Your browser is old and dusty. Try Google Chrome!

Details for sll0319

ORF sll0319
Accession NP_442088.1
Symbol
Category periplasmic protein, function unknown
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -342 -328 -2.36035 0.29
NP_441061.1_2 Forward -198 -184 -2.36035 0.29
NP_440557.1_1 Forward -198 -179 7.07928 0.148
NP_441418.1_6 Reverse -190 -209 -30.7781 0.296
NP_440897.1_6 Reverse -334 -353 0.0970122 0.18
NP_442151.1_6 Reverse -340 -354 7.07942 0.211
NP_442169.1_1 Forward -154 -135 7.27595 0.26
NP_442287.1_1 Forward -344 -334 16.8925 0.122
NP_442287.1_5 Reverse -345 -355 12.1731 0.272
NP_442752.1_4 Reverse -354 -361 10.5605 0.1
NP_442975.1_10 Reverse -47 -61 3.24392 0.26
NP_442861.1_4 Forward -383 -364 -0.39464 0.297
NP_441934.1_8 Reverse -337 -356 11.2092 0.292
NP_441934.1_9 Reverse -218 -237 12.4875 0.256
NP_442000.2_3 Reverse -92 -111 11.2092 0.28
NP_439979.1_7 Forward -360 -343 13.6085 0.267
NP_442062.1_8 Forward -199 -189 4.60159 0.206
NP_441859.1_3 Reverse -34 -53 3.53858 0.239
NP_440044.1_8 Reverse -52 -71 -3.14714 0.28
NP_440011.1_1 Reverse -207 -226 11.8975 0.265
NP_441352.1_2 Reverse -347 -366 8.45592 0.162
NP_441200.1_4 Reverse -68 -87 5.01433 0.299
NP_442110.1_7 Reverse -184 -198 1.86788 0.222
NP_441925.1_4 Forward -235 -216 -14.1609 0.261
NP_440856.1_4 Forward -238 -219 -0.197208 0.174
NP_441083.1_3 Forward -194 -184 13.8442 0.195
NP_442827.1_8 Reverse -182 -201 -0.787962 0.235
NP_441558.1_5 Forward -351 -332 4.62101 0.276
NP_441558.1_5 Reverse -320 -339 4.32602 0.283
NP_440209.1_2 Forward -74 -58 13.3332 0.17
NP_441713.1_8 Forward -172 -154 10.5406 0.255
NP_441770.1_5 Reverse -219 -238 -2.26216 0.285
NP_442570.1_3 Reverse -156 -175 -1.47551 0.212
NP_442570.1_3 Reverse -206 -225 -6.98204 0.265
NP_442570.1_3 Forward -333 -314 -7.67036 0.273
NP_442570.1_3 Reverse -332 -351 -9.24366 0.296
NP_442445.1_1 Reverse -335 -354 17.5024 0.122
NP_442596.1_10 Forward -321 -302 9.43923 0.281
NP_440747.1_10 Forward -334 -322 -12.5474 0.297
NP_441014.1_5 Forward -347 -329 14.7688 0.2
NP_441014.1_5 Forward -172 -154 13.8838 0.2
NP_441014.1_8 Forward -348 -329 -9.14533 0.291
NP_441014.1_10 Forward -200 -181 -0.39464 0.25
NP_442848.1_5 Reverse -56 -74 -3.81576 0.299
NP_443018.1_3 Forward -348 -341 9.38056 0.128
NP_443018.1_3 Reverse -166 -173 9.38056 0.128
NP_443018.1_3 Forward -198 -191 7.6106 0.156
NP_443018.1_3 Forward -330 -323 4.26735 0.267
NP_443018.1_3 Reverse -323 -330 4.07068 0.299
NP_440376.1_1 Reverse -333 -342 7.86621 0.0583
NP_440376.1_1 Reverse -190 -199 2.75299 0.215
NP_440376.1_1 Reverse -334 -343 1.96635 0.236
NP_441588.1_4 Forward -347 -337 5.09324 0.297
NP_442730.1_8 Forward -352 -333 7.86512 0.189
NP_442730.1_8 Forward -351 -332 2.16195 0.292
NP_442687.1_7 Reverse -189 -199 4.10993 0.266
NP_442191.1_4 Reverse -191 -205 12.0596 0.232
NP_442191.1_4 Forward -166 -152 11.187 0.268
NP_442485.1_3 Reverse -148 -167 -4.22878 0.278
NP_441846.1_10 Reverse -345 -364 -20.945 0.256
NP_441846.1_10 Reverse -223 -242 -21.535 0.256
NP_441846.1_10 Reverse -214 -233 -21.535 0.256
NP_440642.1_10 Forward -245 -231 3.93223 0.264
NP_440691.1_8 Reverse -143 -160 15.0835 0.213
NP_440533.1_6 Forward -171 -152 6.98095 0.297
NP_441950.1_7 Reverse -217 -236 -7.37537 0.278
NP_442296.1_9 Forward -348 -329 -2.36049 0.224
NP_442782.1_2 Reverse -328 -342 0.88457 0.282
NP_441414.1_9 Reverse -354 -373 -10.0303 0.275
NP_442937.1_5 Reverse -349 -368 6.4893 0.278
NP_441317.1_4 Forward -54 -40 9.65494 0.29
NP_439905.1_2 Reverse -160 -174 11.996 0.208
NP_441097.1_2 Reverse -324 -341 8.88863 0.236
NP_443055.1_6 Reverse -380 -398 -0.374908 0.259
NP_439975.1_2 Reverse -335 -353 6.31233 0.249
NP_441646.1_1 Reverse -183 -202 0.786102 0.243
NP_441646.1_1 Forward -389 -370 -1.67217 0.293
NP_442431.1_10 Reverse -348 -366 5.62401 0.197
NP_441292.1_2 Forward -163 -144 -4.22878 0.224
NP_441295.1_4 Forward -198 -179 -1.37718 0.29
NP_441041.1_4 Reverse -165 -184 -3.04881 0.119
NP_442642.1_2 Reverse -182 -201 13.8641 0.296
NP_442396.1_5 Forward -52 -39 5.23083 0.292
NP_441547.1_2 Reverse -335 -353 2.96908 0.292
NP_441725.1_4 Reverse -34 -48 3.04726 0.279
NP_439966.1_7 Forward -365 -355 4.99446 0.248
NP_439966.1_7 Forward -224 -214 4.40448 0.273
NP_440983.1_5 Forward -355 -336 -6.88371 0.28
NP_440260.1_8 Reverse -156 -174 -1.75081 0.237
NP_440260.1_8 Reverse -331 -349 -1.94747 0.242
NP_442281.1_1 Forward -347 -333 3.44058 0.231
NP_442281.1_1 Reverse -185 -199 2.94893 0.249
NP_001035871.2_7 Reverse -330 -340 15.3197 0.165
NP_001035871.2_7 Reverse -211 -221 13.943 0.219
NP_001035871.2_7 Reverse -155 -165 13.943 0.219
NP_441087.1_6 Forward -364 -346 -0.964891 0.264
NP_440375.1_8 Reverse -166 -185 7.37428 0.166
NP_441644.1_6 Forward -363 -353 11.091 0.0552
NP_441644.1_6 Forward -349 -339 10.9926 0.058
NP_441644.1_6 Forward -199 -189 4.10949 0.249
NP_441644.1_6 Reverse -165 -175 4.01116 0.253
NP_441795.1_5 Forward -55 -36 7.47261 0.245
NP_442215.1_2 Reverse -181 -197 -3.18639 0.211
NP_442215.1_2 Reverse -200 -216 -4.07137 0.227
NP_442215.1_2 Reverse -338 -354 -6.43131 0.271
NP_442029.1_1 Forward -333 -314 -20.2567 0.297
NP_442029.1_6 Reverse -335 -354 7.27595 0.224
NP_442029.1_6 Forward -76 -57 3.34271 0.282
NP_442029.1_10 Forward -239 -220 9.0459 0.239
NP_440780.1_1 Reverse -37 -56 6.73176 0.295
NP_442554.1_8 Reverse -191 -201 4.40493 0.188
NP_442554.1_8 Forward -348 -338 3.32329 0.23
NP_442554.1_8 Reverse -323 -333 2.04498 0.285
NP_442554.1_8 Forward -330 -320 1.94665 0.288
NP_442142.1_4 Forward -352 -339 4.83694 0.209
NP_442142.1_4 Forward -202 -189 3.85363 0.243
NP_442292.1_1 Reverse -323 -332 5.21127 0.152
NP_443009.1_5 Forward -200 -189 3.99143 0.268
NP_441448.1_9 Forward -164 -145 15.5357 0.262
NP_441468.1_1 Forward -330 -323 3.97235 0.277
NP_441015.1_10 Reverse -349 -368 -3.44213 0.189
NP_441015.1_10 Reverse -335 -354 -7.96535 0.272
NP_441876.1_9 Reverse -31 -41 14.6309 0.267
NP_441876.1_9 Forward -367 -357 14.3359 0.267
NP_441826.1_2 Forward -199 -185 3.04785 0.115
NP_441826.1_2 Reverse -316 -330 2.85119 0.119
NP_442811.1_2 Forward -327 -308 -0.983855 0.252
NP_442719.1_2 Reverse -373 -391 -11.5846 0.292
NP_441056.1_1 Reverse -322 -341 -8.45701 0.282
NP_441056.1_1 Forward -331 -312 -9.24366 0.295
NP_442227.1_2 Forward -370 -351 -1.08219 0.262
NP_442227.1_2 Forward -234 -215 -3.63879 0.294
NP_442808.1_1 Forward -364 -354 7.35439 0.0814
NP_442808.1_1 Forward -224 -214 3.32285 0.244
NP_442808.1_1 Reverse -182 -192 1.06124 0.296
NP_440145.1_3 Reverse -344 -363 -5.21209 0.261
NP_440145.1_4 Forward -362 -352 18.0724 0.0863
NP_442718.1_2 Reverse -224 -243 12.6841 0.0601
NP_440558.1_5 Reverse -197 -211 13.8643 0.289
NP_441518.1_3 Reverse -312 -331 -15.7335 0.299
NP_441878.1_6 Reverse -333 -343 -6.70647 0.194
NP_441878.1_6 Reverse -189 -199 -7.49312 0.231
NP_441557.1_8 Forward -230 -220 11.3859 0.252
NP_441520.1_7 Forward -172 -153 8.06259 0.187
NP_441590.1_4 Forward -235 -216 2.06362 0.297
NP_441308.1_8 Reverse -352 -362 9.22315 0.226
NP_441458.1_8 Forward -384 -365 5.75208 0.259
NP_441564.1_10 Reverse -169 -188 2.0644 0.287
NP_442347.1_2 Reverse -30 -39 3.93297 0.284
NP_442965.1_2 Forward -173 -154 -8.06369 0.277
NP_440547.1_1 Forward -368 -349 9.14342 0.252
NP_442888.1_6 Forward -360 -341 6.29264 0.225
NP_442594.1_8 Reverse -345 -364 15.7324 0.146
NP_442594.1_8 Reverse -215 -234 12.0942 0.161
NP_442594.1_8 Reverse -346 -365 6.19431 0.236
NP_442508.1_8 Forward -73 -56 12.1336 0.256
NP_440151.1_5 Forward -162 -143 5.60432 0.258
NP_442317.1_6 Forward -368 -349 1.86774 0.296
NP_442998.1_5 Reverse -232 -242 8.33817 0.264
NP_441435.1_4 Reverse -155 -174 10.0292 0.255
NP_440256.1_1 Forward -202 -183 2.26107 0.0663
NP_441559.1_8 Reverse -153 -167 -5.01529 0.245
NP_441559.1_9 Reverse -352 -371 12.8808 0.192
NP_441270.1_5 Forward -180 -161 11.4328 0.291
NP_440915.1_6 Reverse -186 -200 5.01447 0.0943
NP_441179.1_4 Reverse -34 -53 10.4217 0.225
NP_440717.1_3 Forward -360 -346 10.5204 0.231
NP_442069.1_7 Reverse -55 -74 11.7983 0.228
NP_440702.1_2 Forward -327 -308 -5.31042 0.257
NP_442993.1_1 Reverse -190 -206 -3.18639 0.126
NP_440677.1_10 Reverse -349 -363 18.3981 0.269
NP_442386.1_9 Forward -350 -341 8.45576 0.197
NP_442386.1_9 Reverse -164 -173 7.47246 0.219
NP_440570.1_5 Reverse -155 -174 -0.295539 0.262
NP_441750.1_1 Reverse -348 -367 -12.2919 0.3
NP_441947.1_4 Reverse -169 -188 12.3892 0.234
NP_441297.1_8 Forward -187 -169 16.9313 0.123
NP_440168.1_4 Forward -353 -334 2.3594 0.202
NP_442240.1_1 Forward -201 -182 7.57013 0.253
NP_440586.1_8 Forward -330 -323 7.70858 0.227
NP_440586.1_8 Reverse -36 -43 7.02027 0.279
NP_442251.1_6 Reverse -123 -130 6.43063 0.298
NP_441262.1_3 Forward -331 -324 5.34899 0.181
NP_439984.1_7 Forward -229 -211 5.62401 0.137
NP_439984.1_10 Reverse -55 -69 13.372 0.186
NP_439937.1_9 Forward -234 -217 -3.40342 0.157
NP_439937.1_9 Reverse -34 -51 -10.8765 0.236
NP_440171.1_2 Reverse -25 -39 17.024 0.258
NP_442783.1_8 Forward -229 -210 21.1397 0.0285
NP_441789.1_7 Forward -364 -345 0.490334 0.245
NP_440316.1_10 Reverse -339 -349 8.73149 0.239
NP_440316.1_10 Forward -163 -153 7.25653 0.251
NP_440316.1_10 Reverse -353 -363 5.97822 0.275
NP_441803.1_2 Reverse -11 -30 2.26107 0.215
NP_441803.1_2 Reverse -153 -172 0.294447 0.255
NP_442384.1_10 Reverse -51 -64 2.47756 0.224
NP_442384.1_10 Forward -167 -154 1.9859 0.24
NP_441018.1_7 Forward -335 -316 8.65258 0.241
NP_442262.1_10 Forward -348 -341 9.47889 0.187
NP_442262.1_10 Reverse -166 -173 9.47889 0.187
NP_442262.1_10 Forward -198 -191 8.8889 0.219
NP_440163.1_10 Reverse -187 -197 8.53483 0.271
NP_440344.1_10 Reverse -327 -344 -3.50107 0.0833
NP_440282.1_10 Forward -172 -153 -3.3438 0.237
NP_440282.1_10 Forward -347 -328 -3.54046 0.24
NP_440531.1_6 Forward -357 -338 -1.27885 0.231
NP_440826.1_5 Forward -168 -150 15.7703 0.231
NP_440297.1_9 Forward -330 -320 -0.511621 0.289
NP_440298.1_10 Forward -129 -111 4.83737 0.188
NP_441592.1_4 Forward -174 -155 1.57275 0.218
NP_441896.1_3 Reverse -181 -200 -3.24547 0.297
NP_442078.1_4 Reverse -362 -381 19.6656 0.147
NP_440888.1_2 Forward -199 -185 13.372 0.0297
NP_440888.1_2 Forward -355 -341 7.07881 0.208
NP_440888.1_2 Reverse -62 -76 6.88214 0.217
NP_442948.1_2 Forward -157 -138 11.0125 0.143
NP_441543.1_3 Forward -225 -211 7.27547 0.286
NP_442845.1_2 Reverse -334 -348 17.4042 0.0608
NP_442845.1_2 Forward -168 -154 14.7492 0.0774
NP_442845.1_2 Reverse -221 -235 7.07942 0.199
NP_442845.1_2 Reverse -159 -173 6.88276 0.201
NP_442845.1_2 Reverse -348 -362 5.01447 0.247
NP_442845.1_2 Forward -180 -166 3.34284 0.294
NP_441834.1_7 Reverse -342 -361 13.9625 0.267
NP_441551.1_5 Reverse -149 -165 10.7759 0.193
NP_441178.1_6 Forward -352 -333 1.86696 0.279
NP_440982.1_1 Forward -363 -344 7.57013 0.294
NP_441469.1_4 Forward -318 -299 14.1591 0.249
NP_442315.1_1 Reverse -352 -370 5.13236 0.256
NP_442337.1_5 Forward -193 -174 19.2723 0.11
NP_440220.1_4 Reverse -152 -171 -0.984623 0.262
NP_441462.1_2 Reverse -190 -200 -1.00328 0.274
NP_443062.1_1 Reverse -165 -183 6.79079 0.192
NP_440519.1_6 Forward -354 -340 11.6026 0.29
NP_442204.1_1 Forward -335 -324 2.71361 0.266
NP_442204.1_5 Forward -177 -158 3.04771 0.198
NP_441351.1_8 Forward -176 -157 1.37609 0.276
NP_440516.1_8 Reverse -354 -363 -0.590259 0.283
NP_440516.1_8 Reverse -340 -349 -0.590259 0.283
NP_442428.1_4 Reverse -189 -208 9.53756 0.158
NP_442428.1_5 Forward -330 -323 4.36568 0.271
NP_441443.1_10 Reverse -160 -178 2.57501 0.275
NP_442120.1_10 Reverse -184 -203 -4.91709 0.199
NP_442120.1_10 Reverse -328 -347 -9.44032 0.242
NP_440673.1_3 Forward -197 -190 8.98723 0.203
NP_440673.1_3 Forward -191 -184 7.80726 0.244
NP_441052.1_2 Forward -349 -339 4.50326 0.157
NP_442219.1_8 Reverse -112 -131 7.00751 0.28
NP_442086.1_6 Forward -174 -155 7.07928 0.286
NP_441719.1_6 Forward -367 -348 11.7 0.269
NP_441733.1_5 Forward -228 -209 13.5691 0.294
NP_441004.1_1 Forward -173 -154 -9.44032 0.207
NP_441004.1_1 Reverse -342 -361 -16.8151 0.287
NP_441004.1_1 Reverse -357 -376 -17.4051 0.291
NP_441004.1_1 Reverse -205 -224 -17.4051 0.291
NP_441004.1_4 Reverse -55 -65 9.7148 0.259
NP_440296.1_10 Reverse -71 -90 -14.3569 0.269
NP_440296.1_10 Reverse -343 -362 -15.1435 0.286
NP_440328.1_4 Forward -161 -142 5.40766 0.148
NP_443054.1_2 Forward -201 -187 1.96621 0.245
NP_442856.1_5 Reverse -148 -167 16.3684 0.282
NP_441396.1_5 Reverse -355 -364 8.75118 0.21
NP_441396.1_5 Forward -43 -34 8.35786 0.224
NP_440593.1_3 Reverse -160 -179 -5.70374 0.264
NP_441982.1_6 Reverse -170 -179 11.4349 0.288
NP_442709.1_3 Forward -162 -143 3.04771 0.288
NP_441046.1_2 Reverse -349 -368 -1.67217 0.292
NP_440432.1_9 Forward -192 -177 -1.5934 0.167
NP_442843.1_1 Forward -173 -154 -7.67036 0.25
NP_442006.1_2 Reverse -10 -27 -15.8908 0.23
NP_442006.1_2 Reverse -339 -356 -17.1691 0.27
NP_442006.1_2 Reverse -340 -357 -18.644 0.294
NP_442006.1_2 Reverse -354 -371 -18.7424 0.295
NP_441003.1_9 Forward -358 -339 6.09597 0.254
NP_440483.1_1 Reverse -349 -368 -2.36049 0.208
NP_442243.1_1 Forward -337 -319 3.75497 0.2
NP_441078.1_4 Reverse -159 -168 3.44131 0.14
NP_441078.1_4 Reverse -190 -199 -1.57357 0.266
NP_442729.1_5 Reverse -339 -349 15.0247 0.199
NP_440707.1_9 Reverse -343 -362 3.04771 0.268
NP_440526.1_3 Reverse -323 -334 3.5981 0.267
NP_440526.1_3 Forward -235 -224 0.353199 0.287
NP_441432.1_8 Reverse -189 -198 3.7363 0.243
NP_441432.1_8 Reverse -339 -348 3.44131 0.245
NP_441732.1_5 Forward -348 -334 13.7659 0.192
NP_440629.1_4 Reverse -36 -55 7.66927 0.287
NP_442003.1_9 Reverse -333 -352 10.1275 0.219
NP_442815.1_2 Reverse -352 -370 5.82068 0.221
NP_442797.1_6 Forward -361 -342 16.0786 0.171
NP_442797.1_7 Forward -350 -332 7.59063 0.198
NP_442797.1_7 Forward -175 -157 1.98577 0.245
NP_442489.1_7 Reverse -190 -199 -1.57357 0.213
NP_442489.1_7 Forward -199 -190 -1.86856 0.259
NP_441452.1_1 Forward -233 -214 17.8957 0.117
NP_441452.1_3 Forward -104 -85 17.5015 0.18
NP_441022.1_1 Reverse -285 -294 13.6565 0.202
NP_441040.1_5 Forward -216 -197 4.81767 0.244
NP_442346.1_5 Reverse -183 -193 7.15819 0.178
NP_441786.1_3 Reverse -341 -360 5.80098 0.29
NP_441923.1_6 Reverse -341 -355 10.226 0.274
NP_440486.1_6 Reverse -333 -352 17.8957 0.207
NP_440486.1_6 Reverse -216 -235 7.47261 0.268
NP_440459.1_2 Reverse -211 -228 7.512 0.288
NP_441653.1_2 Reverse -173 -192 6.81516 0.225
NP_441653.1_2 Forward -342 -323 4.01279 0.264
NP_442137.1_8 Reverse -203 -221 19.6843 0.102
NP_441888.1_7 Reverse -311 -325 1.86788 0.235
NP_440449.1_6 Forward -175 -157 6.60236 0.244
NP_440170.1_6 Reverse -153 -172 11.0125 0.298
NP_440671.1_4 Reverse -184 -198 7.66941 0.21
NP_440671.1_4 Forward -199 -185 7.07942 0.227
NP_440772.1_8 Reverse -316 -335 9.14423 0.253
NP_442140.1_3 Reverse -166 -176 9.32148 0.109
NP_442140.1_3 Forward -348 -338 5.38824 0.211
NP_442723.1_1 Forward -240 -221 8.84842 0.273
NP_442723.1_1 Forward -233 -214 2.6536 0.286
NP_441671.1_10 Reverse -343 -362 4.81767 0.219
NP_442089.1_1 Reverse -7 -26 17.8957 0.04
NP_440590.1_4 Reverse -184 -197 -4.60227 0.263
NP_440567.1_4 Forward -186 -167 1.96607 0.261
NP_441239.1_9 Forward -201 -189 4.95553 0.234
NP_441239.1_9 Reverse -163 -175 3.18557 0.292
NP_442629.1_3 Reverse -212 -231 -0.4922 0.294
NP_441874.1_1 Reverse -336 -350 9.04604 0.28
NP_440900.1_1 Forward -89 -70 9.24257 0.208
NP_440354.1_7 Forward -73 -55 9.55725 0.224
NP_440546.1_4 Forward -174 -164 10.4338 0.109
NP_440546.1_4 Reverse -340 -350 9.94905 0.112
NP_440546.1_4 Forward -162 -152 8.49468 0.186
NP_440546.1_4 Reverse -165 -175 7.81598 0.22
NP_440341.1_1 Reverse -345 -364 5.60432 0.23
NP_440812.1_10 Reverse -356 -369 12.409 0.259
NP_442402.1_4 Forward -238 -219 -5.50783 0.244
NP_442402.1_4 Reverse -43 -62 -9.34271 0.288
NP_441848.1_9 Forward -364 -353 20.7076 0.109
NP_439942.1_6 Reverse -352 -370 22.8319 0.0832
NP_442039.1_7 Forward -64 -54 11.6814 0.257
NP_442039.1_7 Forward -160 -150 11.0914 0.257
NP_442696.1_2 Forward -132 -114 8.7706 0.278
NP_440160.1_2 Forward -344 -325 -1.47551 0.242
NP_441959.1_10 Forward -72 -54 15.7665 0.178
NP_441252.1_6 Forward -62 -55 11.6422 0.288
NP_440914.1_1 Reverse -190 -200 9.00547 0.186
NP_440914.1_1 Forward -342 -332 8.71269 0.186
NP_440914.1_1 Reverse -227 -237 8.41992 0.191
NP_441011.1_8 Reverse -355 -364 5.50626 0.256
NP_442533.1_1 Forward -171 -152 -17.5035 0.289
NP_442533.1_6 Forward -199 -190 5.3096 0.145
NP_442533.1_6 Forward -174 -165 4.71961 0.177
NP_442533.1_6 Reverse -165 -174 3.83464 0.202
NP_442533.1_6 Forward -349 -340 3.7363 0.204
NP_442533.1_6 Forward -363 -354 2.16301 0.27
NP_443050.1_7 Reverse -151 -165 17.7975 0.253
NP_442322.1_4 Forward -363 -346 0.529798 0.21
NP_442322.1_4 Forward -226 -209 -2.91177 0.237
NP_443016.1_1 Reverse -334 -353 -2.95047 0.225
NP_439944.1_9 Forward -330 -320 12.3697 0.0887
NP_439944.1_9 Forward -290 -280 5.87989 0.214
NP_441028.1_6 Forward -368 -358 8.04271 0.217
NP_441028.1_6 Forward -354 -344 5.38779 0.255
NP_441602.1_3 Forward -76 -57 -5.01543 0.277
NP_441106.1_1 Reverse -226 -235 2.26134 0.293
NP_439903.1_6 Forward -202 -183 11.3067 0.095
NP_439903.1_6 Forward -358 -339 1.08032 0.255
NP_441286.1_1 Forward -332 -320 -1.33766 0.142
NP_441930.1_2 Reverse -189 -199 13.5497 0.24
NP_441930.1_2 Reverse -196 -206 12.5664 0.258
NP_440886.1_7 Forward -364 -354 15.6142 0.0243
NP_440886.1_7 Forward -223 -213 3.61784 0.272
NP_442614.1_2 Reverse -340 -354 11.996 0.172
NP_441403.1_4 Forward -62 -44 7.78729 0.282
NP_440907.2_8 Forward -230 -220 3.91283 0.289
NP_442264.1_2 Reverse -180 -197 13.0185 0.156
NP_441021.1_1 Forward -348 -329 -7.37537 0.183
NP_441021.1_1 Reverse -323 -342 -9.73531 0.219
NP_441021.1_1 Forward -173 -154 -11.7019 0.272
NP_441463.1_3 Forward -335 -316 -8.35868 0.268
NP_441901.1_1 Reverse -156 -175 11.7992 0.11
NP_441901.1_1 Reverse -331 -350 8.35759 0.11
NP_442365.1_7 Forward -353 -334 -4.81876 0.25
NP_442794.1_1 Forward -335 -323 6.33216 0.185
NP_441962.1_4 Reverse -160 -179 -10.4236 0.228
NP_441962.1_4 Forward -330 -311 -12.4886 0.259
NP_441836.1_2 Forward -180 -161 3.24438 0.157
NP_441836.1_2 Reverse -334 -353 -6.29373 0.295
NP_440634.1_2 Reverse -70 -89 15.3391 0.286
NP_441993.1_1 Forward -199 -180 4.18821 0.223
NP_442352.1_8 Reverse -32 -46 16.1252 0.242
NP_440114.1_10 Reverse -190 -204 5.80112 0.292
NP_442684.1_6 Reverse -32 -51 16.9115 0.299
NP_442090.1_10 Forward -161 -148 10.934 0.277
NP_442698.1_10 Reverse -161 -180 2.16274 0.284
NP_442698.1_10 Reverse -220 -239 0.786102 0.297
NP_442323.1_7 Forward -348 -329 2.06362 0.273
NP_440725.1_4 Forward -376 -357 1.27776 0.226
NP_441720.1_2 Forward -141 -122 5.89851 0.217
NP_440293.1_9 Reverse -197 -211 14.9197 0.178
NP_440293.1_10 Reverse -207 -226 1.86774 0.219
NP_439988.1_3 Reverse -336 -350 5.99778 0.278
NP_442743.1_1 Reverse -155 -174 5.89851 0.268
NP_441984.1_8 Reverse -213 -227 19.7641 0.126
NP_441332.1_6 Forward -364 -354 15.3256 0.121
NP_441332.1_6 Forward -224 -214 13.583 0.184
NP_441889.1_4 Reverse -324 -343 -0.295539 0.296
NP_442514.1_5 Forward -357 -338 -4.32786 0.239
NP_440734.1_9 Forward -366 -347 10.6192 0.281
NP_442737.1_5 Forward -326 -307 13.3638 0.235
NP_441885.1_5 Forward -174 -164 -1.59326 0.273
NP_442341.1_7 Forward -200 -186 1.27789 0.295
NP_441173.1_9 Reverse -138 -146 12.9004 0.206
NP_440423.1_6 Reverse -346 -365 -11.1119 0.164
NP_440423.1_6 Reverse -214 -233 -21.24 0.284
NP_440423.1_10 Forward -67 -48 13.5691 0.172
NP_442932.1_9 Reverse -220 -239 8.55425 0.241
NP_441902.1_3 Forward -62 -52 12.1071 0.274
NP_441122.1_1 Reverse -336 -351 12.0746 0.182
NP_440175.1_7 Forward -87 -69 9.46071 0.28
NP_442495.1_4 Reverse -353 -363 11.4848 0.271
NP_441105.1_3 Forward -348 -329 1.86774 0.109
NP_441105.1_3 Reverse -154 -173 -5.70374 0.223
NP_440216.1_9 Reverse -324 -333 12.8811 0.213
NP_440216.1_9 Forward -347 -338 7.37455 0.286
NP_440216.1_9 Forward -280 -271 6.78456 0.289
NP_440172.1_1 Reverse -190 -200 1.84832 0.294
NP_442015.1_3 Reverse -28 -47 10.2251 0.296
NP_442015.1_10 Forward -335 -322 8.27909 0.0682
NP_442015.1_10 Forward -64 -51 -0.0790467 0.25
NP_441226.1_7 Reverse -58 -65 6.52862 0.253
NP_440416.1_9 Forward -350 -331 -9.83364 0.135
NP_440416.1_9 Forward -200 -181 -18.1918 0.253
NP_440416.1_9 Forward -243 -224 -18.9784 0.267
NP_440416.1_9 Forward -78 -59 -21.9284 0.298
NP_443052.1_9 Forward -224 -205 -1.47551 0.228
NP_443052.1_9 Forward -229 -210 -3.93378 0.253
NP_443052.1_9 Forward -233 -214 -4.91709 0.262
NP_443052.1_9 Forward -361 -342 -7.27704 0.295
NP_440072.1_5 Reverse -215 -233 -0.865831 0.252
NP_442154.1_1 Reverse -352 -370 -15.6155 0.222
NP_440988.1_10 Reverse -338 -352 5.09245 0.246
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCTGGATTAGGTGACTTTGGTATTCCGTATTCATTACCCCCATCACCTCTTCCCCATGGCCAAACCCCTTGCGATGGTAATTGTCGGAGTGGTGCAGAGACCGTTTAAAAGCTTTGGTATCCATAGAAAAACGAGAATGTCACCTGTATTATGTTGTTCCATTTTGCCATCCTCTCCCCCCAACCGCTAGACAAGCTCAAAGCCCATTGCCGTTGCTCGATTTTTCGGCCATGGGTAAAGCCCTGGGGGCCCGTTTGGTAGAATGGGCTAGCAATCTTGACTGAGCCTGGTTCCCAGACGTTCTGTTCCAACCTGCAGACTGTCTCTCTGGGGCTCCGTTGGGGAACATTTTCGGGCTTGATGGGGTTAACAATCCTATGCCGCGTTGACTATTTCTCTT

CDS

ATGAACTGGAAATTTTTCCCACACCCCTTCCTAGCCATGGCCGTCGGGGCTATCTTGGCTCCCTTCACCCCCGTCTCCGCCAGTACCTTCACCGAAACAGCGATCGATCAAACTGAGGTAATTGCAGTGGCCCGCCCCTATGGCGTCGAAACCACTAAGTATGACCTTTTGGTGATTGAACAGATTCCCGGTAAAAACAAATGTTGGGATGTCACCCCCGGAGCACCGGCCATGGTGGATCCCCTGCTGTTAAATTTTGACTTCACTGGCCACTGCCGCCGCGCCACAGACAGCAACGGCTATTCCATCCGCATCGATGGCCAGGACTATGGCTTGGATTACTTATTACGTCTTGTACCCAGGGGCAATGAATTAGTTTTGGTGGCCACTTCTCGCAACGGCCGCGGCCCCGAACTCGTAGTTGGTAGTACCAAGGGGATTGGCGCAGGTTTTATGCAGGTACAGCTCAACCCAGGCTGGCAGTTCACTAAACGCACCTACGAAGGTCAAGTTTTGGGGCACTACTACATTAGTGGCACCCAGGCCGCTATTTTGGGCGGAACCGCTGTTAGCCCTGTGGGCCCAGAGCCAATCACCCCAGAAAAACAAGAACTCATTGCCCCTGAGCCGGTTCAGACCTTGGAGAATAATCCTAACCCCACTCCAACAGAGGTAACGGAAACCGGGACGGAAATTATCATTAAGCAGGAAGTACCAGAAGTACCCGCTAATGAACAGTCCGGCATGGTGATGGAAGAAGAGAGTGTCAGCACTGTGACCGAAGAAAACTCCGTTGCCAAAGAAATGGAAACGGTTACTCCCAAACCGGCCCTTGTGGTTAAACCAAATCCTCCCCGACGCCGCACCCCCACCCCTGCGGATTTTCGCCCCTAG

Protein

MNWKFFPHPFLAMAVGAILAPFTPVSASTFTETAIDQTEVIAVARPYGVETTKYDLLVIEQIPGKNKCWDVTPGAPAMVDPLLLNFDFTGHCRRATDSNGYSIRIDGQDYGLDYLLRLVPRGNELVLVATSRNGRGPELVVGSTKGIGAGFMQVQLNPGWQFTKRTYEGQVLGHYYISGTQAAILGGTAVSPVGPEPITPEKQELIAPEPVQTLENNPNPTPTEVTETGTEIIIKQEVPEVPANEQSGMVMEEESVSTVTEENSVAKEMETVTPKPALVVKPNPPRRRTPTPADFRP