Your browser is old and dusty. Try Google Chrome!

Details for sll0327

ORF sll0327
Accession NP_442037.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -225 -239 7.27608 0.104
NP_441061.1_2 Forward -232 -218 1.76955 0.183
NP_440557.1_7 Forward -218 -206 16.2636 0.279
NP_440795.1_7 Forward -232 -225 14.6904 0.0123
NP_440795.1_7 Reverse -225 -232 14.6904 0.0123
NP_440795.1_7 Forward -61 -54 14.6904 0.0123
NP_440795.1_7 Reverse -54 -61 14.6904 0.0123
NP_442100.1_1 Forward -191 -172 13.0342 0.146
NP_441418.1_1 Forward -206 -187 7.4002 0.275
NP_441418.1_6 Reverse -224 -243 6.78429 0.00677
NP_441418.1_6 Forward -233 -214 -28.6149 0.206
NP_441418.1_6 Reverse -53 -72 -29.6965 0.234
NP_442291.1_5 Forward -234 -218 2.02515 0.135
NP_440897.1_6 Forward -233 -214 -1.67294 0.194
NP_441453.1_4 Reverse -224 -232 16.539 0.00633
NP_441453.1_4 Reverse -53 -61 16.539 0.00633
NP_441453.1_4 Forward -233 -225 16.539 0.00633
NP_441453.1_4 Forward -62 -54 16.539 0.00633
NP_442151.1_6 Forward -233 -219 16.9125 0.013
NP_442151.1_6 Reverse -53 -67 15.7325 0.0214
NP_442151.1_6 Reverse -224 -238 7.17775 0.206
NP_442151.1_6 Forward -62 -48 6.6861 0.224
NP_441818.1_1 Forward -232 -221 18.8393 0.00301
NP_441818.1_1 Forward -61 -50 9.69459 0.232
NP_441818.1_6 Forward -240 -226 8.35772 0.274
NP_441818.1_9 Reverse -282 -301 -6.58872 0.264
NP_440226.1_1 Forward -62 -43 21.6323 0.00635
NP_440226.1_1 Reverse -53 -72 15.3391 0.025
NP_440226.1_1 Reverse -224 -243 14.6508 0.0293
NP_440226.1_1 Forward -233 -214 13.5691 0.0352
NP_441630.1_3 Reverse -216 -235 14.1591 0.05
NP_441630.1_3 Forward -70 -51 5.80098 0.136
NP_440996.1_3 Reverse -223 -241 10.0489 0.265
NP_442655.1_1 Reverse -48 -67 8.75091 0.0965
NP_442173.1_1 Forward -232 -224 15.4574 0.00633
NP_442173.1_1 Forward -61 -53 15.4574 0.00633
NP_442173.1_1 Reverse -225 -233 15.4574 0.00633
NP_442173.1_1 Reverse -54 -62 15.4574 0.00633
NP_442752.1_4 Forward -233 -226 13.8055 0.0199
NP_442752.1_4 Reverse -224 -231 13.8055 0.0199
NP_442752.1_4 Forward -62 -55 13.8055 0.0199
NP_442752.1_4 Reverse -53 -60 13.8055 0.0199
NP_442752.1_5 Forward -269 -255 20.1568 0.119
NP_443027.1_4 Forward -235 -225 15.3197 0.0437
NP_443027.1_4 Reverse -51 -61 14.828 0.0437
NP_443027.1_4 Reverse -222 -232 14.0414 0.0452
NP_443027.1_4 Forward -64 -54 7.25653 0.24
NP_441812.1_3 Reverse -223 -237 16.2242 0.0755
NP_441812.1_3 Forward -63 -49 8.55439 0.251
NP_441812.1_3 Reverse -52 -66 8.55439 0.251
NP_442975.1_10 Reverse -49 -63 22.32 0.000414
NP_442975.1_10 Reverse -220 -234 13.1753 0.0459
NP_442975.1_10 Forward -66 -52 10.6187 0.0541
NP_442975.1_10 Forward -237 -223 3.24392 0.26
NP_440784.1_7 Forward -232 -225 15.9687 0.0123
NP_440784.1_7 Reverse -225 -232 15.9687 0.0123
NP_440784.1_7 Forward -61 -54 15.9687 0.0123
NP_440784.1_7 Reverse -54 -61 15.9687 0.0123
NP_440061.1_9 Reverse -222 -236 10.9137 0.121
NP_441054.1_2 Forward -370 -351 15.0441 0.155
NP_442062.1_8 Forward -62 -52 19.4496 0.000558
NP_442062.1_8 Forward -233 -223 17.3846 0.00193
NP_442062.1_8 Reverse -224 -234 10.3048 0.0493
NP_442062.1_8 Reverse -53 -63 10.3048 0.0493
NP_440761.1_4 Forward -238 -219 -12.6852 0.257
NP_441859.1_3 Reverse -223 -242 14.3549 0.0705
NP_442972.1_1 Reverse -88 -106 6.71299 0.291
NP_441802.1_1 Forward -350 -331 5.211 0.286
NP_440304.1_4 Forward -235 -225 18.9579 0.00406
NP_440304.1_4 Forward -64 -54 10.8948 0.051
NP_440304.1_4 Reverse -222 -232 10.8948 0.051
NP_440304.1_4 Reverse -51 -61 10.8948 0.051
NP_440304.1_4 Forward -392 -382 6.56821 0.15
NP_440304.1_4 Forward -152 -142 5.09324 0.229
NP_442242.1_4 Forward -232 -225 14.3954 0.0124
NP_442242.1_4 Reverse -225 -232 14.3954 0.0124
NP_442242.1_4 Forward -61 -54 14.3954 0.0124
NP_442242.1_4 Reverse -54 -61 14.3954 0.0124
NP_440044.1_8 Forward -232 -213 5.01433 0.106
NP_440044.1_8 Reverse -54 -73 3.6377 0.126
NP_442097.1_2 Reverse -34 -53 1.37609 0.259
NP_439918.1_2 Reverse -282 -301 -1.18052 0.239
NP_441935.1_2 Forward -74 -55 6.29264 0.103
NP_441208.1_9 Forward -65 -51 11.8976 0.145
NP_441208.1_9 Forward -236 -222 7.47274 0.221
NP_441208.1_9 Reverse -221 -235 6.88276 0.229
NP_442276.1_2 Reverse -212 -231 4.42435 0.299
NP_442110.1_7 Forward -233 -219 9.14437 0.0755
NP_442110.1_7 Reverse -53 -67 1.86788 0.222
NP_442110.1_7 Reverse -224 -238 1.27789 0.233
NP_441082.1_10 Reverse -283 -296 7.78743 0.296
NP_440856.1_4 Forward -240 -221 -1.27885 0.195
NP_440856.1_4 Forward -69 -50 -3.63879 0.234
NP_441083.1_5 Forward -233 -223 20.3345 0.00053
NP_441083.1_5 Forward -62 -52 11.3864 0.0159
NP_441083.1_5 Reverse -224 -234 11.2881 0.0159
NP_441083.1_5 Reverse -53 -63 11.2881 0.0159
NP_442827.1_8 Reverse -216 -235 9.53674 0.07
NP_441738.1_2 Forward -231 -224 15.28 0.0102
NP_441738.1_2 Reverse -226 -233 15.28 0.0102
NP_441738.1_2 Forward -60 -53 15.28 0.0102
NP_441738.1_2 Reverse -55 -62 15.28 0.0102
NP_441558.1_5 Forward -235 -216 4.71934 0.271
NP_440209.1_1 Reverse -224 -232 18.1123 0.00295
NP_440209.1_1 Reverse -53 -61 18.1123 0.00295
NP_440209.1_1 Forward -233 -225 18.1123 0.00295
NP_440209.1_1 Forward -62 -54 18.1123 0.00295
NP_440209.1_1 Reverse -330 -338 2.1827 0.254
NP_442889.1_8 Reverse -50 -64 13.077 0.0596
NP_442889.1_8 Forward -236 -222 8.06211 0.133
NP_442889.1_8 Forward -65 -51 7.3738 0.152
NP_441713.1_1 Forward -239 -220 -12.9802 0.251
NP_441713.1_1 Reverse -47 -66 -13.8652 0.257
NP_440178.1_7 Forward -234 -215 3.73603 0.0199
NP_440178.1_7 Forward -63 -44 -12.9802 0.129
NP_440178.1_7 Reverse -52 -71 -13.3736 0.136
NP_441025.1_6 Forward -204 -185 3.54706 0.24
NP_441716.1_1 Forward -233 -219 4.22782 0.256
NP_441716.1_1 Forward -62 -48 4.22782 0.256
NP_441716.1_1 Forward -312 -298 2.65453 0.298
NP_442111.1_4 Reverse -223 -237 12.8809 0.0413
NP_440906.1_5 Forward -232 -225 15.8704 0.0124
NP_440906.1_5 Reverse -225 -232 15.8704 0.0124
NP_440906.1_5 Forward -61 -54 15.8704 0.0124
NP_440906.1_5 Reverse -54 -61 15.8704 0.0124
NP_440747.1_10 Forward -236 -224 7.80712 0.00223
NP_440747.1_10 Reverse -221 -233 7.51213 0.00286
NP_440747.1_10 Forward -65 -53 5.54551 0.0128
NP_440747.1_10 Reverse -50 -62 -2.02597 0.0196
NP_441130.1_10 Reverse -51 -65 9.93102 0.118
NP_441130.1_10 Reverse -222 -236 7.17775 0.167
NP_441486.1_1 Reverse -50 -64 14.1593 0.00654
NP_441486.1_1 Forward -65 -51 11.111 0.0174
NP_441486.1_1 Reverse -221 -235 5.80112 0.0344
NP_441486.1_1 Forward -236 -222 -5.01529 0.218
NP_442634.1_4 Reverse -222 -236 6.58777 0.0489
NP_442634.1_4 Forward -235 -221 5.50613 0.0561
NP_442634.1_4 Forward -64 -50 -2.36035 0.149
NP_441695.1_9 Forward -337 -323 19.1741 0.185
NP_442848.1_1 Reverse -218 -232 -2.36035 0.263
NP_442848.1_5 Forward -19 -1 2.87075 0.276
NP_443018.1_3 Forward -232 -225 14.8871 0.0123
NP_443018.1_3 Reverse -225 -232 14.8871 0.0123
NP_443018.1_3 Forward -61 -54 14.8871 0.0123
NP_443018.1_3 Reverse -54 -61 14.8871 0.0123
NP_441316.1_7 Reverse -222 -237 17.3845 0.0397
NP_441316.1_7 Reverse -51 -66 3.22482 0.144
NP_441634.1_8 Reverse -222 -236 3.63784 0.145
NP_441634.1_8 Forward -64 -50 -4.32697 0.295
NP_440376.1_1 Forward -233 -224 19.4693 0.000692
NP_440376.1_1 Reverse -224 -233 19.4693 0.000692
NP_440376.1_1 Forward -62 -53 19.4693 0.000692
NP_440376.1_1 Reverse -53 -62 19.4693 0.000692
NP_440376.1_1 Forward -390 -381 4.62128 0.154
NP_440376.1_1 Reverse -375 -384 1.96635 0.236
NP_441588.1_4 Reverse -55 -65 16.2046 0.0369
NP_441588.1_4 Forward -231 -221 8.63316 0.14
NP_441588.1_4 Forward -60 -50 6.96153 0.178
NP_442687.1_7 Reverse -52 -62 15.8113 0.0125
NP_442687.1_7 Reverse -329 -339 10.5998 0.0994
NP_442687.1_7 Forward -234 -224 9.02648 0.0994
NP_442687.1_7 Forward -63 -53 9.02648 0.0994
NP_442687.1_7 Reverse -223 -233 8.92815 0.0994
NP_442687.1_7 Forward -313 -303 3.61828 0.299
NP_441846.1_10 Forward -331 -312 -21.6334 0.256
NP_440642.1_10 Reverse -200 -214 6.98048 0.224
NP_441013.1_3 Forward -332 -313 8.45592 0.243
NP_442658.1_1 Reverse -51 -61 15.9091 0.00966
NP_442658.1_1 Forward -235 -225 15.9091 0.00966
NP_442658.1_1 Forward -64 -54 13.0576 0.04
NP_442658.1_1 Reverse -222 -232 6.76441 0.214
NP_440141.1_8 Forward -399 -380 6.19431 0.268
NP_442205.1_9 Forward -239 -223 -3.77637 0.295
NP_440656.1_8 Forward -73 -54 -9.14533 0.276
NP_442544.1_6 Forward -240 -221 2.94938 0.111
NP_441414.1_9 Forward -233 -214 0.786102 0.0789
NP_441414.1_9 Forward -62 -43 -6.78538 0.203
NP_440800.1_2 Reverse -159 -178 16.2831 0.147
NP_441487.1_6 Forward -241 -222 -0.590531 0.276
NP_441487.1_9 Reverse -52 -71 3.93269 0.154
NP_441478.1_5 Reverse -303 -322 16.5191 0.236
NP_441958.1_5 Forward -234 -224 21.2195 0.000805
NP_441958.1_5 Forward -63 -53 21.2195 0.000805
NP_441958.1_5 Reverse -223 -233 12.2714 0.00183
NP_441958.1_5 Reverse -52 -62 12.2714 0.00183
NP_440203.1_5 Reverse -227 -237 10.4026 0.225
NP_440984.1_7 Forward -67 -53 15.4376 0.0548
NP_440984.1_7 Forward -238 -224 10.7177 0.122
NP_440984.1_7 Reverse -219 -233 7.57108 0.166
NP_439990.1_5 Forward -238 -225 6.60746 0.227
NP_442690.1_1 Reverse -172 -191 5.70265 0.0692
NP_442911.1_2 Forward -243 -224 8.55425 0.0203
NP_442911.1_2 Reverse -43 -62 4.71934 0.0369
NP_442911.1_2 Reverse -214 -233 -1.7705 0.0897
NP_440993.1_2 Reverse -219 -235 9.10498 0.124
NP_440993.1_2 Forward -67 -51 3.30346 0.259
NP_440993.1_2 Forward -238 -222 2.51681 0.265
NP_440993.1_7 Reverse -125 -139 19.301 0.131
NP_440602.1_2 Reverse -376 -395 1.0811 0.268
NP_440602.1_8 Forward -233 -219 17.5025 0.0898
NP_441099.1_5 Forward -243 -224 -9.93197 0.237
NP_441099.1_5 Reverse -214 -233 -10.6203 0.258
NP_442002.1_9 Reverse -52 -59 10.7572 0.185
NP_440809.1_9 Forward -242 -224 -7.749 0.225
NP_440809.1_9 Forward -265 -247 -9.0273 0.291
NP_442598.1_2 Forward -373 -364 14.0611 0.268
NP_441712.1_3 Forward -254 -241 13.4906 0.288
NP_441294.1_7 Reverse -49 -63 12.5142 0.0944
NP_441294.1_7 Reverse -220 -234 10.7864 0.171
NP_441294.1_7 Forward -66 -52 9.25063 0.256
NP_441646.1_1 Forward -240 -221 -1.57384 0.291
NP_442438.1_10 Reverse -219 -233 7.86607 0.0859
NP_442438.1_10 Reverse -48 -62 1.67122 0.19
NP_441000.1_6 Forward -63 -49 5.1128 0.0933
NP_441000.1_6 Reverse -52 -66 3.53951 0.111
NP_441000.1_6 Forward -234 -220 -4.62196 0.248
NP_441674.1_6 Forward -247 -228 2.65439 0.275
NP_440147.1_4 Forward -64 -51 11.6223 0.0326
NP_440147.1_4 Reverse -222 -235 10.934 0.0346
NP_440147.1_4 Forward -235 -222 3.65753 0.183
NP_440147.1_4 Reverse -51 -64 2.87088 0.202
NP_441550.1_8 Forward -235 -225 17.4824 0.00754
NP_441550.1_8 Forward -64 -54 15.3192 0.0132
NP_441550.1_8 Reverse -222 -232 12.3692 0.0336
NP_441550.1_8 Reverse -51 -61 6.0761 0.214
NP_441916.1_7 Reverse -224 -234 18.9579 0.00144
NP_441916.1_7 Reverse -53 -63 18.9579 0.00144
NP_441916.1_7 Forward -62 -52 18.4663 0.00144
NP_441916.1_7 Forward -233 -223 10.3048 0.0261
NP_441916.1_10 Forward -398 -379 2.26107 0.25
NP_440345.1_5 Reverse -179 -193 15.0979 0.272
NP_441041.1_4 Forward -233 -214 -2.16383 0.108
NP_441041.1_4 Forward -62 -43 -3.54046 0.123
NP_441041.1_4 Forward -332 -313 -8.85033 0.208
NP_441041.1_4 Forward -326 -307 -13.5702 0.291
NP_441041.1_7 Forward -65 -53 17.7184 0.00706
NP_441041.1_7 Forward -236 -224 14.9975 0.0309
NP_441041.1_7 Reverse -50 -62 10.916 0.0864
NP_442642.1_9 Forward -240 -223 6.52869 0.192
NP_440569.1_7 Forward -233 -214 10.9142 0.286
NP_442004.1_6 Reverse -224 -238 2.75286 0.257
NP_441725.1_4 Forward -238 -224 3.14559 0.279
NP_441725.1_5 Forward -232 -222 11.2881 0.0247
NP_441725.1_5 Forward -61 -51 11.2881 0.0247
NP_441725.1_5 Reverse -225 -235 8.92815 0.0553
NP_441725.1_5 Reverse -54 -64 1.94665 0.115
NP_441725.1_5 Reverse -142 -152 0.0783647 0.215
NP_439966.1_7 Reverse -51 -61 18.4657 0.00473
NP_439966.1_7 Reverse -222 -232 15.8108 0.0124
NP_439966.1_7 Forward -235 -225 13.8442 0.0234
NP_439966.1_7 Forward -64 -54 6.27276 0.185
NP_439966.1_9 Forward -235 -226 0.983037 0.253
NP_439966.1_9 Reverse -51 -60 0.983037 0.253
NP_442941.1_3 Forward -232 -222 19.9412 0.00262
NP_442941.1_3 Forward -61 -51 11.4848 0.0116
NP_442941.1_3 Reverse -54 -64 11.0914 0.0116
NP_442941.1_3 Reverse -225 -235 10.9931 0.0116
NP_440289.1_2 Reverse -50 -63 14.5723 0.0107
NP_440289.1_2 Reverse -221 -234 6.50913 0.0591
NP_440289.1_2 Forward -236 -223 2.18257 0.102
NP_440289.1_2 Forward -65 -52 -2.04567 0.251
NP_442281.1_1 Forward -67 -53 17.8952 0.00513
NP_442281.1_1 Reverse -219 -233 17.2068 0.00633
NP_442281.1_1 Forward -238 -224 15.0436 0.0144
NP_442281.1_1 Reverse -48 -62 11.9953 0.0418
NP_442256.1_2 Forward -235 -217 1.29745 0.107
NP_442256.1_2 Reverse -51 -69 -7.35568 0.214
NP_442256.1_2 Reverse -222 -240 -9.12563 0.249
NP_440437.1_1 Forward -68 -49 0.58944 0.168
NP_440437.1_1 Reverse -218 -237 -5.99873 0.3
NP_441457.1_7 Forward -64 -45 0.491109 0.287
NP_441556.1_4 Forward -399 -380 10.4871 0.279
NP_440498.1_1 Forward -242 -224 -0.669169 0.218
NP_440498.1_1 Forward -71 -53 -4.20908 0.296
NP_442982.1_5 Reverse -214 -233 -3.44213 0.298
NP_441644.1_6 Reverse -224 -234 19.0557 0.000803
NP_441644.1_6 Reverse -53 -63 19.0557 0.000803
NP_441644.1_6 Forward -233 -223 17.3841 0.00127
NP_441644.1_6 Forward -62 -52 10.1076 0.0628
NP_441644.1_6 Reverse -381 -391 3.91283 0.256
NP_442215.1_2 Forward -235 -219 3.59845 0.094
NP_442215.1_2 Reverse -51 -67 0.648521 0.148
NP_442177.1_5 Reverse -290 -304 8.25939 0.281
NP_440253.1_2 Forward -62 -44 20.472 0.00505
NP_440253.1_2 Reverse -53 -71 1.29745 0.163
NP_440253.1_2 Reverse -224 -242 -1.65248 0.245
NP_440253.1_2 Forward -233 -215 -1.75081 0.249
NP_440929.1_8 Forward -233 -224 19.2726 0.000701
NP_440929.1_8 Reverse -224 -233 19.2726 0.000701
NP_440929.1_8 Forward -62 -53 19.2726 0.000701
NP_440929.1_8 Reverse -53 -62 19.2726 0.000701
NP_442933.1_10 Forward -233 -224 17.601 0.00325
NP_442933.1_10 Reverse -224 -233 17.601 0.00325
NP_442933.1_10 Forward -62 -53 17.601 0.00325
NP_442933.1_10 Reverse -53 -62 17.601 0.00325
NP_441751.2_8 Reverse -225 -239 13.7659 0.015
NP_441751.2_8 Forward -232 -218 -3.147 0.134
NP_441751.2_8 Forward -61 -47 -4.13031 0.163
NP_442554.1_8 Reverse -225 -235 19.1546 0.00369
NP_442554.1_8 Reverse -54 -64 16.4013 0.0065
NP_442554.1_8 Forward -232 -222 15.9097 0.00747
NP_442554.1_8 Forward -61 -51 13.8447 0.0145
NP_441762.1_7 Reverse -52 -64 9.47875 0.0142
NP_441762.1_7 Forward -63 -51 2.98891 0.0676
NP_441762.1_7 Reverse -223 -235 2.59558 0.0676
NP_441762.1_7 Forward -340 -328 -5.46756 0.212
NP_441762.1_7 Forward -234 -222 -6.74586 0.284
NP_442142.1_4 Reverse -50 -63 16.4399 0.0264
NP_442142.1_4 Reverse -221 -234 14.7683 0.0302
NP_442142.1_4 Forward -236 -223 12.9 0.0406
NP_442142.1_4 Forward -65 -52 12.9 0.0406
NP_442292.1_1 Forward -232 -223 18.486 0.00229
NP_442292.1_1 Reverse -225 -234 17.5026 0.00435
NP_442292.1_1 Reverse -54 -63 17.5026 0.00435
NP_442292.1_1 Forward -61 -52 9.63616 0.0183
NP_440122.1_8 Reverse -313 -332 17.0099 0.273
NP_442476.1_6 Reverse -225 -239 2.75286 0.174
NP_441711.1_4 Forward -242 -223 3.04771 0.255
NP_443009.1_5 Forward -63 -52 19.626 0.00102
NP_443009.1_5 Reverse -223 -234 14.5128 0.02
NP_443009.1_5 Forward -234 -223 10.1862 0.0792
NP_443009.1_5 Forward -151 -140 9.00628 0.0965
NP_443009.1_5 Reverse -52 -63 7.82632 0.118
NP_442301.1_2 Reverse -310 -329 3.34192 0.296
NP_442408.2_1 Forward -233 -214 0.196116 0.202
NP_441715.1_4 Forward -61 -51 16.303 0.0117
NP_441715.1_4 Forward -232 -222 14.828 0.0268
NP_441715.1_4 Reverse -54 -64 7.35486 0.108
NP_441715.1_4 Reverse -225 -235 7.25653 0.108
NP_440620.1_4 Reverse -354 -368 16.5317 0.236
NP_441198.1_8 Forward -235 -225 15.4199 0.0427
NP_441198.1_8 Forward -64 -54 12.783 0.116
NP_441468.1_1 Forward -232 -225 15.8704 0.0124
NP_441468.1_1 Reverse -225 -232 15.8704 0.0124
NP_441468.1_1 Forward -61 -54 15.8704 0.0124
NP_441468.1_1 Reverse -54 -61 15.8704 0.0124
NP_441020.2_6 Reverse -222 -239 16.9518 0.0231
NP_441020.2_6 Reverse -51 -68 12.6252 0.0903
NP_441020.2_6 Forward -235 -218 9.18362 0.179
NP_441015.1_10 Forward -238 -219 -8.45701 0.273
NP_441673.1_1 Forward -233 -224 20.8459 0.000698
NP_441673.1_1 Reverse -224 -233 20.8459 0.000698
NP_441673.1_1 Forward -62 -53 20.8459 0.000698
NP_441673.1_1 Reverse -53 -62 20.8459 0.000698
NP_441339.1_4 Forward -397 -378 -1.96717 0.227
NP_441876.1_9 Reverse -307 -317 14.4342 0.267
NP_441876.1_9 Reverse -208 -218 11.3859 0.275
NP_441826.1_2 Reverse -218 -232 6.29277 0.0944
NP_441637.1_9 Reverse -187 -205 -0.669169 0.292
NP_442868.1_6 Reverse -222 -232 9.91146 0.038
NP_442868.1_6 Forward -235 -225 8.63316 0.0555
NP_442868.1_6 Forward -64 -54 0.963343 0.205
NP_442868.1_6 Reverse -51 -61 0.963343 0.205
NP_441056.1_1 Forward -233 -214 -1.47551 0.184
NP_441612.1_2 Forward -233 -223 8.54929 0.21
NP_443058.1_7 Reverse -223 -242 11.7008 0.206
NP_442361.1_3 Reverse -218 -231 9.85238 0.272
NP_442361.1_3 Forward -68 -55 8.47575 0.285
NP_442427.1_3 Forward -238 -220 5.82068 0.171
NP_442427.1_8 Reverse -132 -151 5.01433 0.284
NP_442808.1_1 Reverse -52 -62 18.4657 0.00201
NP_442808.1_1 Forward -234 -224 8.73102 0.0481
NP_442808.1_1 Forward -63 -53 8.73102 0.0481
NP_442808.1_1 Reverse -223 -233 8.63269 0.0481
NP_440145.1_3 Reverse -43 -62 -0.000545616 0.138
NP_442542.1_2 Forward -235 -222 13.294 0.114
NP_442050.1_5 Forward -235 -225 17.1874 0.00812
NP_442050.1_5 Reverse -222 -232 16.4991 0.00812
NP_442050.1_5 Forward -64 -54 9.22267 0.193
NP_442050.1_5 Reverse -51 -61 9.12434 0.193
NP_442903.1_2 Forward -197 -178 5.1084 0.196
NP_442903.1_2 Forward -209 -190 2.05265 0.297
NP_441114.1_3 Forward -389 -380 7.66954 0.231
NP_442789.1_4 Reverse -222 -241 -8.35868 0.299
NP_441518.1_3 Forward -47 -28 -11.8003 0.261
NP_441518.1_3 Reverse -214 -233 -12.0953 0.262
NP_441518.1_3 Reverse -43 -62 -12.9802 0.264
NP_441878.1_6 Forward -234 -224 10.5014 0.0176
NP_441878.1_6 Forward -63 -53 10.5014 0.0176
NP_441878.1_6 Reverse -223 -233 10.4031 0.0176
NP_441878.1_6 Reverse -52 -62 10.4031 0.0176
NP_441878.1_6 Forward -391 -381 -6.60814 0.193
NP_441036.1_8 Reverse -52 -62 17.7779 0.000554
NP_441036.1_8 Forward -234 -224 15.713 0.00724
NP_441036.1_8 Forward -63 -53 15.713 0.00724
NP_441036.1_8 Reverse -223 -233 8.33817 0.174
NP_442503.1_9 Reverse -223 -242 7.17762 0.272
NP_441557.1_5 Forward -233 -224 19.9609 0.000699
NP_441557.1_5 Reverse -224 -233 19.9609 0.000699
NP_441557.1_5 Forward -62 -53 19.9609 0.000699
NP_441557.1_5 Reverse -53 -62 19.9609 0.000699
NP_441557.1_8 Reverse -322 -332 10.206 0.292
NP_441445.1_1 Reverse -44 -63 6.68596 0.144
NP_441445.1_1 Forward -242 -223 2.94938 0.224
NP_441445.1_1 Forward -71 -52 0.982764 0.264
NP_442066.2_9 Forward -237 -224 12.3107 0.154
NP_442066.2_9 Forward -366 -353 6.4108 0.291
NP_441739.1_2 Forward -310 -294 5.85938 0.227
NP_441308.1_8 Forward -235 -225 12.4681 0.218
NP_441308.1_8 Reverse -51 -61 10.1081 0.22
NP_440101.1_3 Forward -238 -219 2.16274 0.259
NP_441458.1_8 Reverse -162 -181 3.82988 0.273
NP_442183.1_1 Reverse -224 -238 19.1741 0.0065
NP_442183.1_1 Forward -62 -48 10.226 0.0869
NP_442183.1_1 Forward -233 -219 7.37441 0.143
NP_441407.1_5 Reverse -214 -233 5.80098 0.199
NP_441407.1_5 Forward -72 -53 5.211 0.219
NP_440979.1_3 Reverse -225 -243 12.2122 0.234
NP_441819.1_5 Forward -194 -175 9.11906 0.275
NP_441574.1_1 Reverse -224 -243 6.68596 0.112
NP_441574.1_1 Reverse -269 -288 -7.27704 0.286
NP_441549.1_9 Reverse -220 -238 -7.45401 0.207
NP_440861.1_2 Reverse -112 -131 10.1973 0.27
NP_442347.1_2 Forward -232 -223 12.4878 0.056
NP_442347.1_2 Forward -61 -52 11.1111 0.056
NP_442347.1_2 Reverse -225 -234 3.34298 0.284
NP_442347.1_2 Reverse -54 -63 3.34298 0.284
NP_442645.1_2 Reverse -45 -64 -14.1602 0.171
NP_442645.1_2 Reverse -373 -392 -18.8801 0.28
NP_442645.1_2 Forward -235 -216 -21.7317 0.29
NP_442645.1_2 Forward -70 -51 -21.7317 0.29
NP_441037.1_4 Forward -235 -225 16.5761 0.0168
NP_441037.1_4 Forward -64 -54 15.0168 0.028
NP_441037.1_4 Reverse -51 -61 7.02532 0.237
NP_442594.1_7 Reverse -213 -232 9.34008 0.186
NP_442508.1_8 Forward -228 -211 11.1502 0.256
NP_441633.1_3 Reverse -222 -235 3.65753 0.0699
NP_441633.1_3 Forward -64 -51 1.29759 0.109
NP_441633.1_3 Reverse -51 -64 -3.81562 0.177
NP_440136.1_2 Forward -232 -225 15.9687 0.0123
NP_440136.1_2 Reverse -225 -232 15.9687 0.0123
NP_440136.1_2 Forward -61 -54 15.9687 0.0123
NP_440136.1_2 Reverse -54 -61 15.9687 0.0123
NP_442998.1_5 Forward -214 -204 10.3048 0.218
NP_442998.1_10 Forward -231 -224 15.5754 0.0102
NP_442998.1_10 Reverse -226 -233 15.5754 0.0102
NP_442998.1_10 Forward -60 -53 15.5754 0.0102
NP_442998.1_10 Reverse -55 -62 15.5754 0.0102
NP_440299.1_1 Reverse -220 -233 4.44361 0.207
NP_440299.1_1 Forward -237 -224 2.96866 0.265
NP_440299.1_1 Reverse -49 -62 2.28034 0.292
NP_441799.1_1 Forward -66 -52 17.3052 0.011
NP_441799.1_1 Forward -237 -223 15.6336 0.0172
NP_441799.1_1 Reverse -220 -234 11.012 0.0629
NP_441799.1_1 Reverse -49 -63 9.73373 0.0857
NP_441007.1_10 Forward -238 -225 20.3738 0.0153
NP_441007.1_10 Forward -67 -54 2.67422 0.183
NP_441007.1_10 Reverse -219 -232 0.805932 0.216
NP_440256.1_1 Forward -65 -46 5.89931 0.0331
NP_440256.1_1 Reverse -50 -69 3.6377 0.0514
NP_440256.1_1 Forward -236 -217 0.58944 0.0818
NP_440256.1_1 Reverse -378 -397 -0.4922 0.0936
NP_440256.1_1 Reverse -221 -240 -5.50708 0.184
NP_441559.1_8 Reverse -48 -62 -6.19526 0.275
NP_440915.1_6 Reverse -49 -63 5.89945 0.0879
NP_440915.1_6 Reverse -220 -234 4.03116 0.1
NP_440915.1_6 Forward -237 -223 3.73617 0.1
NP_442785.1_7 Forward -392 -378 17.0108 0.131
NP_441866.1_1 Forward -365 -346 17.5248 0.201
NP_442866.1_1 Forward -238 -219 -3.14714 0.217
NP_442866.1_4 Forward -320 -301 4.81767 0.249
NP_440695.1_5 Reverse -224 -243 -1.57384 0.285
NP_441939.1_3 Reverse -225 -244 9.73422 0.134
NP_441199.1_6 Reverse -299 -318 1.67108 0.213
NP_441199.1_6 Reverse -220 -239 1.57275 0.214
NP_441494.1_6 Forward -238 -225 8.77074 0.227
NP_442993.1_1 Forward -62 -46 10.7766 0.0168
NP_442993.1_1 Forward -233 -217 -7.61128 0.146
NP_442993.1_1 Reverse -53 -69 -9.47957 0.186
NP_440677.1_1 Forward -242 -223 19.6656 0.0472
NP_442386.1_9 Reverse -52 -61 15.7322 0.0144
NP_442386.1_9 Reverse -223 -232 13.8639 0.0289
NP_442386.1_9 Forward -234 -225 6.39082 0.219
NP_442386.1_9 Forward -63 -54 6.39082 0.219
NP_442386.1_9 Reverse -311 -320 5.30919 0.257
NP_441340.1_5 Forward -232 -225 15.6737 0.0124
NP_441340.1_5 Reverse -225 -232 15.6737 0.0124
NP_441340.1_5 Forward -61 -54 15.6737 0.0124
NP_441340.1_5 Reverse -54 -61 15.6737 0.0124
NP_441947.1_4 Forward -267 -248 13.3725 0.222
NP_441947.1_4 Forward -73 -54 10.3242 0.3
NP_442484.1_2 Reverse -213 -232 -0.885524 0.277
NP_440168.1_9 Reverse -222 -241 -4.22878 0.296
NP_442240.1_2 Reverse -234 -253 -7.08038 0.123
NP_440161.1_3 Forward -341 -322 14.1591 0.123
NP_442950.1_1 Forward -201 -182 -5.11376 0.244
NP_440586.1_8 Forward -232 -225 13.2151 0.026
NP_440586.1_8 Forward -61 -54 13.2151 0.026
NP_440586.1_8 Reverse -225 -232 13.2151 0.026
NP_440586.1_8 Reverse -54 -61 13.2151 0.026
NP_442251.1_6 Forward -232 -225 15.2804 0.0124
NP_442251.1_6 Reverse -225 -232 15.2804 0.0124
NP_442251.1_6 Forward -61 -54 15.2804 0.0124
NP_442251.1_6 Reverse -54 -61 15.2804 0.0124
NP_442251.1_6 Forward -338 -331 8.69224 0.199
NP_442959.1_5 Forward -151 -132 7.7676 0.23
NP_441262.1_3 Reverse -224 -231 14.7888 0.0223
NP_441262.1_3 Reverse -53 -60 14.7888 0.0223
NP_441262.1_3 Forward -233 -226 14.7888 0.0223
NP_441262.1_3 Forward -62 -55 14.7888 0.0223
NP_443051.1_1 Forward -234 -225 19.5676 0.00335
NP_443051.1_1 Forward -63 -54 19.5676 0.00335
NP_443051.1_1 Reverse -223 -232 10.4228 0.00754
NP_443051.1_1 Reverse -52 -61 10.4228 0.00754
NP_439937.1_9 Forward -313 -296 -14.6131 0.287
NP_439937.1_9 Forward -63 -46 -16.5797 0.287
NP_440408.1_7 Reverse -224 -243 7.47261 0.288
NP_440439.1_1 Forward -236 -223 10.344 0.0369
NP_440439.1_1 Reverse -50 -63 8.08242 0.0559
NP_440439.1_1 Forward -65 -52 2.08423 0.138
NP_440439.1_1 Reverse -221 -234 -0.177378 0.209
NP_440372.1_2 Forward -232 -225 16.3621 0.0124
NP_440372.1_2 Reverse -225 -232 16.3621 0.0124
NP_440372.1_2 Forward -61 -54 16.3621 0.0124
NP_440372.1_2 Reverse -54 -61 16.3621 0.0124
NP_441138.1_5 Reverse -189 -202 2.92653 0.297
NP_441293.1_3 Forward -204 -186 11.7475 0.291
NP_441803.1_2 Forward -238 -219 1.96607 0.222
NP_439977.1_5 Forward -239 -220 1.57275 0.191
NP_441572.1_1 Reverse -379 -398 -6.78538 0.297
NP_440267.1_2 Forward -67 -53 11.012 0.125
NP_440267.1_2 Reverse -219 -233 8.45543 0.162
NP_440267.1_2 Forward -151 -137 5.40719 0.268
NP_442384.1_10 Reverse -224 -237 7.49244 0.0807
NP_442384.1_10 Forward -233 -220 1.10092 0.268
NP_441877.1_9 Reverse -187 -204 2.10379 0.292
NP_442262.1_10 Forward -232 -225 14.1988 0.0123
NP_442262.1_10 Reverse -225 -232 14.1988 0.0123
NP_442262.1_10 Forward -61 -54 14.1988 0.0123
NP_442262.1_10 Reverse -54 -61 14.1988 0.0123
NP_441689.1_5 Reverse -222 -232 15.3192 0.0403
NP_441689.1_5 Reverse -51 -61 8.53436 0.132
NP_441689.1_5 Forward -235 -225 8.43603 0.132
NP_441689.1_5 Forward -64 -54 8.3377 0.132
NP_440163.1_10 Reverse -50 -60 15.2213 0.0762
NP_440163.1_10 Reverse -221 -231 11.3864 0.169
NP_440344.1_10 Reverse -46 -63 3.0871 0.0274
NP_440344.1_10 Forward -69 -52 -1.33779 0.0527
NP_440344.1_10 Forward -240 -223 -1.73112 0.0566
NP_440282.1_10 Forward -243 -224 0.392778 0.194
NP_440282.1_10 Forward -400 -381 -8.16202 0.26
NP_442123.1_3 Reverse -224 -243 19.3707 0.0449
NP_442917.1_1 Forward -198 -179 5.89851 0.29
NP_440562.1_3 Reverse -225 -242 3.0871 0.247
NP_441965.1_10 Reverse -221 -237 9.20332 0.123
NP_441640.1_8 Forward -232 -213 5.89931 0.111
NP_440297.1_9 Forward -232 -222 9.32148 0.0917
NP_440297.1_9 Forward -61 -51 9.32148 0.0917
NP_440297.1_9 Reverse -382 -392 3.81494 0.26
NP_440297.1_9 Reverse -54 -64 -0.216628 0.282
NP_440297.1_9 Reverse -225 -235 -0.314959 0.282
NP_441896.1_3 Reverse -44 -63 -2.36049 0.281
NP_442378.1_1 Forward -187 -170 16.8534 0.22
NP_441679.1_6 Forward -238 -219 0.294447 0.268
NP_440999.1_9 Forward -237 -223 9.93102 0.0574
NP_440999.1_9 Reverse -49 -63 2.06454 0.154
NP_440888.1_2 Forward -233 -219 18.0918 0.00261
NP_440888.1_2 Forward -62 -48 15.5352 0.0102
NP_440888.1_2 Reverse -224 -238 11.4053 0.0681
NP_440888.1_2 Reverse -53 -67 8.45543 0.16
NP_441771.1_4 Forward -186 -167 -3.24547 0.292
NP_440491.1_1 Reverse -50 -69 9.25599 0.218
NP_440491.1_1 Forward -236 -217 7.79413 0.258
NP_440663.1_5 Reverse -247 -266 10.4225 0.281
NP_442277.1_4 Forward -71 -52 1.08032 0.286
NP_442033.1_10 Reverse -318 -337 -8.752 0.206
NP_441949.1_5 Forward -207 -188 18.1997 0.0704
NP_442818.1_1 Forward -297 -278 6.48849 0.0796
NP_441543.1_2 Forward -61 -52 18.486 0.00236
NP_441543.1_2 Forward -232 -223 16.9127 0.00359
NP_441543.1_2 Reverse -225 -234 15.9293 0.00518
NP_441543.1_2 Reverse -54 -63 15.9293 0.00518
NP_442845.1_2 Reverse -218 -232 5.01447 0.247
NP_442845.1_2 Forward -239 -225 4.32615 0.261
NP_442710.1_7 Forward -202 -183 -8.37606 0.299
NP_441469.1_8 Reverse -52 -61 16.126 0.00797
NP_441469.1_8 Forward -234 -225 6.5879 0.227
NP_441469.1_8 Forward -63 -54 6.5879 0.227
NP_441469.1_8 Reverse -223 -232 6.48957 0.227
NP_443064.1_6 Reverse -303 -313 13.5365 0.0796
NP_443064.1_6 Forward -233 -223 12.5669 0.0796
NP_443064.1_6 Reverse -224 -234 10.8217 0.13
NP_443064.1_6 Reverse -53 -63 10.8217 0.13
NP_442578.1_7 Forward -232 -225 14.5921 0.026
NP_442578.1_7 Forward -61 -54 14.5921 0.026
NP_442578.1_7 Reverse -225 -232 14.5921 0.026
NP_442578.1_7 Reverse -54 -61 14.5921 0.026
NP_440710.1_1 Forward -398 -380 0.21581 0.163
NP_441462.1_2 Reverse -224 -234 20.2362 0.000805
NP_441462.1_2 Reverse -53 -63 20.2362 0.000805
NP_441462.1_2 Forward -233 -223 11.5831 0.00406
NP_441462.1_2 Forward -62 -52 11.5831 0.00406
NP_441621.1_7 Reverse -222 -236 4.62115 0.0934
NP_441621.1_7 Reverse -51 -65 -5.50694 0.254
NP_443062.1_1 Forward -233 -215 13.9088 0.0553
NP_443062.1_1 Forward -62 -44 11.5686 0.0962
NP_443062.1_1 Reverse -53 -71 9.81352 0.127
NP_443062.1_1 Reverse -224 -242 6.79079 0.192
NP_443062.1_1 Reverse -330 -348 6.40076 0.202
NP_443062.1_6 Forward -147 -128 0.687771 0.291
NP_442204.1_1 Forward -260 -249 3.79525 0.266
NP_442204.1_1 Forward -237 -226 2.12362 0.266
NP_442780.1_1 Forward -203 -184 7.37428 0.279
NP_440454.1_2 Forward -208 -194 10.3247 0.291
NP_440516.1_2 Reverse -200 -218 0.904127 0.213
NP_440516.1_8 Forward -233 -224 16.9127 0.00442
NP_440516.1_8 Reverse -224 -233 16.9127 0.00442
NP_440516.1_8 Forward -62 -53 16.9127 0.00442
NP_440516.1_8 Reverse -53 -62 16.9127 0.00442
NP_441785.1_1 Forward -62 -48 11.3809 0.3
NP_441033.1_2 Forward -72 -53 -9.14533 0.293
NP_442428.1_5 Forward -232 -225 15.8704 0.0124
NP_442428.1_5 Reverse -225 -232 15.8704 0.0124
NP_442428.1_5 Forward -61 -54 15.8704 0.0124
NP_442428.1_5 Reverse -54 -61 15.8704 0.0124
NP_442120.1_10 Forward -233 -214 -16.2252 0.297
NP_442823.1_8 Reverse -224 -243 11.8975 0.275
NP_440673.1_3 Forward -231 -224 12.4288 0.0426
NP_440673.1_3 Forward -60 -53 12.4288 0.0426
NP_440673.1_3 Reverse -226 -233 12.4288 0.0426
NP_440673.1_3 Reverse -55 -62 12.4288 0.0426
NP_440673.1_3 Forward -337 -330 10.4622 0.139
NP_440673.1_7 Reverse -213 -232 10.1275 0.111
NP_441714.1_3 Forward -240 -222 14.178 0.196
NP_441052.1_2 Forward -233 -223 19.9412 0.00106
NP_441052.1_2 Forward -62 -52 10.5014 0.0285
NP_441052.1_2 Reverse -224 -234 10.4031 0.0285
NP_441052.1_2 Reverse -53 -63 10.4031 0.0285
NP_442219.1_9 Forward -232 -223 17.7976 0.00718
NP_442219.1_9 Forward -61 -52 8.35786 0.0681
NP_442219.1_9 Reverse -225 -234 8.25953 0.0681
NP_442219.1_9 Reverse -54 -63 8.25953 0.0681
NP_440436.1_4 Forward -61 -52 18.1905 0.00233
NP_440436.1_4 Forward -232 -223 17.2072 0.00233
NP_440436.1_4 Reverse -225 -234 9.24241 0.0871
NP_440436.1_4 Reverse -54 -63 9.24241 0.0871
NP_441884.1_8 Forward -331 -312 -7.86702 0.254
NP_441884.1_9 Reverse -221 -240 -15.3402 0.138
NP_441884.1_9 Forward -236 -217 -22.2233 0.277
NP_441884.1_9 Reverse -50 -69 -22.6167 0.281
NP_440314.1_1 Forward -187 -168 15.7324 0.0882
NP_440314.1_1 Reverse -172 -191 11.2092 0.219
NP_440314.1_9 Forward -61 -42 -8.35868 0.247
NP_441719.1_4 Forward -232 -225 16.3621 0.0124
NP_441719.1_4 Reverse -225 -232 16.3621 0.0124
NP_441719.1_4 Forward -61 -54 16.3621 0.0124
NP_441719.1_4 Reverse -54 -61 16.3621 0.0124
NP_441733.1_10 Forward -65 -52 8.27909 0.14
NP_441733.1_10 Forward -236 -223 6.31247 0.192
NP_441733.1_10 Reverse -12 -25 4.44418 0.261
NP_442366.1_3 Reverse -52 -70 11.1305 0.0392
NP_442366.1_3 Forward -234 -216 9.16393 0.0578
NP_442366.1_3 Forward -63 -45 -4.60241 0.274
NP_442366.1_5 Forward -65 -55 14.8275 0.0375
NP_442873.1_9 Forward -243 -224 4.12856 0.287
NP_442206.1_10 Reverse -224 -239 16.3028 0.0799
NP_440328.1_4 Reverse -218 -237 15.3391 0.0338
NP_442312.1_3 Reverse -190 -209 22.123 0.0539
NP_443054.1_2 Reverse -51 -65 11.2093 0.0761
NP_443054.1_2 Forward -64 -50 3.24451 0.24
NP_443054.1_2 Reverse -222 -236 2.75286 0.241
NP_443054.1_2 Forward -71 -57 1.17956 0.251
NP_441851.1_10 Reverse -52 -62 16.008 0.00552
NP_441851.1_10 Reverse -223 -233 15.8113 0.00552
NP_441851.1_10 Forward -234 -224 8.53483 0.114
NP_441851.1_10 Forward -63 -53 8.53483 0.114
NP_441273.1_5 Reverse -293 -311 14.6697 0.286
NP_442515.1_1 Reverse -223 -237 6.58777 0.0975
NP_442515.1_1 Forward -234 -220 0.786239 0.18
NP_442515.1_1 Reverse -302 -316 -4.32697 0.298
NP_441396.1_5 Forward -221 -212 8.35786 0.224
NP_440593.1_3 Forward -42 -23 -7.67036 0.298
NP_442689.1_8 Reverse -176 -193 8.10198 0.138
NP_441349.1_10 Reverse -214 -233 -0.885524 0.0967
NP_441409.1_6 Forward -239 -220 1.76941 0.0586
NP_441409.1_6 Reverse -47 -66 -4.22878 0.0899
NP_440432.1_9 Reverse -54 -69 7.74804 0.0427
NP_440432.1_9 Forward -232 -217 7.64971 0.0427
NP_440432.1_9 Reverse -225 -240 -0.0201027 0.163
NP_440432.1_9 Forward -61 -46 -2.77337 0.175
NP_442843.1_1 Forward -338 -319 -11.8003 0.293
NP_440474.1_8 Forward -61 -47 13.4703 0.0696
NP_440474.1_8 Reverse -225 -239 6.39049 0.227
NP_440474.1_8 Reverse -54 -68 6.29216 0.228
NP_440474.1_8 Forward -232 -218 5.70218 0.244
NP_441124.1_5 Reverse -350 -360 12.4352 0.221
NP_440431.1_3 Forward -340 -321 -8.06369 0.224
NP_440431.1_4 Forward -207 -188 -4.91826 0.226
NP_442450.1_5 Reverse -222 -232 9.32148 0.115
NP_442450.1_5 Reverse -51 -61 9.32148 0.115
NP_442450.1_5 Forward -64 -54 7.64985 0.13
NP_440040.1_7 Forward -104 -87 13.5094 0.293
NP_440943.1_5 Reverse -379 -393 11.3077 0.273
NP_442038.1_1 Reverse -176 -195 21.8289 0.0156
NP_442038.1_3 Reverse -17 -36 19.9606 0.039
NP_442038.1_4 Reverse -84 -103 25.4672 0.00682
NP_442038.1_5 Reverse -237 -256 24.4839 0.0119
NP_442038.1_6 Reverse -206 -225 23.8939 0.0203
NP_441570.1_1 Forward -233 -215 7.78729 0.0159
NP_441570.1_1 Reverse -53 -71 -11.0923 0.187
NP_441570.1_1 Reverse -381 -399 -17.0904 0.264
NP_441570.1_1 Reverse -224 -242 -17.6804 0.287
NP_441078.1_4 Forward -233 -224 19.6659 0.0007
NP_441078.1_4 Reverse -224 -233 19.6659 0.0007
NP_441078.1_4 Forward -62 -53 19.6659 0.0007
NP_441078.1_4 Reverse -53 -62 19.6659 0.0007
NP_441078.1_4 Forward -390 -381 -1.37691 0.254
NP_440526.1_3 Forward -232 -221 10.1862 0.0646
NP_440526.1_3 Reverse -225 -236 9.3996 0.0876
NP_440526.1_3 Forward -61 -50 1.92649 0.267
NP_440526.1_3 Reverse -54 -65 1.92649 0.267
NP_441432.1_8 Reverse -223 -232 16.8143 0.00595
NP_441432.1_8 Forward -234 -225 16.8143 0.00595
NP_441432.1_8 Forward -63 -54 16.8143 0.00595
NP_441432.1_8 Forward -391 -382 12.2911 0.0444
NP_441432.1_8 Forward -321 -312 9.53783 0.0755
NP_441432.1_8 Reverse -52 -61 8.25953 0.0755
NP_442320.1_8 Reverse -47 -61 15.4376 0.0102
NP_442320.1_8 Reverse -218 -232 11.8976 0.0175
NP_442320.1_8 Forward -68 -54 -3.93365 0.136
NP_442344.1_7 Reverse -54 -73 -7.4737 0.183
NP_441732.1_2 Forward -237 -221 -6.92296 0.0558
NP_441732.1_2 Reverse -220 -236 -16.2644 0.165
NP_441732.1_2 Forward -66 -50 -16.5594 0.174
NP_440629.1_6 Forward -239 -220 15.4332 0.129
NP_441737.1_7 Forward -250 -231 10.4225 0.172
NP_442003.1_4 Forward -232 -213 9.63589 0.299
NP_440760.1_1 Forward -233 -214 -22.42 0.257
NP_441131.1_5 Forward -321 -302 3.6377 0.251
NP_440199.1_10 Reverse -221 -231 16.7946 0.0381
NP_440199.1_10 Reverse -50 -60 14.533 0.0861
NP_440913.1_1 Forward -235 -217 10.9339 0.168
NP_442489.1_2 Reverse -213 -232 1.27776 0.293
NP_442489.1_7 Forward -233 -224 20.1576 0.000695
NP_442489.1_7 Reverse -224 -233 20.1576 0.000695
NP_442489.1_7 Forward -62 -53 20.1576 0.000695
NP_442489.1_7 Reverse -53 -62 20.1576 0.000695
NP_442489.1_7 Forward -390 -381 -1.37691 0.195
NP_442489.1_7 Reverse -381 -390 -1.6719 0.235
NP_442079.1_7 Reverse -225 -244 0.196116 0.286
NP_442079.1_7 Forward -61 -42 0.196116 0.286
NP_440559.1_1 Forward -232 -223 17.4043 0.00658
NP_440559.1_1 Forward -61 -52 8.75118 0.0586
NP_440559.1_1 Reverse -225 -234 8.65285 0.0586
NP_440559.1_1 Reverse -54 -63 8.65285 0.0586
NP_441659.2_8 Reverse -224 -234 20.9245 0.000805
NP_441659.2_8 Reverse -53 -63 20.9245 0.000805
NP_441659.2_8 Forward -233 -223 18.1713 0.00133
NP_441659.2_8 Forward -62 -52 11.9764 0.0147
NP_441659.2_8 Reverse -381 -391 -0.314959 0.298
NP_442913.1_10 Reverse -215 -234 16.4207 0.0143
NP_442913.1_10 Forward -71 -52 7.7676 0.0518
NP_440779.1_5 Forward -233 -216 -4.97604 0.12
NP_440779.1_5 Reverse -53 -70 -5.95935 0.157
NP_442346.1_5 Reverse -223 -233 16.6963 0.00248
NP_442346.1_5 Forward -234 -224 16.303 0.00248
NP_442346.1_5 Forward -63 -53 16.303 0.00248
NP_442346.1_5 Reverse -52 -62 9.02648 0.118
NP_440545.1_3 Reverse -220 -237 5.34871 0.0623
NP_440545.1_3 Forward -66 -49 -6.64766 0.285
NP_441856.1_3 Reverse -221 -240 5.50599 0.127
NP_441856.1_3 Reverse -50 -69 -3.3438 0.283
NP_441629.1_1 Reverse -45 -64 6.68596 0.253
NP_440459.1_2 Reverse -215 -232 9.28195 0.23
NP_441943.1_5 Reverse -25 -44 17.6145 0.189
NP_441948.1_4 Forward -69 -51 5.52568 0.0764
NP_441948.1_4 Reverse -217 -235 -4.30741 0.225
NP_441833.1_4 Forward -232 -225 15.9687 0.0124
NP_441833.1_4 Reverse -225 -232 15.9687 0.0124
NP_441833.1_4 Forward -61 -54 15.9687 0.0124
NP_441833.1_4 Reverse -54 -61 15.9687 0.0124
NP_441329.1_6 Forward -165 -146 1.57519 0.233
NP_441329.1_6 Forward -211 -192 0.524783 0.253
NP_441895.1_10 Forward -218 -199 -27.5332 0.282
NP_442162.1_9 Forward -232 -225 16.2637 0.0124
NP_442162.1_9 Reverse -225 -232 16.2637 0.0124
NP_442162.1_9 Forward -61 -54 16.2637 0.0124
NP_442162.1_9 Reverse -54 -61 16.2637 0.0124
NP_440671.1_4 Reverse -47 -61 14.5526 0.0587
NP_440671.1_4 Reverse -368 -382 9.04604 0.187
NP_440671.1_4 Reverse -218 -232 6.48943 0.245
NP_442943.1_1 Forward -191 -176 6.07244 0.206
NP_442199.1_5 Forward -241 -222 -2.75381 0.194
NP_442199.1_5 Reverse -45 -64 -5.21209 0.24
NP_442199.1_5 Forward -70 -51 -7.4737 0.296
NP_442140.1_3 Forward -61 -51 8.33817 0.119
NP_442140.1_3 Reverse -225 -235 7.94484 0.124
NP_442140.1_3 Reverse -54 -64 6.66654 0.159
NP_442140.1_3 Forward -232 -222 4.40493 0.243
NP_440875.1_9 Reverse -226 -236 17.5217 0.0116
NP_440875.1_9 Forward -60 -50 8.37203 0.233
NP_440875.1_9 Reverse -55 -65 7.69067 0.255
NP_441813.1_5 Reverse -51 -61 17.188 0.00979
NP_441813.1_5 Reverse -222 -232 15.9097 0.01
NP_441813.1_5 Forward -235 -225 8.73149 0.0367
NP_441813.1_5 Forward -64 -54 8.63316 0.0367
NP_442089.1_1 Reverse -50 -69 5.50599 0.15
NP_440590.1_4 Forward -61 -48 5.23083 0.0585
NP_440590.1_4 Forward -232 -219 2.57589 0.0845
NP_440590.1_4 Reverse -54 -67 1.00259 0.136
NP_440567.1_1 Reverse -225 -239 14.2576 0.0187
NP_440567.1_1 Reverse -54 -68 6.29277 0.085
NP_440567.1_1 Forward -232 -218 6.29277 0.085
NP_440567.1_1 Forward -61 -47 1.17956 0.214
NP_442497.1_10 Reverse -225 -234 17.601 0.00813
NP_442497.1_10 Reverse -54 -63 17.601 0.00813
NP_442497.1_10 Forward -232 -223 10.4228 0.0087
NP_442497.1_10 Forward -61 -52 10.4228 0.0087
NP_440821.1_4 Reverse -51 -61 19.0562 0.00399
NP_440821.1_4 Reverse -222 -232 18.2696 0.00448
NP_440821.1_4 Forward -235 -225 10.7964 0.0146
NP_440821.1_4 Forward -64 -54 2.24165 0.131
NP_441239.1_9 Forward -235 -223 14.887 0.0247
NP_441239.1_9 Forward -64 -52 13.707 0.0355
NP_441239.1_9 Reverse -51 -63 13.3137 0.037
NP_441239.1_9 Reverse -222 -234 4.36554 0.253
NP_440706.1_1 Forward -66 -47 -3.83545 0.258
NP_442568.1_8 Forward -211 -197 11.3077 0.257
NP_441727.1_3 Forward -240 -221 10.2259 0.169
NP_441892.1_1 Forward -71 -54 8.20031 0.0829
NP_441892.1_1 Forward -242 -225 -2.12444 0.218
NP_440665.1_1 Reverse -227 -246 -10.3253 0.244
NP_440604.1_6 Reverse -224 -243 -0.000545616 0.17
NP_442270.1_9 Reverse -213 -232 -9.047 0.226
NP_441508.1_1 Forward -204 -185 10.2692 0.295
NP_441874.1_1 Reverse -290 -304 8.75105 0.294
NP_440949.1_7 Forward -241 -222 10.9134 0.233
NP_440546.1_4 Reverse -224 -234 13.5365 0.0459
NP_440546.1_4 Reverse -53 -63 13.5365 0.0459
NP_440546.1_4 Forward -62 -52 11.8882 0.0679
NP_440546.1_4 Forward -233 -223 10.046 0.109
NP_440462.1_6 Forward -235 -225 19.4496 0.00371
NP_440462.1_6 Reverse -51 -61 15.418 0.0142
NP_440462.1_6 Forward -64 -54 10.5014 0.0396
NP_440462.1_6 Reverse -222 -232 7.74818 0.0699
NP_440868.1_4 Forward -237 -225 16.4603 0.0149
NP_440868.1_4 Reverse -49 -61 8.49544 0.0602
NP_440868.1_4 Reverse -220 -232 5.93884 0.0879
NP_440868.1_4 Forward -66 -54 5.93884 0.0879
NP_440868.1_4 Reverse -326 -338 -0.354346 0.263
NP_441497.1_2 Reverse -279 -298 14.0608 0.18
NP_442479.1_9 Reverse -173 -192 -11.9969 0.278
NP_440812.1_7 Forward -189 -170 22.418 0.0191
NP_442402.1_4 Reverse -297 -316 0.785326 0.182
NP_441848.1_4 Forward -191 -175 7.83714 0.288
NP_441084.1_6 Forward -235 -221 9.92586 0.257
NP_442039.1_4 Forward -232 -225 15.1821 0.0124
NP_442039.1_4 Reverse -225 -232 15.1821 0.0124
NP_442039.1_4 Forward -61 -54 15.1821 0.0124
NP_442039.1_4 Reverse -54 -61 15.1821 0.0124
NP_442039.1_7 Forward -388 -378 6.76487 0.299
NP_441811.1_1 Reverse -302 -321 19.0757 0.109
NP_441811.1_2 Reverse -334 -353 14.6499 0.284
NP_442679.1_1 Forward -215 -196 -3.73712 0.262
NP_442829.1_2 Forward -194 -178 7.75456 0.295
NP_441926.1_3 Forward -62 -46 6.35172 0.17
NP_441926.1_3 Forward -233 -217 5.6634 0.17
NP_441926.1_3 Reverse -330 -346 4.58176 0.184
NP_440825.1_6 Forward -329 -310 9.14423 0.285
NP_442696.1_2 Reverse -223 -241 14.2771 0.128
NP_442837.1_3 Forward -232 -225 15.7721 0.0124
NP_442837.1_3 Reverse -225 -232 15.7721 0.0124
NP_442837.1_3 Forward -61 -54 15.7721 0.0124
NP_442837.1_3 Reverse -54 -61 15.7721 0.0124
NP_440160.1_1 Forward -209 -190 10.8206 0.232
NP_442053.1_1 Forward -233 -224 18.3876 0.0007
NP_442053.1_1 Reverse -224 -233 18.3876 0.0007
NP_442053.1_1 Forward -62 -53 18.3876 0.0007
NP_442053.1_1 Reverse -53 -62 18.3876 0.0007
NP_440505.1_3 Reverse -222 -232 16.303 0.00696
NP_440505.1_3 Forward -235 -225 15.418 0.0114
NP_440505.1_3 Reverse -51 -61 13.8447 0.0247
NP_440505.1_3 Forward -64 -54 8.04317 0.147
NP_442532.1_7 Reverse -224 -238 4.12949 0.178
NP_440914.1_1 Forward -233 -223 17.5935 0.000537
NP_440914.1_1 Reverse -224 -234 16.3248 0.00196
NP_440914.1_1 Reverse -53 -63 16.3248 0.00196
NP_440914.1_1 Forward -62 -52 8.6151 0.186
NP_441011.1_8 Forward -61 -52 16.9127 0.00602
NP_441011.1_8 Reverse -225 -234 16.6177 0.00602
NP_441011.1_8 Reverse -54 -63 16.6177 0.00602
NP_441011.1_8 Forward -232 -223 8.25953 0.144
NP_442101.1_10 Forward -70 -51 2.26107 0.0714
NP_442533.1_6 Forward -233 -224 17.2076 0.00137
NP_442533.1_6 Reverse -224 -233 17.2076 0.00137
NP_442533.1_6 Forward -62 -53 17.2076 0.00137
NP_442533.1_6 Reverse -53 -62 17.2076 0.00137
NP_442533.1_6 Reverse -382 -391 1.96635 0.28
NP_442541.1_10 Reverse -311 -325 7.66879 0.228
NP_440263.1_3 Forward -232 -213 4.42435 0.243
NP_442229.1_1 Forward -64 -50 8.25877 0.184
NP_441482.1_7 Forward -239 -225 -3.147 0.11
NP_439944.1_9 Forward -232 -222 19.0562 0.00329
NP_439944.1_9 Reverse -225 -235 17.7779 0.00341
NP_439944.1_9 Forward -61 -51 10.3048 0.0887
NP_439944.1_9 Reverse -54 -64 9.12481 0.1
NP_441697.1_5 Forward -108 -89 -8.73794 0.268
NP_441028.1_6 Reverse -208 -218 5.38779 0.255
NP_441028.1_6 Reverse -340 -350 4.89613 0.275
NP_440116.1_8 Forward -232 -213 1.37609 0.0926
NP_440116.1_8 Reverse -54 -73 -0.688862 0.112
NP_441527.1_4 Forward -211 -192 0.715766 0.134
NP_441527.1_4 Forward -210 -191 -3.86785 0.175
NP_441527.1_4 Forward -212 -193 -7.59203 0.235
NP_441527.1_4 Forward -165 -146 -12.1756 0.285
NP_440115.1_6 Forward -236 -226 16.9913 0.0288
NP_440007.1_9 Reverse -220 -234 1.47456 0.285
NP_439965.1_7 Reverse -317 -336 10.6116 0.294
NP_441170.1_4 Forward -318 -300 6.60732 0.205
NP_441972.1_5 Forward -244 -225 -7.57203 0.25
NP_441106.1_1 Forward -234 -225 18.486 0.0028
NP_441106.1_1 Forward -63 -54 18.486 0.0028
NP_441106.1_1 Reverse -52 -61 18.191 0.0028
NP_441106.1_1 Reverse -223 -232 9.63616 0.0311
NP_441106.1_1 Forward -340 -331 4.62128 0.213
NP_439903.1_6 Forward -236 -217 -0.197979 0.277
NP_439903.1_6 Reverse -221 -240 -0.29631 0.28
NP_441286.1_1 Reverse -223 -235 14.6903 0.00418
NP_441286.1_1 Forward -234 -222 11.937 0.0108
NP_441286.1_1 Forward -63 -51 5.05386 0.0259
NP_441286.1_1 Reverse -52 -64 -3.59927 0.145
NP_442674.1_3 Forward -241 -222 4.71854 0.288
NP_440670.1_8 Forward -233 -224 18.3876 0.000699
NP_440670.1_8 Reverse -224 -233 18.3876 0.000699
NP_440670.1_8 Forward -62 -53 18.3876 0.000699
NP_440670.1_8 Reverse -53 -62 18.3876 0.000699
NP_441930.1_2 Forward -391 -381 11.7798 0.275
NP_440886.1_7 Reverse -52 -62 17.7774 0.0011
NP_440886.1_7 Forward -234 -224 8.04271 0.0805
NP_440886.1_7 Forward -63 -53 8.04271 0.0805
NP_440886.1_7 Reverse -223 -233 7.94438 0.0805
NP_442614.1_2 Forward -233 -219 5.80112 0.297
NP_442072.1_9 Forward -234 -216 -20.237 0.204
NP_442072.1_9 Reverse -223 -241 -20.827 0.204
NP_442072.1_9 Reverse -52 -70 -20.9253 0.204
NP_442072.1_9 Forward -63 -45 -21.9087 0.215
NP_440907.2_8 Reverse -225 -235 19.1541 0.00362
NP_440907.2_8 Reverse -54 -64 15.9091 0.0161
NP_440907.2_8 Forward -61 -51 7.84605 0.117
NP_441021.1_1 Forward -232 -213 -10.227 0.232
NP_441021.1_8 Forward -67 -49 14.4738 0.088
NP_440326.1_7 Forward -371 -357 17.9942 0.109
NP_441463.1_2 Forward -370 -352 -1.07099 0.293
NP_441463.1_3 Forward -243 -224 7.47261 0.0522
NP_441463.1_3 Reverse -214 -233 -0.39387 0.132
NP_441463.1_3 Forward -72 -53 -9.83364 0.286
NP_441463.1_6 Reverse -222 -236 11.7308 0.224
NP_442842.1_10 Reverse -192 -211 10.6585 0.206
NP_442893.1_3 Forward -306 -287 19.4681 0.12
NP_441626.1_2 Forward -232 -225 15.7721 0.0124
NP_441626.1_2 Reverse -225 -232 15.7721 0.0124
NP_441626.1_2 Forward -61 -54 15.7721 0.0124
NP_441626.1_2 Reverse -54 -61 15.7721 0.0124
NP_442794.1_1 Reverse -214 -226 5.15219 0.231
NP_441401.1_4 Forward -192 -179 14.5723 0.216
NP_442615.1_1 Forward -242 -224 8.96727 0.0266
NP_442615.1_1 Forward -71 -53 7.78729 0.0304
NP_442615.1_1 Reverse -215 -233 -3.71743 0.168
NP_442467.1_4 Forward -233 -214 15.7324 0.11
NP_441962.1_4 Reverse -219 -238 -8.06369 0.195
NP_440387.1_1 Reverse -224 -240 14.3165 0.00649
NP_440387.1_1 Forward -233 -217 -3.08806 0.155
NP_441431.1_2 Reverse -50 -64 9.6354 0.181
NP_441431.1_2 Forward -236 -222 7.17714 0.247
NP_441993.1_1 Forward -233 -214 1.16703 0.284
NP_440114.1_10 Reverse -53 -67 18.7808 0.00482
NP_440114.1_10 Forward -62 -48 14.1593 0.0429
NP_440114.1_10 Forward -233 -219 10.4227 0.148
NP_440114.1_10 Reverse -224 -238 8.75105 0.195
NP_441510.2_7 Reverse -218 -232 9.6354 0.281
NP_441237.1_9 Forward -390 -380 10.5998 0.224
NP_441311.1_2 Forward -239 -225 11.4053 0.251
NP_439910.1_2 Reverse -45 -62 16.1651 0.00114
NP_439910.1_2 Reverse -216 -233 -12.2525 0.0788
NP_439910.1_2 Reverse -366 -383 -14.2191 0.183
NP_440457.1_1 Reverse -220 -232 0.0389777 0.25
NP_440457.1_1 Reverse -49 -61 0.0389777 0.25
NP_440457.1_1 Forward -237 -225 -0.354346 0.262
NP_440798.1_6 Reverse -54 -67 12.409 0.0468
NP_442680.1_5 Forward -216 -197 0.169919 0.268
NP_442297.1_4 Reverse -220 -239 13.8914 0.214
NP_441436.1_2 Forward -336 -317 0.392778 0.277
NP_442509.1_9 Forward -62 -52 16.2041 0.00739
NP_442509.1_9 Forward -233 -223 8.14104 0.192
NP_442509.1_9 Reverse -224 -234 8.04271 0.192
NP_442509.1_9 Reverse -53 -63 8.04271 0.192
NP_442509.1_9 Forward -312 -302 6.56775 0.263
NP_441159.1_8 Reverse -188 -207 1.96529 0.236
NP_440554.1_4 Reverse -225 -235 15.418 0.0199
NP_440554.1_4 Forward -61 -51 14.6313 0.02
NP_440554.1_4 Reverse -54 -64 8.82982 0.0646
NP_440554.1_4 Forward -232 -222 7.05986 0.106
NP_441885.1_5 Forward -233 -223 20.9245 0.000538
NP_441885.1_5 Forward -62 -52 11.4848 0.00668
NP_441885.1_5 Reverse -224 -234 11.3864 0.00668
NP_441885.1_5 Reverse -53 -63 11.3864 0.00668
NP_442703.1_9 Forward -195 -177 3.06741 0.3
NP_442341.1_7 Reverse -223 -237 7.07942 0.111
NP_442341.1_7 Forward -63 -49 1.57289 0.286
NP_442341.1_9 Reverse -51 -65 12.192 0.109
NP_442341.1_9 Forward -235 -221 10.6187 0.133
NP_442341.1_9 Forward -64 -50 9.93039 0.142
NP_441756.1_5 Forward -237 -218 -3.83545 0.29
NP_441173.1_9 Reverse -307 -315 10.8354 0.243
NP_440423.1_6 Forward -329 -310 -20.7484 0.268
NP_443000.1_7 Reverse -222 -232 17.0896 0.00865
NP_443000.1_7 Forward -235 -225 10.7964 0.0345
NP_443000.1_7 Forward -64 -54 10.6981 0.0345
NP_443000.1_7 Reverse -51 -61 8.73149 0.0437
NP_441842.1_10 Forward -69 -55 17.0108 0.0273
NP_441842.1_10 Forward -240 -226 10.3243 0.165
NP_440275.1_3 Forward -235 -225 18.6629 0.0082
NP_440275.1_3 Forward -64 -54 9.02648 0.0563
NP_440275.1_3 Reverse -51 -61 8.4365 0.0602
NP_440275.1_3 Reverse -222 -232 8.1415 0.0602
NP_440091.1_1 Reverse -49 -61 18.3285 0.0114
NP_440091.1_1 Reverse -220 -232 16.4603 0.0153
NP_440091.1_1 Forward -66 -54 1.41561 0.197
NP_440679.1_10 Reverse -226 -245 -18.2901 0.278
NP_442451.1_7 Forward -206 -187 13.0775 0.113
NP_440149.1_8 Forward -233 -214 3.53937 0.0921
NP_441105.1_3 Forward -244 -225 -9.93197 0.298
NP_440216.1_1 Reverse -53 -67 15.9292 0.00309
NP_440216.1_1 Forward -233 -219 7.9644 0.00737
NP_440216.1_1 Forward -62 -48 6.3911 0.0156
NP_440216.1_1 Reverse -224 -238 -2.55701 0.0521
NP_440216.1_9 Reverse -347 -356 7.17789 0.286
NP_440172.1_1 Reverse -224 -234 17.5813 0.00421
NP_440172.1_1 Reverse -53 -63 17.5813 0.00421
NP_440172.1_1 Forward -233 -223 15.0247 0.00945
NP_440172.1_1 Forward -62 -52 8.73149 0.0586
NP_440172.1_1 Forward -150 -140 2.7333 0.268
NP_441844.1_1 Forward -188 -169 16.0274 0.146
NP_442015.1_10 Reverse -49 -62 0.904263 0.216
NP_442015.1_10 Reverse -220 -233 0.60927 0.221
NP_441226.1_7 Forward -232 -225 14.4934 0.0123
NP_441226.1_7 Reverse -225 -232 14.4934 0.0123
NP_441226.1_7 Forward -61 -54 14.4934 0.0123
NP_441226.1_7 Reverse -54 -61 14.4934 0.0123
NP_441757.1_3 Reverse -223 -242 0.786102 0.184
NP_441111.1_7 Forward -232 -224 18.7023 0.00294
NP_441111.1_7 Forward -61 -53 18.7023 0.00294
NP_441111.1_7 Reverse -225 -233 18.7023 0.00294
NP_441111.1_7 Reverse -54 -62 18.7023 0.00294
NP_442379.1_10 Reverse -217 -234 13.1169 0.0548
NP_442379.1_10 Forward -240 -223 -2.02611 0.224
NP_440244.1_1 Forward -215 -196 -9.44032 0.287
NP_441766.1_2 Forward -233 -224 17.5026 0.00297
NP_441766.1_2 Reverse -224 -233 17.5026 0.00297
NP_441766.1_2 Forward -62 -53 17.5026 0.00297
NP_441766.1_2 Reverse -53 -62 17.5026 0.00297
NP_440416.1_9 Forward -69 -50 -16.6185 0.218
NP_440416.1_9 Reverse -217 -236 -17.6018 0.243
NP_443052.1_8 Reverse -214 -233 -0.197208 0.0684
NP_443052.1_8 Reverse -43 -62 -1.37718 0.0793
NP_440261.1_5 Reverse -225 -238 8.27909 0.0273
NP_440261.1_5 Forward -232 -219 -10.6005 0.201
NP_440261.1_5 Reverse -54 -67 -10.6005 0.201
NP_440261.1_5 Forward -61 -48 -12.4687 0.297
NP_440988.1_10 Reverse -222 -236 8.19046 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCACCAGTAAGGCATTGGCCAACCACTGTTTCTTTTGAGGAGATTTTGTCATGGAGAATAAAACGATTGCGGAGAAAGGTGGCATTGGGGTGAACCTCCCCTAAACCAAACTCAATAACTATACCCACATCTAATGACCTCGAAGTTGATCAAGCCACAATCATCGAGGCGATCGCCATTTGGTAGGGGACAAAAGGTAAAGAAACATAAAATTGTAGCAAAATATACTGAATTATCAAAAGTGAAATAGGACAATTGCTCGACAATCTTTCTAAAAACCAGTATTAACCTTTCTAAGTTTCAAATTTAGTTGCCCTCAGAAAGTTCACAGTCCAATAGGCGATCGCCGTTTAATCTTCAAGTTTCCATCACAAACACATATCCCAACAGACTCTCCACC

CDS

ATGGATAACAAAAACGAGAATCAAGAAAACAGTCAAATTGACGATACCGATATTGCGGCTGGTGCAATTGCAGTCGGGACTGTAGCTGGGGCTGGACTTTCCGCAACTATTGGAGGGATGGGATTAACCGTTGCCGGGGCCGGGATTGGCATAGGGATGGCCCCAGTTGCGGCCGCTGGTGCGGTGGTTGGGTCTGCCGCCTTTGGAGCAAAAAAAGCAATCGAAGGTCAAGATCCAATGGCAGTTGGGGCAATTGCTACTGGTGCGGTAGTTGGAGCAGGGACATCTGCGGCATTAGGTGGAATGGGATTAGCTCTTACTGGAACGGCCATAGGAATAGGAATGGCCCCGATCGCCGCCGCTGGTGCGGTAGTTGGATTAGCTGGCTATGGGCTGTACAAAATGTTTGGCGGTGAATAA

Protein

MDNKNENQENSQIDDTDIAAGAIAVGTVAGAGLSATIGGMGLTVAGAGIGIGMAPVAAAGAVVGSAAFGAKKAIEGQDPMAVGAIATGAVVGAGTSAALGGMGLALTGTAIGIGMAPIAAAGAVVGLAGYGLYKMFGGE