261 6.88262 0.123
NP_439959.1_3 Forward -264 -245 12.7825 0.215
NP_439959.1_3 Reverse -244 -263 11.6025 0.229
NP_442937.1_5 Reverse -58 -77 11.3075 0.141
NP_441958.1_5 Reverse -62 -72 0.865012 0.12
NP_441958.1_5 Forward -172 -162 -0.314959 0.198
NP_441958.1_5 Reverse -257 -267 -0.41329 0.205
NP_441127.1_1 Forward -180 -166 17.6008 0.0924
NP_441127.1_1 Reverse -249 -263 11.3077 0.23
NP_441127.1_1 Reverse -153 -167 9.2427 0.278
NP_441127.1_1 Reverse -63 -77 8.55439 0.29
NP_441127.1_1 Reverse -237 -251 8.25939 0.3
NP_442836.1_5 Forward -258 -239 3.04771 0.248
NP_442836.1_10 Reverse -64 -74 13.943 0.212
NP_442025.1_4 Reverse -302 -321 10.8159 0.291
NP_439905.1_1 Forward -71 -58 9.85238 0.216
NP_439905.1_1 Reverse -163 -176 7.39411 0.262
NP_442911.1_2 Forward -277 -258 -10.7186 0.286
NP_441580.1_6 Reverse -52 -71 4.81767 0.117
NP_441580.1_6 Reverse -247 -266 1.76941 0.117
NP_441580.1_6 Reverse -151 -170 -6.09707 0.235
NP_440153.1_5 Forward -71 -57 2.94952 0.219
NP_440153.1_5 Reverse -64 -78 0.491246 0.299
NP_440153.1_8 Reverse -243 -256 -3.71729 0.299
NP_441591.1_10 Forward -74 -55 6.98095 0.275
NP_441591.1_10 Reverse -61 -80 5.211 0.297
NP_442119.1_6 Reverse -61 -80 3.73603 0.3
NP_443055.1_6 Forward -388 -370 -0.76823 0.266
NP_440993.1_2 Reverse -157 -173 3.89344 0.256
NP_440827.1_3 Reverse -337 -356 14.1591 0.213
NP_441429.1_4 Reverse -315 -334 13.175 0.158
NP_441348.1_3 Forward -191 -172 6.29264 0.282
NP_441099.1_5 Reverse -332 -351 -11.9969 0.294
NP_441099.1_5 Reverse -248 -267 -12.0953 0.294
NP_442002.1_9 Forward -172 -165 11.3472 0.185
NP_442002.1_9 Reverse -62 -69 10.7572 0.185
NP_441646.1_1 Forward -332 -313 3.93269 0.204
NP_442438.1_10 Forward -272 -258 8.25939 0.0795
NP_442438.1_10 Reverse -58 -72 2.35953 0.178
NP_442438.1_10 Reverse -55 -69 0.88457 0.213
NP_442431.1_10 Forward -251 -233 8.37728 0.149
NP_442431.1_10 Forward -65 -47 8.37728 0.149
NP_442431.1_10 Forward -248 -230 1.00246 0.262
NP_442431.1_10 Forward -242 -224 0.117479 0.281
NP_440879.1_6 Forward -77 -58 -4.03212 0.279
NP_442885.1_1 Forward -74 -55 9.83255 0.282
NP_441752.1_6 Reverse -34 -53 5.30933 0.211
NP_441752.1_6 Reverse -316 -335 1.37609 0.257
NP_442231.1_5 Forward -362 -343 16.2241 0.263
NP_441000.1_6 Forward -73 -59 3.44117 0.111
NP_440147.1_4 Forward -37 -24 2.67422 0.203
NP_440147.1_4 Reverse -61 -74 0.412608 0.255
NP_441550.1_8 Reverse -61 -71 9.22267 0.103
NP_441550.1_8 Reverse -256 -266 6.86274 0.188
NP_441550.1_8 Forward -74 -64 5.87944 0.224
NP_441916.1_7 Forward -267 -257 5.09324 0.146
NP_440345.1_3 Reverse -204 -218 10.5157 0.277
NP_440465.1_10 Forward -75 -56 7.57094 0.173
NP_441041.1_4 Forward -284 -265 -12.3902 0.265
NP_441041.1_7 Reverse -159 -171 5.76558 0.241
NP_441041.1_7 Reverse -60 -72 5.6684 0.245
NP_441041.1_7 Reverse -333 -345 5.57123 0.25
NP_442004.1_6 Reverse -258 -272 5.70279 0.184
NP_442004.1_6 Forward -72 -58 2.45787 0.264
NP_440703.1_3 Reverse -55 -74 15.6882 0.297
NP_441725.1_5 Reverse -163 -173 7.64985 0.0904
NP_441725.1_5 Reverse -349 -359 6.37155 0.115
NP_441725.1_5 Forward -266 -256 -0.216628 0.241
NP_441725.1_5 Forward -71 -61 -0.806614 0.271
NP_441725.1_5 Forward -356 -346 -1.10161 0.288
NP_439966.1_7 Forward -74 -64 17.1874 0.0068
NP_439966.1_7 Reverse -268 -278 8.43603 0.14
NP_439966.1_7 Reverse -61 -71 7.74772 0.15
NP_439966.1_7 Reverse -295 -305 5.09279 0.243
NP_439966.1_9 Forward -281 -272 14.2577 0.0863
NP_439966.1_9 Reverse -61 -70 10.7178 0.0863
NP_439966.1_9 Forward -74 -65 9.83282 0.215
NP_440674.1_3 Forward -293 -274 1.57275 0.277
NP_440983.1_5 Reverse -231 -250 -0.787193 0.228
NP_440983.1_5 Reverse -45 -64 -7.67036 0.291
NP_440983.1_5 Reverse -228 -247 -8.55534 0.295
NP_440983.1_9 Reverse -54 -73 3.04771 0.289
NP_441678.1_9 Forward -343 -324 -3.73712 0.288
NP_441678.1_9 Forward -300 -281 -5.11376 0.297
NP_442281.1_1 Forward -209 -195 9.43874 0.0703
NP_442281.1_1 Reverse -157 -171 2.8506 0.253
NP_441334.1_7 Forward -74 -55 -10.7186 0.12
NP_440018.1_3 Reverse -246 -265 7.96426 0.209
NP_440018.1_3 Reverse -279 -298 6.4893 0.276
NP_440437.1_1 Reverse -176 -195 -0.688862 0.185
NP_442012.1_1 Forward -78 -59 1.47442 0.215
NP_442012.1_7 Forward -259 -240 17.109 0.103
NP_441556.1_7 Reverse -25 -44 6.98015 0.171
NP_441644.1_6 Forward -72 -62 7.15773 0.133
NP_441644.1_6 Reverse -26 -36 6.0761 0.167
NP_443049.1_6 Reverse -62 -72 11.6409 0.24
NP_442215.1_2 Reverse -182 -198 -0.924775 0.175
NP_441810.1_5 Reverse -46 -65 12.8808 0.297
NP_441810.1_5 Reverse -232 -251 9.53756 0.297
NP_442029.1_6 Forward -362 -343 8.16093 0.211
NP_440253.1_2 Reverse -363 -381 -0.865831 0.226
NP_440253.1_2 Forward -351 -333 -1.55415 0.244
NP_440253.1_2 Reverse -63 -81 -2.63579 0.271
NP_440253.1_2 Forward -54 -36 -3.12744 0.286
NP_440929.1_8 Forward -72 -63 7.07956 0.0713
NP_442933.1_10 Forward -267 -258 4.62128 0.227
NP_440430.1_4 Reverse -53 -72 12.7816 0.276
NP_441751.2_8 Forward -80 -66 -6.49025 0.269
NP_442554.1_8 Forward -266 -256 6.46988 0.117
NP_442554.1_8 Forward -71 -61 6.17489 0.125
NP_442554.1_8 Forward -34 -24 4.60159 0.18
NP_442554.1_8 Reverse -64 -74 4.10993 0.198
NP_442554.1_8 Reverse -178 -188 3.12662 0.239
NP_442554.1_9 Forward -369 -350 13.0738 0.279
NP_442863.1_5 Reverse -52 -71 17.5024 0.169
NP_441762.1_7 Reverse -62 -74 13.9036 0.0142
NP_441762.1_7 Forward -73 -61 4.26721 0.0518
NP_442142.1_4 Reverse -50 -63 7.68852 0.132
NP_442142.1_4 Forward -75 -62 2.67367 0.281
NP_442292.1_1 Forward -71 -62 -0.196935 0.239
NP_440039.1_9 Reverse -52 -71 12.0942 0.284
NP_442476.1_6 Forward -71 -57 2.85119 0.171
NP_442476.1_6 Reverse -64 -78 2.5562 0.179
NP_440895.1_10 Forward -73 -56 3.97208 0.149
NP_443009.1_5 Reverse -257 -268 6.74468 0.15
NP_443009.1_5 Reverse -161 -172 6.74468 0.15
NP_443009.1_5 Forward -172 -161 5.07306 0.218
NP_443009.1_5 Forward -358 -347 4.77807 0.23
NP_443009.1_5 Forward -205 -194 3.79477 0.278
NP_442301.1_2 Reverse -218 -237 9.7334 0.2
NP_442301.1_2 Reverse -224 -243 9.63507 0.2
NP_442408.2_1 Reverse -112 -131 -7.57203 0.3
NP_441088.1_1 Forward -72 -53 8.65258 0.243
NP_441448.1_1 Forward -353 -334 3.93269 0.285
NP_440158.1_8 Forward -281 -262 17.699 0.0977
NP_440183.1_9 Reverse -28 -47 -21.1417 0.296
NP_441198.1_8 Reverse -256 -266 14.4433 0.0797
NP_441198.1_8 Forward -173 -163 12.49 0.129
NP_441198.1_8 Reverse -70 -80 11.3181 0.211
NP_441198.1_8 Forward -359 -349 11.0251 0.228
NP_440379.1_5 Forward -252 -233 2.75272 0.149
NP_440379.1_5 Forward -366 -347 -7.17871 0.24
NP_440379.1_5 Forward -249 -230 -7.96535 0.25
NP_441468.1_1 Forward -266 -259 10.2655 0.0906
NP_441468.1_1 Reverse -64 -71 6.13563 0.209
NP_441468.1_1 Forward -71 -64 6.0373 0.223
NP_439939.1_9 Reverse -27 -46 20.352 0.159
NP_441020.2_6 Reverse -61 -78 8.49531 0.197
NP_441020.2_6 Forward -269 -252 6.62702 0.26
NP_441015.1_10 Reverse -58 -77 -2.85214 0.183
NP_441015.1_10 Forward -239 -220 -4.6221 0.209
NP_441673.1_1 Reverse -63 -72 1.37636 0.114
NP_441673.1_1 Forward -72 -63 1.1797 0.163
NP_441731.1_9 Reverse -242 -259 10.7569 0.282
NP_442253.1_5 Reverse -218 -235 -4.48438 0.293
NP_441876.1_9 Reverse -293 -303 10.9926 0.28
NP_441826.1_2 Reverse -156 -170 2.35953 0.129
NP_441826.1_2 Reverse -252 -266 1.08123 0.164
NP_441826.1_2 Reverse -57 -71 0.589577 0.18
NP_441826.1_2 Reverse -66 -80 -1.08205 0.234
NP_441826.1_2 Forward -78 -64 -4.03198 0.291
NP_441826.1_5 Forward -362 -343 4.71934 0.253
NP_441826.1_5 Forward -71 -52 1.17943 0.295
NP_442868.1_6 Reverse -256 -266 4.20827 0.183
NP_442868.1_6 Forward -173 -163 3.71661 0.194
NP_442868.1_6 Forward -254 -244 -0.314959 0.284
NP_441056.1_1 Forward -273 -254 -7.08038 0.271
NP_442227.1_2 Reverse -44 -63 -0.295539 0.253
NP_442808.1_1 Forward -73 -63 19.449 0.00201
NP_442808.1_1 Reverse -25 -35 5.19112 0.168
NP_441290.1_1 Forward -332 -313 5.01433 0.26
NP_442775.1_6 Forward -248 -229 12.1925 0.277
NP_442775.1_6 Forward -62 -43 10.3242 0.277
NP_440145.1_3 Forward -45 -26 3.34271 0.106
NP_442542.1_2 Forward -173 -160 7.49244 0.179
NP_442542.1_2 Forward -281 -268 5.32916 0.272
NP_442050.1_5 Reverse -268 -278 8.92768 0.206
NP_442342.1_9 Forward -74 -58 2.91013 0.278
NP_440558.1_2 Reverse -69 -88 5.211 0.147
NP_440558.1_2 Reverse -254 -273 1.27776 0.182
NP_440558.1_2 Reverse -249 -268 -2.55715 0.229
NP_440558.1_2 Reverse -63 -82 -2.65548 0.229
NP_440558.1_2 Reverse -266 -285 -5.60541 0.262
NP_440558.1_2 Reverse -260 -279 -5.70374 0.264
NP_440111.2_2 Reverse -52 -71 2.3594 0.201
NP_442789.1_4 Forward -278 -259 -2.85214 0.242
NP_442789.1_4 Forward -266 -247 -4.91709 0.265
NP_442789.1_4 Forward -146 -127 -8.35868 0.299
NP_441878.1_6 Reverse -257 -267 -0.41329 0.177
NP_441878.1_6 Forward -172 -162 -7.00147 0.201
NP_441878.1_6 Forward -36 -26 -7.59145 0.245
NP_441036.1_8 Reverse -62 -72 6.8632 0.213
NP_441036.1_8 Forward -73 -63 6.07655 0.242
NP_441557.1_5 Reverse -63 -72 1.08137 0.0794
NP_441557.1_5 Forward -72 -63 0.589713 0.134
NP_441557.1_5 Forward -171 -162 -0.885252 0.26
NP_441557.1_5 Reverse -258 -267 -0.983583 0.272
NP_441445.1_1 Reverse -54 -73 1.76941 0.247
NP_441445.1_1 Forward -276 -257 1.76941 0.247
NP_442066.2_4 Forward -372 -353 -8.85033 0.296
NP_442066.2_9 Forward -76 -63 7.39411 0.23
NP_442419.1_2 Reverse -358 -377 0.0977854 0.243
NP_442419.1_2 Reverse -58 -77 -3.73712 0.27
NP_441458.1_10 Reverse -17 -36 1.96607 0.277
NP_442183.1_1 Reverse -63 -77 15.9292 0.0175
NP_442183.1_1 Forward -267 -253 6.6861 0.164
NP_442183.1_1 Reverse -162 -176 5.21113 0.226
NP_442166.1_7 Forward -251 -237 18.2892 0.1
NP_442166.1_7 Forward -65 -51 18.2892 0.1
NP_442397.1_9 Reverse -316 -335 5.99764 0.246
NP_441116.1_1 Reverse -56 -75 9.63589 0.222
NP_441574.1_1 Forward -234 -215 -4.72043 0.254
NP_441549.1_9 Forward -76 -58 -10.8956 0.291
NP_440540.1_1 Reverse -228 -247 15.4374 0.232
NP_442347.1_2 Forward -71 -62 8.94785 0.0718
NP_440547.1_1 Forward -263 -244 21.7297 0.0474
NP_440547.1_1 Forward -77 -58 12.6833 0.177
NP_441037.1_4 Reverse -61 -71 7.22024 0.237
NP_441037.1_4 Reverse -256 -266 6.92787 0.237
NP_441037.1_4 Forward -242 -232 6.05075 0.283
NP_440690.1_5 Forward -366 -347 18.0924 0.123
NP_441633.1_3 Reverse -346 -359 -3.22564 0.177
NP_441633.1_3 Forward -74 -61 -3.91395 0.177
NP_441633.1_3 Reverse -160 -173 -4.89726 0.216
NP_441633.1_3 Reverse -61 -74 -6.07724 0.236
NP_440136.1_2 Reverse -64 -71 6.23397 0.171
NP_440136.1_2 Forward -71 -64 6.13563 0.193
NP_440136.1_2 Forward -266 -259 4.26735 0.218
NP_442590.1_10 Forward -72 -53 8.84924 0.204
NP_442590.1_10 Forward -78 -59 7.66927 0.221
NP_442998.1_5 Forward -25 -15 8.53483 0.261
NP_442998.1_5 Forward -194 -184 8.1415 0.271
NP_442998.1_10 Forward -70 -63 15.5754 0.0102
NP_442998.1_10 Reverse -86 -93 4.16902 0.259
NP_440899.1_1 Reverse -360 -379 9.18818 0.221
NP_440299.1_1 Reverse -254 -267 8.18017 0.0964
NP_440299.1_3 Reverse -360 -379 12.8808 0.244
NP_441799.1_1 Forward -76 -62 10.6187 0.0702
NP_441007.1_10 Forward -245 -232 6.01747 0.175
NP_441007.1_10 Forward -176 -163 1.69091 0.203
NP_441007.1_10 Forward -77 -64 0.0192843 0.254
NP_441007.1_10 Forward -257 -244 -0.669033 0.287
NP_442334.1_1 Forward -183 -164 -5.40875 0.268
NP_441449.1_10 Forward -72 -54 14.5721 0.295
NP_441449.1_10 Forward -258 -240 11.3272 0.295
NP_442333.2_5 Reverse -52 -71 -13.9635 0.271
NP_440256.1_1 Reverse -192 -211 -6.88371 0.223
NP_441957.1_1 Forward -365 -346 14.4541 0.107
NP_441957.1_1 Forward -179 -160 9.14423 0.175
NP_441559.1_8 Forward -283 -269 -0.197071 0.174
NP_440915.1_6 Reverse -59 -73 5.89945 0.0879
NP_440915.1_6 Forward -271 -257 3.53951 0.101
NP_440915.1_6 Reverse -158 -172 1.08123 0.147
NP_440915.1_6 Forward -310 -296 -0.295402 0.189
NP_441296.1_7 Forward -252 -233 17.5024 0.23
NP_442785.1_7 Reverse -24 -38 10.4227 0.228
NP_442785.1_9 Reverse -281 -300 13.6666 0.261
NP_441704.1_8 Reverse -337 -356 7.17681 0.247
NP_441704.1_8 Reverse -151 -170 5.2102 0.3
NP_442866.1_1 Forward -284 -265 -0.885524 0.202
NP_440748.1_5 Reverse -266 -285 -0.787193 0.26
NP_441464.1_1 Reverse -271 -290 19.6656 0.0732
NP_441464.1_1 Reverse -319 -338 7.66927 0.261
NP_441464.1_10 Forward -239 -225 7.57108 0.295
NP_440026.1_5 Forward -251 -232 19.5673 0.19
NP_440695.1_5 Reverse -162 -181 -2.16383 0.296
NP_441494.1_6 Forward -176 -163 13.0973 0.219
NP_440677.1_6 Forward -148 -129 8.16093 0.277
NP_442386.1_5 Reverse -158 -177 10.1267 0.164
NP_442386.1_9 Forward -73 -64 13.8639 0.0289
NP_442386.1_9 Forward -268 -259 11.209 0.0993
NP_442386.1_9 Forward -82 -73 7.47246 0.219
NP_442386.1_9 Reverse -62 -71 5.9975 0.23
NP_441750.1_7 Forward -180 -170 15.713 0.254
NP_441750.1_7 Forward -153 -143 15.2213 0.254
NP_441340.1_5 Reverse -64 -71 13.5105 0.0314
NP_441340.1_5 Forward -92 -85 8.8889 0.084
NP_441340.1_5 Forward -71 -64 5.84064 0.208
NP_441947.1_10 Reverse -346 -364 2.57575 0.276
NP_442791.1_5 Reverse -55 -74 -9.53865 0.279
NP_440168.1_9 Forward -83 -64 1.86774 0.237
NP_440146.1_2 Forward -342 -328 11.996 0.3
NP_442240.1_2 Forward -71 -52 -16.2252 0.242
NP_440161.1_3 Forward -317 -298 8.16093 0.276
NP_441160.1_1 Forward -179 -160 -6.39206 0.246
NP_441160.1_1 Reverse -127 -146 -11.7019 0.295
NP_440586.1_1 Forward -253 -234 5.99764 0.182
NP_440586.1_8 Forward -71 -64 9.47853 0.146
NP_440586.1_8 Reverse -64 -71 5.74197 0.283
NP_442251.1_3 Forward -161 -142 19.469 0.157
NP_442251.1_6 Reverse -196 -203 8.69224 0.199
NP_440192.1_5 Forward -252 -233 6.19431 0.226
NP_441912.1_2 Forward -343 -324 17.15 0.224
NP_441262.1_3 Reverse -63 -70 14.7888 0.0223
NP_440027.1_3 Reverse -269 -287 9.35981 0.184
NP_440027.1_3 Forward -72 -54 9.16315 0.187
NP_440027.1_3 Reverse -53 -71 8.86816 0.188
NP_440027.1_3 Reverse -221 -239 6.40989 0.225
NP_440027.1_3 Reverse -233 -251 1.69003 0.299
NP_440027.1_8 Forward -96 -77 9.04509 0.243
NP_443051.1_1 Reverse -62 -71 7.47288 0.0571
NP_439937.1_8 Forward -74 -55 1.96607 0.217
NP_439937.1_8 Reverse -58 -77 -3.44213 0.268
NP_439937.1_9 Forward -73 -56 -2.81344 0.153
NP_440398.1_2 Reverse -51 -70 4.03102 0.231
NP_440408.1_10 Forward -261 -242 10.9142 0.176
NP_440439.1_1 Reverse -60 -73 8.67241 0.0513
NP_440439.1_1 Forward -75 -62 7.00078 0.0703
NP_442239.1_8 Forward -246 -227 14.9458 0.205
NP_442239.1_8 Forward -63 -44 10.9142 0.239
NP_442239.1_8 Forward -258 -239 7.37428 0.258
NP_442239.1_8 Forward -363 -344 4.52268 0.296
NP_440372.1_2 Reverse -64 -71 13.8055 0.0214
NP_440372.1_2 Forward -71 -64 6.52896 0.188
NP_441789.1_7 Reverse -325 -344 5.40686 0.193
NP_441789.1_7 Reverse -112 -131 -5.01617 0.293
NP_442285.1_3 Reverse -342 -361 11.2092 0.254
NP_440316.1_10 Reverse -62 -72 11.1898 0.214
NP_441803.1_2 Forward -71 -52 1.76941 0.226
NP_441803.1_2 Forward -77 -58 0.786102 0.244
NP_441803.1_2 Forward -74 -55 -1.18052 0.294
NP_439977.1_5 Reverse -237 -256 1.57275 0.191
NP_439977.1_5 Forward -273 -254 -2.85214 0.29
NP_439977.1_5 Reverse -141 -160 -2.95047 0.293
NP_440139.1_1 Forward -99 -80 6.68515 0.139
NP_442384.1_10 Forward -267 -254 1.88757 0.243
NP_442114.1_4 Forward -72 -61 11.3667 0.129
NP_441877.1_7 Forward -77 -58 6.1935 0.218
NP_441018.1_7 Forward -367 -348 8.35759 0.249
NP_442790.1_4 Reverse -54 -73 -6.09707 0.144
NP_442262.1_10 Forward -71 -64 13.2155 0.0213
NP_441689.1_5 Forward -206 -196 7.74772 0.19
NP_441689.1_5 Reverse -268 -278 7.64939 0.197
NP_441689.1_5 Forward -269 -259 5.58445 0.23
NP_440163.1_10 Forward -96 -86 8.33817 0.278
NP_440344.1_10 Reverse -56 -73 -11.4659 0.215
NP_440344.1_10 Forward -286 -269 -13.6292 0.29
NP_440531.1_6 Forward -256 -237 -1.67217 0.237
NP_440531.1_6 Forward -373 -354 -5.11376 0.293
NP_442123.1_3 Reverse -195 -214 10.2259 0.294
NP_442917.1_2 Forward -284 -265 13.4708 0.0981
NP_441060.1_6 Forward -363 -347 14.3165 0.254
NP_441060.1_6 Reverse -258 -274 10.5799 0.283
NP_441335.1_4 Reverse -61 -80 10.1275 0.26
NP_441965.1_10 Reverse -255 -271 8.31834 0.128
NP_442065.1_7 Reverse -54 -72 1.98577 0.222
NP_442529.1_6 Forward -98 -79 15.7324 0.267
NP_440297.1_9 Forward -266 -256 -0.511621 0.289
NP_441896.1_3 Reverse -54 -73 9.83255 0.0872
NP_441896.1_3 Forward -366 -347 4.916 0.135
NP_441896.1_3 Forward -81 -62 1.0811 0.222
NP_440894.1_10 Forward -77 -58 12.5858 0.123
NP_440937.1_5 Forward -168 -149 9.63589 0.275
NP_440937.1_5 Forward -369 -350 7.57094 0.295
NP_440999.1_2 Reverse -280 -299 19.2723 0.084
NP_440999.1_9 Reverse -239 -253 2.35953 0.151
NP_440999.1_9 Reverse -158 -172 0.491246 0.183
NP_440999.1_9 Forward -76 -62 -0.197071 0.201
NP_440888.1_2 Forward -72 -58 14.9452 0.0137
NP_440888.1_2 Reverse -258 -272 9.34041 0.13
NP_440888.1_2 Reverse -72 -86 9.34041 0.13
NP_440888.1_2 Forward -171 -157 6.19383 0.243
NP_440491.1_1 Forward -282 -263 9.06107 0.219
NP_440052.1_5 Forward -251 -232 -2.36049 0.212
NP_440052.1_5 Reverse -232 -251 -2.55715 0.213
NP_440052.1_5 Forward -65 -46 -3.3438 0.234
NP_440052.1_5 Forward -263 -244 -4.13045 0.249
NP_442948.1_4 Forward -270 -256 17.3058 0.275
NP_442033.1_10 Forward -74 -55 -1.18052 0.135
NP_442033.1_10 Reverse -51 -70 -7.37537 0.186
NP_440575.1_1 Reverse -197 -216 3.44025 0.256
NP_441543.1_2 Forward -71 -62 8.65285 0.0968
NP_442845.1_2 Forward -273 -259 17.4042 0.0608
NP_442845.1_2 Forward -312 -298 5.21113 0.24
NP_440380.1_1 Forward -138 -119 -10.3253 0.284
NP_441551.1_5 Forward -76 -60 9.4976 0.21
NP_441469.1_8 Reverse -257 -266 11.8978 0.141
NP_441469.1_8 Reverse -62 -71 6.39124 0.227
NP_441469.1_8 Forward -73 -64 5.60459 0.258
NP_442578.1_7 Reverse -64 -71 6.0373 0.18
NP_441462.1_2 Reverse -63 -73 7.55152 0.0543
NP_441462.1_2 Forward -35 -25 -1.10161 0.281
NP_441462.1_4 Reverse -345 -364 -2.75381 0.192
NP_441621.1_7 Reverse -61 -75 7.66941 0.0675
NP_441621.1_7 Forward -74 -60 5.99778 0.068
NP_441621.1_7 Reverse -49 -63 -4.52363 0.232
NP_443062.1_1 Reverse -258 -276 4.64563 0.255
NP_441601.1_4 Forward -74 -55 10.1275 0.155
NP_441601.1_4 Forward -260 -241 0.196116 0.263
NP_441601.1_4 Reverse -238 -257 -4.91709 0.293
NP_441601.1_7 Reverse -355 -374 9.83255 0.23
NP_442204.1_1 Reverse -59 -70 0.648657 0.281
NP_442204.1_6 Forward -44 -25 5.89931 0.269
NP_441560.1_3 Reverse -213 -231 12.7038 0.197
NP_441560.1_8 Forward -176 -157 14.8239 0.134
NP_441560.1_8 Forward -233 -214 12.1944 0.261
NP_441351.1_8 Forward -365 -346 11.4058 0.141
NP_440516.1_2 Forward -78 -60 -0.570838 0.256
NP_440516.1_8 Reverse -63 -72 18.9776 0.00442
NP_440516.1_8 Forward -72 -63 5.01461 0.118
NP_442428.1_5 Reverse -64 -71 6.13563 0.209
NP_442428.1_5 Forward -71 -64 6.0373 0.212
NP_442428.1_5 Forward -266 -259 4.66067 0.244
NP_440818.1_6 Forward -263 -244 18.584 0.22
NP_441443.1_10 Forward -184 -166 1.49337 0.276
NP_442120.1_10 Forward -171 -152 -9.14533 0.242
NP_442120.1_10 Reverse -285 -304 -15.1435 0.289
NP_440673.1_2 Forward -250 -231 16.0476 0.0784
NP_440673.1_2 Forward -262 -243 11.7553 0.165
NP_440673.1_2 Forward -166 -147 11.5602 0.171
NP_440673.1_2 Forward -181 -162 10.1945 0.22
NP_440673.1_2 Forward -367 -348 9.70673 0.238
NP_440673.1_3 Forward -70 -63 12.4288 0.0426
NP_440673.1_3 Reverse -197 -204 11.3472 0.085
NP_440673.1_3 Forward -292 -285 6.23397 0.283
NP_441052.1_2 Reverse -258 -268 5.19158 0.128
NP_441052.1_2 Forward -72 -62 1.25834 0.249
NP_442219.1_9 Reverse -259 -268 5.70292 0.135
NP_440436.1_4 Reverse -259 -268 10.029 0.0863
NP_440436.1_4 Forward -71 -62 8.55409 0.0997
NP_440436.1_4 Reverse -73 -82 6.78414 0.147
NP_441884.1_8 Forward -73 -54 0.884433 0.138
NP_441884.1_9 Reverse -60 -79 -14.6519 0.138
NP_441884.1_9 Reverse -240 -259 -19.7651 0.158
NP_441884.1_9 Reverse -54 -73 -20.3551 0.183
NP_441884.1_9 Forward -75 -56 -22.42 0.278
NP_441884.1_9 Forward -174 -155 -22.8133 0.284
NP_441893.1_5 Reverse -319 -333 15.7319 0.279
NP_441719.1_4 Reverse -64 -71 6.82395 0.0855
NP_441719.1_4 Forward -71 -64 6.52896 0.188
NP_441719.1_4 Forward -203 -196 3.77569 0.285
NP_441733.1_10 Reverse -60 -73 11.6223 0.106
NP_441004.1_1 Forward -363 -344 -5.40875 0.176
NP_441004.1_1 Forward -177 -158 -16.4218 0.284
NP_441004.1_1 Reverse -54 -73 -17.7001 0.294
NP_441004.1_1 Forward -246 -227 -18.0934 0.297
NP_441004.1_2 Forward -182 -163 17.8957 0.0653
NP_441004.1_2 Forward -368 -349 2.26107 0.215
NP_441004.1_2 Forward -251 -232 0.687771 0.23
NP_441004.1_2 Forward -239 -220 -1.47551 0.259
NP_441004.1_2 Reverse -247 -266 -2.45882 0.264
NP_441004.1_2 Reverse -274 -293 -4.6221 0.293
NP_441004.1_4 Forward -174 -164 9.91146 0.259
NP_442694.1_3 Forward -256 -238 -4.40575 0.268
NP_442206.1_10 Reverse -63 -78 -0.413427 0.292
NP_443054.1_2 Reverse -268 -282 -0.0987402 0.284
NP_441851.1_10 Forward -172 -162 7.25653 0.144
NP_441851.1_10 Reverse -257 -267 6.96153 0.151
NP_441851.1_10 Reverse -71 -81 5.28991 0.218
NP_441851.1_10 Forward -358 -348 4.3066 0.277
NP_441851.1_10 Reverse -194 -204 4.10993 0.287
NP_442208.1_5 Forward -254 -235 -8.45701 0.275
NP_442515.1_1 Reverse -161 -175 3.8345 0.112
NP_442515.1_1 Reverse -218 -232 -3.147 0.287
NP_440593.1_3 Reverse -157 -176 4.916 0.128
NP_440593.1_3 Forward -257 -238 -2.26216 0.224
NP_440593.1_3 Forward -77 -58 -7.4737 0.295
NP_440593.1_3 Reverse -343 -362 -7.67036 0.298
NP_440463.1_1 Reverse -227 -246 16.6174 0.288
NP_441349.1_10 Forward -342 -323 -3.73712 0.15
NP_441349.1_10 Forward -277 -258 -8.06369 0.266
NP_441394.1_10 Reverse -38 -56 14.2763 0.238
NP_440432.1_9 Forward -266 -251 -2.8717 0.176
NP_442843.1_1 Forward -266 -247 5.70265 0.144
NP_442843.1_1 Forward -80 -61 3.83436 0.153
NP_442843.1_1 Forward -239 -220 0.196116 0.17
NP_442843.1_1 Forward -179 -160 -9.44032 0.266
NP_442843.1_1 Forward -53 -34 -9.93197 0.272
NP_439960.1_10 Forward -259 -241 -3.42244 0.273
NP_442450.1_5 Reverse -256 -266 5.38824 0.245
NP_442168.1_5 Forward -266 -247 5.40766 0.202
NP_440588.1_2 Forward -148 -129 -3.04881 0.177
NP_442006.1_2 Reverse -279 -296 -14.4158 0.203
NP_442006.1_2 Forward -249 -232 -14.7108 0.208
NP_442006.1_3 Reverse -57 -75 -6.96235 0.298
NP_440483.1_1 Reverse -58 -77 -5.99873 0.238
NP_442038.1_7 Reverse -337 -356 24.2872 0.00456
NP_441570.1_1 Forward -72 -54 -16.8938 0.257
NP_441570.1_1 Forward -380 -362 -17.5821 0.283
NP_441570.1_1 Forward -171 -153 -17.8771 0.295
NP_441078.1_4 Forward -35 -26 6.09625 0.0863
NP_441078.1_4 Reverse -63 -72 0.196389 0.205
NP_441078.1_4 Forward -72 -63 -0.000272808 0.205
NP_441078.1_4 Reverse -258 -267 -2.06522 0.295
NP_441078.1_4 Reverse -26 -35 -2.06522 0.295
NP_441078.1_4 Forward -267 -258 -2.06522 0.295
NP_442729.1_4 Reverse -233 -252 19.0748 0.0702
NP_440539.1_9 Reverse -307 -326 -7.57203 0.299
NP_442348.1_2 Forward -279 -270 10.1278 0.27
NP_442443.1_1 Forward -160 -141 10.1275 0.108
NP_442443.1_1 Forward -145 -126 -3.83545 0.267
NP_442443.1_1 Forward -263 -244 -4.42544 0.272
NP_442443.1_1 Reverse -242 -261 -4.91709 0.28
NP_442443.1_1 Reverse -140 -159 -6.39206 0.294
NP_441432.1_8 Forward -36 -27 10.0295 0.0681
NP_441432.1_8 Reverse -62 -71 5.50626 0.151
NP_443024.1_3 Forward -359 -349 16.7946 0.251
NP_442320.1_8 Reverse -57 -71 -1.37704 0.0817
NP_442320.1_8 Reverse -156 -170 -6.29359 0.277
NP_441732.1_2 Reverse -59 -75 -15.8711 0.163
NP_440497.1_2 Forward -266 -247 10.8159 0.201
NP_440497.1_2 Forward -71 -52 3.24438 0.3
NP_440760.1_1 Reverse -162 -181 -14.1602 0.125
NP_440760.1_1 Forward -267 -248 -14.3569 0.129
NP_440760.1_1 Reverse -348 -367 -17.2085 0.194
NP_442797.1_1 Reverse -232 -251 0.786102 0.212
NP_442797.1_1 Reverse -46 -65 0.0977854 0.223
NP_442797.1_1 Reverse -229 -248 -1.47551 0.236
NP_442797.1_7 Forward -280 -262 9.26226 0.174
NP_442797.1_7 Forward -73 -55 -1.35749 0.297
NP_440199.1_10 Forward -96 -86 6.56821 0.296
NP_441057.1_4 Forward -288 -270 -3.91409 0.299
NP_442751.1_2 Reverse -56 -75 4.52188 0.261
NP_441072.1_2 Reverse -95 -114 5.50599 0.296
NP_440713.1_4 Forward -277 -258 8.94757 0.158
NP_440713.1_4 Reverse -53 -72 5.30933 0.212
NP_442489.1_2 Forward -104 -85 9.24257 0.168
NP_442489.1_7 Forward -72 -63 0.688044 0.152
NP_442489.1_7 Reverse -63 -72 0.688044 0.152
NP_442489.1_7 Forward -267 -258 -1.57357 0.213
NP_442489.1_7 Forward -35 -26 -1.6719 0.235
NP_442489.1_7 Reverse -162 -171 -1.86856 0.259
NP_442489.1_7 Forward -171 -162 -1.96689 0.28
NP_441452.1_1 Reverse -300 -319 14.3558 0.292
NP_441452.1_9 Reverse -127 -146 15.2408 0.236
NP_442079.1_7 Forward -266 -247 10.2259 0.111
NP_440559.1_1 Forward -170 -161 4.42462 0.277
NP_440559.1_1 Reverse -163 -172 4.22796 0.292
NP_441659.2_8 Reverse -26 -36 3.22496 0.169
NP_441659.2_8 Reverse -243 -253 0.176696 0.271
NP_441040.1_5 Reverse -312 -331 2.55606 0.28
NP_440442.1_3 Reverse -56 -70 15.4376 0.271
NP_442346.1_1 Forward -278 -259 11.3075 0.27
NP_442346.1_5 Reverse -257 -267 6.66654 0.195
NP_442346.1_5 Forward -172 -162 5.5849 0.238
NP_442346.1_10 Reverse -268 -287 4.03102 0.184
NP_442346.1_10 Forward -232 -213 -3.73712 0.296
NP_440545.1_3 Reverse -59 -76 -1.23946 0.165
NP_440545.1_3 Forward -292 -275 -5.1727 0.242
NP_440545.1_3 Forward -361 -344 -6.64766 0.285
NP_440025.1_3 Forward -175 -161 9.93309 0.29
NP_440555.1_3 Reverse -145 -164 18.2882 0.116
NP_441126.1_5 Reverse -238 -257 2.75272 0.299
NP_440459.1_2 Forward -95 -78 7.80699 0.278
NP_441653.1_2 Reverse -232 -251 10.294 0.133
NP_441653.1_2 Reverse -151 -170 7.2017 0.223
NP_441653.1_2 Reverse -52 -71 5.55893 0.245
NP_441653.1_2 Reverse -220 -239 3.43298 0.264
NP_440010.1_4 Forward -76 -57 -0.886293 0.265
NP_440010.1_4 Reverse -227 -246 -1.57461 0.267
NP_440847.1_3 Reverse -298 -312 10.717 0.283
NP_440847.1_5 Reverse -361 -380 12.5858 0.281
NP_442603.1_7 Reverse -63 -77 7.57046 0.202
NP_442603.1_10 Forward -286 -269 15.6232 0.267
NP_440946.1_6 Forward -260 -241 8.45592 0.294
NP_440946.1_6 Forward -62 -43 5.80098 0.294
NP_441833.1_4 Forward -71 -64 6.52896 0.0924
NP_441833.1_4 Reverse -64 -71 6.23397 0.163
NP_443040.1_1 Forward -396 -382 17.1415 0.276
NP_442162.1_9 Forward -71 -64 12.9205 0.0282
NP_442162.1_9 Reverse -64 -71 12.9205 0.0282
NP_440671.1_4 Forward -273 -259 5.40779 0.283
NP_440671.1_4 Forward -186 -172 4.91614 0.3
NP_442045.1_5 Forward -261 -242 3.6377 0.239
NP_442045.1_5 Reverse -168 -187 1.0811 0.265
NP_441915.1_6 Forward -70 -51 17.8469 0.259
NP_442140.1_3 Forward -71 -61 15.418 0.0393
NP_442140.1_3 Reverse -64 -74 10.0098 0.0949
NP_442140.1_3 Forward -266 -256 4.10993 0.261
NP_441609.1_1 Forward -325 -306 0.0977854 0.224
NP_440875.1_9 Forward -70 -60 15.2829 0.0295
NP_440875.1_9 Forward -202 -192 7.00932 0.287
NP_442547.1_7 Reverse -275 -294 11.293 0.26
NP_441813.1_5 Forward -74 -64 6.8632 0.0784
NP_441813.1_5 Reverse -61 -71 0.275027 0.206
NP_441813.1_5 Reverse -241 -251 -0.314959 0.239
NP_441813.1_5 Reverse -193 -203 -0.806614 0.285
NP_440590.1_4 Forward -71 -58 12.409 0.0141
NP_440590.1_4 Reverse -54 -67 1.49425 0.122
NP_440590.1_4 Forward -278 -265 -0.669033 0.196
NP_440590.1_4 Reverse -64 -77 -4.89726 0.269
NP_440567.1_1 Forward -71 -57 2.85119 0.16
NP_440567.1_1 Reverse -64 -78 1.08123 0.219
NP_440567.1_1 Reverse -259 -273 -0.688726 0.298
NP_442497.1_10 Forward -71 -62 0.589713 0.153
NP_442497.1_10 Forward -266 -257 0.393051 0.175
NP_442497.1_10 Reverse -163 -172 0.29472 0.199
NP_440821.1_4 Reverse -61 -71 9.02648 0.0364
NP_440821.1_4 Forward -74 -64 6.56821 0.0853
NP_440821.1_4 Forward -173 -163 -0.0199663 0.217
NP_440821.1_4 Reverse -256 -266 -0.118297 0.229
NP_440821.1_4 Forward -359 -349 -0.609952 0.279
NP_441239.1_9 Forward -74 -62 17.0502 0.0153
NP_441239.1_9 Forward -188 -176 9.67541 0.0987
NP_441239.1_9 Reverse -24 -36 3.38223 0.285
NP_441951.1_4 Forward -72 -53 14.8474 0.168
NP_441951.1_4 Forward -258 -239 7.96426 0.266
NP_441951.1_4 Reverse -270 -289 4.32602 0.273
NP_441892.1_1 Reverse -54 -71 9.47861 0.0722
NP_441892.1_1 Forward -213 -196 -3.50107 0.242
NP_441892.1_1 Reverse -249 -266 -5.86102 0.29
NP_441892.1_4 Forward -337 -318 -1.08219 0.28
NP_442044.1_1 Reverse -58 -77 -6.78538 0.211
NP_442193.1_1 Forward -249 -231 11.6222 0.224
NP_442643.1_1 Forward -243 -224 -5.01543 0.231
NP_441017.1_6 Forward -208 -194 11.7987 0.242
NP_442629.1_3 Forward -67 -48 2.55606 0.275
NP_442629.1_3 Forward -253 -234 -0.39387 0.294
NP_442629.1_3 Forward -295 -276 -0.590531 0.294
NP_440949.1_7 Forward -80 -61 9.53674 0.261
NP_440354.1_7 Forward -60 -42 7.39397 0.267
NP_440354.1_7 Reverse -57 -75 7.39397 0.267
NP_442052.1_7 Forward -292 -278 18.9775 0.152
NP_440546.1_4 Reverse -63 -73 14.0213 0.0459
NP_440546.1_4 Forward -35 -25 10.7247 0.108
NP_440546.1_4 Forward -267 -257 9.75513 0.121
NP_440546.1_4 Forward -72 -62 6.55553 0.291
NP_440546.1_6 Reverse -311 -330 8.75091 0.253
NP_440546.1_6 Reverse -242 -261 8.55425 0.256
NP_440546.1_6 Forward -352 -333 8.45592 0.256
NP_440675.1_3 Forward -248 -229 4.71934 0.3
NP_440675.1_3 Forward -62 -43 4.71934 0.3
NP_440462.1_6 Forward -74 -64 14.0414 0.0235
NP_440462.1_6 Reverse -61 -71 8.4365 0.062
NP_440462.1_6 Forward -206 -196 3.22496 0.255
NP_440462.1_9 Reverse -224 -243 13.0775 0.259
NP_442611.1_1 Reverse -58 -77 -1.7705 0.283
NP_440868.1_4 Forward -76 -64 13.5103 0.022
NP_440868.1_4 Reverse -59 -71 9.97041 0.0405
NP_441848.1_4 Forward -30 -14 7.26419 0.292
NP_440696.1_3 Forward -45 -27 1.49411 0.217
NP_440696.1_3 Forward -231 -213 0.0191479 0.237
NP_440696.1_3 Forward -76 -58 -0.865831 0.249
NP_440843.1_8 Forward -171 -152 12.8808 0.297
NP_442039.1_4 Reverse -64 -71 11.6422 0.0747
NP_441811.1_8 Forward -177 -163 6.78443 0.263
NP_440825.1_6 Forward -281 -262 14.3558 0.242
NP_442837.1_3 Forward -71 -64 6.0373 0.25
NP_442837.1_3 Reverse -64 -71 6.0373 0.25
NP_440160.1_2 Reverse -257 -276 -8.45701 0.286
NP_442053.1_1 Forward -72 -63 14.4544 0.0114
NP_442053.1_1 Reverse -63 -72 7.86621 0.0863
NP_440505.1_3 Reverse -61 -71 12.5664 0.0482
NP_440505.1_3 Forward -182 -172 6.96153 0.169
NP_440351.1_8 Forward -190 -172 13.7855 0.162
NP_441252.1_6 Forward -174 -167 11.9372 0.25
NP_441252.1_6 Forward -360 -353 11.6422 0.288
NP_442532.1_7 Reverse -63 -77 12.586 0.0947
NP_441011.1_8 Reverse -64 -73 11.7994 0.0629
NP_441011.1_8 Forward -71 -62 7.07956 0.179
NP_441011.1_8 Forward -34 -25 6.78456 0.184
NP_442533.1_6 Reverse -258 -267 14.7494 0.00935
NP_442533.1_6 Reverse -72 -81 5.50626 0.14
NP_442533.1_6 Reverse -26 -35 5.40793 0.14
NP_442533.1_6 Reverse -323 -332 4.52295 0.179
NP_442533.1_6 Forward -72 -63 4.42462 0.179
NP_442533.1_6 Reverse -297 -306 1.96635 0.28
NP_442533.1_6 Forward -288 -279 1.37636 0.3
NP_442541.1_10 Reverse -269 -283 5.50552 0.248
NP_442541.1_10 Reverse -26 -40 2.45727 0.262
NP_442232.1_3 Reverse -55 -74 -7.27704 0.198
NP_442322.1_4 Reverse -267 -284 -3.60008 0.249
NP_443016.1_10 Forward -44 -25 13.7658 0.169
NP_441482.1_7 Reverse -252 -266 -3.44199 0.124
NP_441482.1_7 Reverse -57 -71 -8.5552 0.193
NP_441482.1_7 Forward -177 -163 -11.3085 0.254
NP_439944.1_9 Forward -266 -256 5.28991 0.262
NP_441749.1_7 Reverse -58 -77 13.9625 0.205
NP_442202.1_4 Forward -74 -60 12.5444 0.29
NP_442202.1_10 Reverse -211 -225 6.6861 0.255
NP_440116.1_8 Forward -170 -151 -5.99873 0.2
NP_440116.1_8 Forward -278 -259 -8.55534 0.254
NP_441527.1_4 Forward -210 -191 -5.5867 0.204
NP_440115.1_6 Reverse -60 -70 9.61647 0.115
NP_439965.1_1 Forward -276 -257 2.0644 0.115
NP_441347.1_5 Forward -273 -259 10.9137 0.269
NP_443045.1_2 Reverse -156 -175 16.6174 0.181
NP_441602.1_3 Reverse -58 -77 9.63589 0.117
NP_441602.1_3 Forward -254 -235 2.3594 0.199
NP_441602.1_3 Forward -77 -58 0.491109 0.217
NP_441602.1_3 Forward -176 -157 -1.47551 0.227
NP_441602.1_3 Forward -362 -343 -5.9004 0.3
NP_442890.1_9 Reverse -55 -74 15.4374 0.227
NP_441972.1_5 Forward -266 -247 -3.14714 0.197
NP_441972.1_5 Forward -71 -52 -3.24547 0.199
NP_441106.1_1 Reverse -62 -71 8.45619 0.0548
NP_441106.1_1 Reverse -242 -251 5.11294 0.178
NP_440429.1_2 Reverse -238 -257 15.0441 0.176
NP_440429.1_2 Reverse -52 -71 10.7175 0.267
NP_442306.1_10 Forward -77 -58 -20.65 0.219
NP_441286.1_1 Forward -268 -256 -4.38592 0.156
NP_441286.1_1 Reverse -161 -173 -4.48425 0.161
NP_441286.1_1 Reverse -62 -74 -5.17256 0.192
NP_440670.1_8 Reverse -63 -72 8.75118 0.0606
NP_440670.1_8 Forward -72 -63 6.19458 0.124
NP_442908.1_9 Forward -260 -241 10.7175 0.209
NP_440886.1_7 Forward -73 -63 16.4991 0.0104
NP_440886.1_7 Reverse -62 -72 6.86274 0.113
NP_440886.1_7 Reverse -170 -180 3.12618 0.296
NP_442072.1_9 Forward -172 -154 -22.892 0.266
NP_442213.1_5 Forward -295 -276 9.93088 0.127
NP_440907.2_8 Forward -71 -61 15.7125 0.0168
NP_440907.2_8 Forward -266 -256 6.76441 0.15
NP_440907.2_8 Reverse -298 -308 4.20782 0.273
NP_442264.1_2 Forward -181 -164 6.43035 0.259
NP_442264.1_2 Forward -367 -350 5.34871 0.277
NP_440176.1_3 Reverse -263 -277 17.3052 0.219
NP_441463.1_6 Forward -83 -69 20.8144 0.0553
NP_441463.1_6 Forward -269 -255 16.949 0.114
NP_441463.1_6 Reverse -160 -174 6.70583 0.267
NP_441626.1_2 Reverse -64 -71 12.2322 0.0511
NP_441626.1_2 Forward -71 -64 5.93897 0.231
NP_442365.1_7 Reverse -266 -285 1.96607 0.168
NP_442365.1_7 Forward -76 -57 -3.63879 0.222
NP_442365.1_7 Reverse -260 -279 -5.70374 0.277
NP_442362.1_5 Reverse -44 -63 15.8299 0.174
NP_442362.1_5 Reverse -230 -249 15.0432 0.211
NP_442238.1_3 Forward -56 -37 5.70265 0.254
NP_442238.1_3 Forward -284 -265 4.62101 0.278
NP_440107.1_5 Forward -73 -54 -3.24547 0.178
NP_442794.1_1 Reverse -80 -92 8.49544 0.104
NP_442794.1_1 Reverse -260 -272 3.77555 0.286
NP_442794.1_1 Reverse -266 -278 2.49725 0.288
NP_442615.1_1 Forward -276 -258 -2.53746 0.145
NP_441962.1_4 Reverse -58 -77 -2.36049 0.132
NP_441962.1_4 Reverse -157 -176 -2.75381 0.137
NP_441962.1_4 Forward -350 -331 -4.22878 0.157
NP_441962.1_4 Forward -272 -253 -5.21209 0.166
NP_441962.1_4 Forward -86 -67 -6.29373 0.175
NP_441962.1_4 Reverse -349 -368 -6.78538 0.181
NP_441962.1_4 Reverse -244 -263 -9.14533 0.213
NP_441962.1_4 Forward -176 -157 -9.93197 0.222
NP_441962.1_4 Forward -143 -124 -11.3086 0.239
NP_441962.1_4 Reverse -238 -257 -13.0786 0.268
NP_441962.1_4 Forward -329 -310 -14.0619 0.282
NP_441962.1_4 Forward -362 -343 -14.9469 0.296
NP_440387.1_1 Reverse -63 -79 3.30346 0.0612
NP_440387.1_1 Forward -72 -56 -5.448 0.232
NP_440855.1_1 Forward -252 -233 0.884433 0.229
NP_441431.1_2 Forward -75 -61 13.4703 0.0891
NP_441431.1_2 Reverse -60 -74 12.8803 0.104
NP_441431.1_2 Reverse -276 -290 5.80051 0.288
NP_441993.1_1 Forward -300 -281 0.679741 0.294
NP_441993.1_1 Forward -72 -53 0.582284 0.297
NP_440814.1_8 Forward -215 -196 16.6174 0.114
NP_440114.1_10 Forward -35 -21 16.4209 0.0185
NP_440114.1_10 Forward -306 -292 10.6193 0.142
NP_440114.1_10 Reverse -162 -176 10.0294 0.155
NP_440114.1_10 Reverse -63 -77 10.0294 0.155
NP_442323.1_7 Reverse -343 -362 3.04693 0.252
NP_441720.1_2 Forward -235 -216 4.81688 0.231
NP_440293.1_3 Forward -179 -160 7.17762 0.184
NP_440293.1_3 Forward -365 -346 1.37609 0.207
NP_440293.1_3 Forward -350 -331 -6.09707 0.286
NP_440293.1_10 Forward -360 -341 -2.26216 0.271
NP_440766.1_4 Reverse -59 -73 21.8291 0.0197
NP_440766.1_4 Forward -256 -242 1.96621 0.205
NP_442103.1_2 Forward -378 -360 10.0481 0.246
NP_441133.1_1 Forward -248 -229 17.6007 0.135
NP_441133.1_1 Forward -62 -43 14.6508 0.2
NP_440457.1_1 Reverse -59 -71 9.47875 0.0927
NP_440457.1_1 Forward -244 -232 0.432302 0.25
NP_440798.1_2 Reverse -167 -181 17.8952 0.191
NP_440798.1_6 Forward -71 -58 2.57589 0.17
NP_440801.1_9 Forward -339 -325 12.9322 0.286
NP_440801.1_10 Reverse -59 -78 5.89931 0.289
NP_442297.1_3 Reverse -272 -291 12.9783 0.193
NP_441984.1_1 Reverse -57 -75 9.95058 0.214
NP_441984.1_1 Forward -68 -50 7.29564 0.283
NP_441984.1_1 Forward -242 -224 5.82068 0.288
NP_441984.1_3 Reverse -41 -59 5.42735 0.286
NP_442509.1_9 Reverse -63 -73 11.9759 0.107
NP_442509.1_9 Forward -72 -62 9.71433 0.192
NP_442509.1_9 Reverse -270 -280 8.23937 0.192
NP_442936.1_10 Reverse -11 -25 10.0295 0.262
NP_440554.1_4 Forward -71 -61 10.9931 0.0429
NP_441761.1_1 Forward -266 -247 9.73422 0.188
NP_441885.1_5 Reverse -258 -268 8.1415 0.0355
NP_441885.1_5 Forward -171 -161 0.668351 0.133
NP_441885.1_5 Reverse -63 -73 0.0783647 0.183
NP_441885.1_5 Reverse -72 -82 -1.69159 0.277
NP_442341.1_7 Forward -73 -59 11.7993 0.051
NP_442341.1_7 Reverse -62 -76 4.71948 0.181
NP_442341.1_7 Forward -301 -287 2.45787 0.256
NP_440409.1_1 Reverse -154 -173 -0.295539 0.216
NP_440423.1_6 Reverse -55 -74 -10.9153 0.162
NP_442513.1_5 Forward -260 -241 5.80018 0.287
NP_440727.1_9 Forward -258 -240 18.407 0.147
NP_441842.1_10 Reverse -56 -70 10.521 0.161
NP_440275.1_3 Reverse -61 -71 15.418 0.0178
NP_440275.1_3 Forward -254 -244 7.35486 0.0755
NP_440091.1_1 Reverse -59 -71 0.432302 0.25
NP_442354.1_8 Forward -367 -348 7.7676 0.266
NP_442275.1_2 Forward -231 -212 16.0274 0.104
NP_441902.1_3 Forward -216 -206 12.0099 0.281
NP_440679.1_2 Forward -79 -61 15.1621 0.281
NP_440679.1_10 Reverse -56 -75 -20.4534 0.284
NP_443010.1_10 Reverse -60 -77 12.0476 0.0951
NP_442451.1_2 Reverse -154 -173 17.699 0.0317
NP_442451.1_2 Reverse -340 -359 -6.98204 0.232
NP_442451.1_2 Reverse -55 -74 -7.17871 0.232
NP_442451.1_2 Forward -179 -160 -8.16202 0.241
NP_439962.1_4 Reverse -241 -260 5.30933 0.176
NP_439962.1_4 Reverse -232 -251 4.71934 0.178
NP_439962.1_4 Forward -230 -211 3.6377 0.187
NP_439962.1_4 Reverse -55 -74 3.14605 0.195
NP_439962.1_4 Reverse -235 -254 0.884433 0.197
NP_439962.1_4 Forward -365 -346 -0.4922 0.199
NP_439962.1_4 Forward -266 -247 -1.86883 0.223
NP_439962.1_4 Forward -80 -61 -3.3438 0.251
NP_439962.1_4 Reverse -136 -155 -5.01543 0.272
NP_439962.1_4 Forward -74 -55 -5.50708 0.28
NP_439962.1_4 Reverse -220 -239 -5.70374 0.28
NP_439962.1_4 Reverse -46 -65 -5.9004 0.28
NP_439962.1_4 Reverse -169 -188 -7.96535 0.292
NP_439962.1_4 Reverse -154 -173 -8.35868 0.293
NP_439962.1_4 Reverse -340 -359 -8.55534 0.296
NP_439962.1_4 Forward -248 -229 -9.047 0.298
NP_439962.1_6 Forward -342 -324 14.3755 0.194
NP_439962.1_8 Forward -175 -156 19.174 0.0907
NP_440175.1_7 Forward -288 -270 9.5583 0.28
NP_440149.1_8 Forward -72 -53 7.07928 0.0628
NP_440149.1_8 Forward -171 -152 2.0644 0.115
NP_440149.1_8 Forward -279 -260 -8.16202 0.3
NP_441105.1_3 Reverse -15 -34 -6.68705 0.239
NP_442373.1_2 Forward -267 -248 -8.94866 0.254
NP_440678.1_9 Reverse -58 -77 8.94757 0.279
NP_440172.1_1 Forward -171 -161 10.9931 0.0445
NP_441226.1_7 Reverse -64 -71 12.7234 0.0312
NP_441226.1_7 Forward -71 -64 11.5435 0.0757
NP_441226.1_7 Reverse -259 -266 11.2485 0.0971
NP_441226.1_7 Reverse -298 -305 8.29857 0.205
NP_440413.1_1 Reverse -240 -259 6.4893 0.165
NP_441111.1_7 Forward -71 -63 8.86921 0.0589
NP_441766.1_2 Forward -72 -63 14.7494 0.00772
NP_441766.1_2 Forward -252 -243 3.83464 0.202
NP_440416.1_1 Reverse -63 -82 -14.4552 0.288
NP_440416.1_9 Reverse -262 -281 -18.6834 0.262
NP_440416.1_9 Reverse -263 -282 -19.5684 0.276
NP_443052.1_9 Reverse -229 -248 12.9791 0.0657
NP_443052.1_9 Reverse -43 -62 12.6841 0.0695
NP_443052.1_9 Reverse -145 -164 10.1275 0.106
NP_443052.1_9 Forward -73 -54 -2.75381 0.242
NP_443052.1_9 Reverse -271 -290 -4.22878 0.255
NP_443052.1_9 Reverse -343 -362 -4.42544 0.258
NP_443052.1_9 Reverse -46 -65 -6.58872 0.285
NP_443052.1_9 Reverse -241 -260 -7.08038 0.293
NP_440072.1_5 Forward -344 -326 -1.45582 0.259
NP_440072.1_5 Forward -242 -224 -3.6191 0.281
NP_441940.1_2 Forward -342 -323 17.5024 0.112
NP_442403.1_9 Reverse -60 -79 10.8159 0.163
NP_442403.1_9 Forward -75 -56 8.35759 0.191
NP_442154.1_1 Forward -239 -221 -5.78238 0.127
NP_442154.1_1 Forward -248 -230 -8.24065 0.158
NP_442154.1_1 Forward -251 -233 -9.91228 0.195
NP_442154.1_1 Forward -373 -355 -10.6989 0.21
NP_442154.1_1 Forward -53 -35 -15.2222 0.218
NP_442154.1_1 Forward -266 -248 -15.7138 0.224
NP_442154.1_1 Forward -344 -326 -17.5821 0.26
NP_442154.1_1 Forward -62 -44 -17.9754 0.273
NP_440261.1_5 Forward -80 -67 -2.93064 0.0983
NP_440261.1_5 Reverse -163 -176 -10.4038 0.201
NP_440261.1_5 Forward -266 -253 -11.9771 0.268
NP_440261.1_5 Forward -71 -58 -12.4687 0.297
NP_440988.1_10 Reverse -268 -282 4.60839 0.258
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATCAAGAAAACAGTCAAATTGACGATACCGATATTGCGGCTGGTGCAATTGCAGTCGGGACTGTAGCTGGGGCTGGACTTTCCGCAACTATTGGAGGGATGGGATTAACCGTTGCCGGGGCCGGGATTGGCATAGGGATGGCCCCAGTTGCGGCCGCTGGTGCGGTGGTTGGGTCTGCCGCCTTTGGAGCAAAAAAAGCAATCGAAGGTCAAGATCCAATGGCAGTTGGGGCAATTGCTACTGGTGCGGTAGTTGGAGCAGGGACATCTGCGGCATTAGGTGGAATGGGATTAGCTCTTACTGGAACGGCCATAGGAATAGGAATGGCCCCGATCGCCGCCGCTGGTGCGGTAGTTGGATTAGCTGGCTATGGGCTGTACAAAATGTTTGGCGGTGAATA

CDS

ATGCCCAAACCAGATCCATTCCAGAGTCTTGTTAGGGGATTCGTTAGGGATCTCATCGATGCAGTTAATGGGCAGGAAAGGGAGAAAAAAGTCACATTGGGGGAAAGTTTTCCCAGTGGACAAAAGCATCCTGAGTCTTGGTATCAAAAAAGGTTAGCGAAAAAATTGGGGGGAGACATCGAAGTTCAAACCCCCGTTGGCAGGATAGATATTCTGACCAAGACCGAAATTATTGAAGTCAAGACCGCCAAGAACTGGAAAGCGGCGATCGGGCAAGTCAAAAGTTATGGCAGATATTACACCAATCATTCGTTGAGGATTCATCTTTTTGGAGCCATTAAGCCCAGTCAGCTAATTCTTATCAAACAAACCTGTAAAGACGAAGGAATTGCTTTGACCCACGAAGAAATTTCTTTATAA

Protein

MPKPDPFQSLVRGFVRDLIDAVNGQEREKKVTLGESFPSGQKHPESWYQKRLAKKLGGDIEVQTPVGRIDILTKTEIIEVKTAKNWKAAIGQVKSYGRYYTNHSLRIHLFGAIKPSQLILIKQTCKDEGIALTHEEISL