Your browser is old and dusty. Try Google Chrome!

Details for sll0317

ORF sll0317
Accession NP_442093.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY203i: 2443391 - 2443924, join 2444874 - 2445513]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442100.1_4 Forward -173 -154 9.63507 0.278
NP_441480.1_1 Forward -179 -160 -0.787193 0.287
NP_440897.1_6 Reverse -287 -306 3.9319 0.14
NP_442151.1_1 Reverse -124 -143 4.42435 0.287
NP_440226.1_9 Reverse -230 -249 12.1925 0.215
NP_440259.1_4 Reverse -11 -25 10.082 0.276
NP_441098.1_3 Reverse -250 -269 -6.50185 0.28
NP_440996.1_1 Reverse -238 -257 18.6308 0.0234
NP_440996.1_2 Reverse -194 -203 14.8477 0.248
NP_441812.1_4 Reverse -297 -315 11.9172 0.253
NP_441470.1_4 Reverse -367 -386 27.5321 0.0000116
NP_441470.1_6 Reverse -224 -243 28.2204 0.0000759
NP_441470.1_7 Reverse -323 -342 27.2371 0.000139
NP_442062.1_3 Forward -20 -1 -3.63879 0.294
NP_442972.1_2 Reverse -212 -226 15.2402 0.136
NP_442268.1_3 Forward -301 -282 12.9783 0.284
NP_441492.1_1 Reverse -119 -138 11.1109 0.148
NP_441365.1_5 Reverse -119 -138 37.5619 0.000000115
NP_440300.1_5 Forward -110 -92 12.225 0.271
NP_441434.1_1 Forward -270 -256 10.0383 0.233
NP_441434.1_1 Reverse -256 -270 7.93745 0.26
NP_440178.1_7 Forward -294 -275 -15.0452 0.156
NP_441716.1_2 Forward -87 -68 3.35565 0.229
NP_442973.1_5 Reverse -127 -146 9.93088 0.287
NP_441486.1_10 Forward -33 -16 12.0968 0.255
NP_442730.1_8 Forward -173 -154 8.16011 0.185
NP_442687.1_7 Reverse -168 -178 4.20827 0.262
NP_442687.1_7 Forward -398 -388 4.10993 0.266
NP_442720.1_8 Forward -350 -332 7.59063 0.297
NP_442658.1_1 Reverse -134 -144 6.37109 0.231
NP_442496.1_5 Reverse -186 -204 4.83737 0.288
NP_442690.1_1 Reverse -4 -23 -14.3569 0.272
NP_440200.1_7 Reverse -182 -201 6.22677 0.204
NP_441913.1_1 Reverse -295 -311 13.6262 0.246
NP_442598.1_2 Forward -329 -320 14.2577 0.252
NP_441000.1_1 Reverse -118 -136 13.3937 0.184
NP_441369.1_1 Reverse -84 -103 38.7419 0.000000157
NP_441369.1_2 Reverse -114 -133 38.9385 0.0000000955
NP_441369.1_3 Reverse -67 -81 28.5156 0.00021
NP_441514.1_1 Forward -25 -15 13.4856 0.284
NP_441079.1_3 Reverse -138 -157 13.4708 0.166
NP_441566.1_3 Reverse -182 -201 14.5524 0.198
NP_440437.1_1 Reverse -278 -297 -5.80207 0.292
NP_442500.1_8 Forward -24 -10 10.9496 0.271
NP_442288.1_5 Reverse -82 -96 16.7159 0.12
NP_441556.1_6 Reverse -86 -104 12.4797 0.296
NP_442247.1_5 Forward -111 -97 14.4865 0.234
NP_442933.1_1 Reverse -35 -54 7.59119 0.253
NP_442933.1_1 Forward -235 -216 7.11373 0.253
NP_442671.1_2 Reverse -92 -111 24.6829 0.000359
NP_442970.1_1 Reverse -94 -108 9.56081 0.269
NP_440405.1_6 Reverse -250 -268 2.18243 0.26
NP_440881.1_10 Forward -301 -288 11.3273 0.249
NP_442076.1_5 Reverse -88 -107 9.93088 0.186
NP_440183.1_1 Forward -363 -344 8.25926 0.244
NP_441758.1_10 Forward -23 -4 -1.27961 0.265
NP_441096.1_7 Reverse -21 -35 18.1551 0.198
NP_441826.1_2 Reverse -287 -301 -0.197071 0.204
NP_441826.1_6 Reverse -248 -262 20.5508 0.0182
NP_441612.1_2 Reverse -192 -202 11.5505 0.21
NP_440871.1_3 Forward -88 -74 15.905 0.166
NP_442775.1_6 Forward -369 -350 10.5209 0.277
NP_441849.1_2 Reverse -17 -36 0.142815 0.277
NP_442692.1_4 Forward -33 -14 13.8641 0.246
NP_440274.1_2 Forward -388 -374 12.3887 0.236
NP_441878.1_6 Reverse -387 -397 -7.29646 0.217
NP_441036.1_7 Reverse -188 -198 16.7941 0.0578
NP_441445.1_1 Forward -311 -292 1.17943 0.259
NP_440084.1_5 Forward -376 -357 13.7658 0.124
NP_441116.1_10 Forward -200 -181 4.71934 0.257
NP_442047.1_2 Forward -314 -300 15.4376 0.161
NP_441633.1_6 Forward -213 -194 8.75091 0.182
NP_440136.1_1 Forward -247 -231 9.69426 0.238
NP_442998.1_5 Reverse -115 -125 8.53483 0.261
NP_440899.1_8 Forward -107 -88 -9.14533 0.258
NP_441118.1_2 Reverse -155 -174 24.4839 0.000875
NP_441118.1_10 Reverse -287 -305 24.0119 0.000829
NP_441362.1_2 Reverse -90 -109 5.55684 0.243
NP_441296.1_6 Forward -279 -260 0.982764 0.299
NP_441866.1_1 Reverse -39 -58 18.0069 0.201
NP_440537.1_7 Reverse -68 -87 16.6629 0.0599
NP_440787.1_5 Forward -23 -9 18.6825 0.0934
NP_440306.1_3 Reverse -251 -270 4.71934 0.295
NP_441340.1_5 Reverse -294 -301 8.8889 0.084
NP_441248.1_10 Reverse -371 -381 14.9073 0.277
NP_440192.1_4 Reverse -370 -389 12.6963 0.169
NP_443051.1_5 Forward -52 -33 5.99764 0.256
NP_440372.1_3 Reverse -95 -109 15.0039 0.165
NP_441293.1_6 Forward -386 -367 16.09 0.1
NP_440699.1_1 Forward -39 -20 7.97315 0.239
NP_441018.1_3 Forward -293 -274 10.52 0.286
NP_440530.1_6 Forward -286 -272 15.7664 0.201
NP_442910.1_1 Reverse -305 -324 -7.57203 0.254
NP_440189.1_2 Reverse -380 -399 1.27776 0.268
NP_440562.1_5 Forward -351 -332 3.04771 0.261
NP_440350.1_5 Forward -340 -321 1.57275 0.158
NP_442129.1_6 Reverse -93 -112 13.9464 0.246
NP_440888.1_2 Forward -171 -157 6.19383 0.243
NP_441771.1_4 Reverse -191 -210 -4.42544 0.292
NP_440600.1_9 Reverse -41 -60 13.3207 0.243
NP_440179.1_6 Forward -396 -377 4.03102 0.246
NP_440663.1_6 Forward -301 -282 14.4541 0.0249
NP_442277.1_7 Forward -37 -21 -1.61656 0.278
NP_442845.1_2 Reverse -287 -301 3.93283 0.272
NP_442710.1_6 Reverse -201 -220 6.39097 0.204
NP_442710.1_7 Reverse -91 -110 -7.22274 0.294
NP_439907.1_10 Reverse -285 -304 11.0117 0.273
NP_441462.1_2 Forward -397 -387 -0.904945 0.265
NP_440519.1_6 Forward -176 -162 9.43936 0.29
NP_440544.1_5 Forward -342 -335 13.8024 0.28
NP_442139.1_10 Forward -371 -352 12.1917 0.188
NP_442694.1_8 Forward -108 -90 12.3105 0.191
NP_442694.1_9 Reverse -5 -24 8.35759 0.277
NP_443054.1_2 Reverse -386 -400 0.982901 0.251
NP_441982.1_10 Forward -136 -117 8.55343 0.143
NP_440005.1_3 Reverse -254 -273 21.2407 0.00993
NP_442689.1_8 Forward -108 -91 -8.61428 0.294
NP_441661.1_3 Reverse -329 -346 -3.99273 0.226
NP_441124.1_5 Reverse -87 -97 12.7217 0.215
NP_440431.1_3 Forward -36 -17 -10.3253 0.275
NP_440431.1_3 Reverse -286 -305 -10.7186 0.276
NP_440431.1_4 Forward -45 -26 -7.30556 0.262
NP_440943.1_5 Reverse -133 -147 14.1593 0.22
NP_442348.1_2 Forward -347 -338 11.7994 0.225
NP_442906.1_9 Forward -212 -193 4.32602 0.207
NP_441432.1_8 Reverse -161 -170 2.85133 0.281
NP_442400.1_10 Forward -48 -35 9.41998 0.271
NP_442489.1_7 Reverse -388 -397 -1.47524 0.203
NP_440284.1_8 Reverse -125 -144 29.6945 0.000000161
NP_440284.1_9 Reverse -193 -212 28.8104 0.00000727
NP_440336.1_1 Reverse -217 -236 10.5209 0.286
NP_441329.1_1 Forward -83 -64 6.15881 0.265
NP_441329.1_1 Forward -198 -179 5.29938 0.265
NP_441329.1_6 Reverse -323 -342 12.0793 0.106
NP_441329.1_6 Reverse -321 -340 -2.14899 0.293
NP_441329.1_6 Forward -40 -21 -2.91293 0.294
NP_442436.1_4 Forward -236 -222 12.3893 0.218
NP_440227.1_2 Reverse -264 -280 8.41667 0.29
NP_441239.1_9 Forward -399 -387 4.26721 0.256
NP_442568.1_8 Reverse -323 -337 10.7177 0.257
NP_441541.1_1 Reverse -104 -122 -3.43572 0.264
NP_440833.1_4 Forward -352 -334 14.3755 0.0722
NP_442499.1_4 Reverse -291 -305 11.0127 0.226
NP_442840.1_7 Reverse -195 -214 13.5691 0.064
NP_440341.1_7 Forward -321 -307 12.6843 0.2
NP_441848.1_4 Forward -73 -57 8.79206 0.288
NP_441848.1_4 Reverse -270 -286 7.74165 0.288
NP_441811.1_8 Reverse -376 -390 5.80112 0.289
NP_442679.1_1 Reverse -216 -235 3.83436 0.147
NP_442053.1_1 Reverse -388 -397 5.70292 0.172
NP_441959.1_8 Reverse -94 -107 8.61288 0.286
NP_441959.1_8 Reverse -33 -46 8.22726 0.298
NP_442456.1_5 Reverse -158 -176 6.80398 0.26
NP_442532.1_2 Forward -34 -15 10.5514 0.121
NP_442533.1_6 Reverse -388 -397 2.35967 0.259
NP_440854.1_6 Forward -30 -11 14.5621 0.26
NP_441482.1_7 Reverse -382 -396 -11.0135 0.229
NP_441028.1_6 Forward -199 -189 14.6309 0.158
NP_441527.1_4 Reverse -322 -341 -1.09858 0.146
NP_441527.1_4 Reverse -321 -340 -1.28956 0.146
NP_441527.1_4 Reverse -324 -343 -1.67153 0.148
NP_441527.1_4 Reverse -325 -344 -4.15432 0.179
NP_441527.1_4 Forward -35 -16 -10.0748 0.264
NP_441527.1_4 Reverse -323 -342 -11.5072 0.282
NP_441527.1_4 Reverse -184 -203 -12.1756 0.285
NP_441527.1_4 Forward -52 -33 -12.5576 0.291
NP_441527.1_4 Forward -48 -29 -12.6531 0.292
NP_439965.1_1 Forward -356 -337 -10.4236 0.3
NP_442673.1_5 Forward -218 -200 11.4255 0.272
NP_441106.1_7 Reverse -355 -374 13.0766 0.205
NP_441825.1_4 Forward -347 -337 12.5664 0.249
NP_440670.1_8 Reverse -388 -397 3.14632 0.296
NP_442463.1_3 Forward -177 -158 10.0292 0.275
NP_439940.1_1 Reverse -66 -85 31.957 0.00000438
NP_440855.1_3 Forward -328 -309 9.63507 0.185
NP_441431.1_1 Forward -109 -91 5.06306 0.245
NP_440082.1_5 Reverse -18 -37 15.2287 0.256
NP_442805.1_6 Reverse -155 -174 1.86774 0.292
NP_440114.1_10 Reverse -136 -150 7.37441 0.236
NP_440114.1_10 Forward -397 -383 5.80112 0.292
NP_442324.1_7 Reverse -124 -143 6.24429 0.268
NP_440766.1_5 Reverse -190 -202 7.65579 0.288
NP_440278.1_1 Reverse -348 -367 9.53756 0.155
NP_440213.1_4 Forward -218 -199 15.6421 0.217
NP_442680.1_5 Reverse -261 -280 1.73297 0.237
NP_441436.1_8 Reverse -311 -330 7.07928 0.293
NP_441496.1_1 Forward -208 -194 14.3354 0.265
NP_440185.1_9 Reverse -378 -395 11.9369 0.264
NP_442341.1_5 Reverse -269 -288 15.0441 0.182
NP_440191.1_6 Forward -109 -95 13.1895 0.294
NP_441397.1_8 Reverse -190 -203 15.8179 0.142
NP_441902.1_3 Reverse -190 -200 13.0789 0.23
NP_442451.1_7 Reverse -89 -108 12.9791 0.113
NP_442451.1_7 Reverse -220 -239 8.65258 0.26
NP_441190.1_2 Reverse -198 -217 4.03102 0.17
NP_440175.1_4 Reverse -380 -399 -2.36049 0.122
NP_440216.1_9 Reverse -295 -304 5.50626 0.292
NP_441064.1_4 Forward -316 -297 7.07928 0.276
NP_440117.1_7 Reverse -231 -245 17.9942 0.0592
NP_442116.1_6 Reverse -315 -332 12.5616 0.172
NP_442116.1_6 Forward -110 -93 7.50051 0.254
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TACGGCACTCGGCCTCACTCCAAATTTCTTGGCTCTGTCTATCAATCTTGCATCGGGATTTTCTTCTACGTCTTTTTTTAGAGCTTCCCAGTCTAATTTCCTATGGCGACGCTCTACTTTTGTTGGGCTTAAATCTACTCTATTTAACCATCTGTATATCGAGGCTTTTCCTATTTTATATATCTTGGAAGCCTCAGTTATTTTTCCTCCAGCTTCTATATAAGCTACTACCCTTTGCCTTAAATCTAAACTGTAAGCCATTGTTTAAACCTGTTCATTTTGTACACTCCATAATTTTACATTAAATTCTCTCATCGTTAATTGAAATGACTATAACAAATATCATGTATTAAGAATAAAGAATAATATAAAGCTAGAAAAATTAGCCAATGATAACTAT

CDS

ATGGTTGGAACTGGAAAGAATAAAATAGAGAGTAGAGTGGTAATATTCACCCATGATAATTCAGAGTTTAGATTGGTTACAAATTTACCTATAGAAAGTAAAGAAATAGAAGGAGTTAGTGATGAAAAAATAGCAGAAATTTATAAAAAAAGATGGCAAATAGAATTGTTATGGAAATTCTTAAAAATGCACTTAAAGCTGAATAGACTGATTGCCAAAAATGAGAATGCAATTGGGATTCAAATCTATACCTGTATAATTGCTTATTTAATACTAAAATTACTGGTAATCCCAAAAGAAGCAGGTACAACAATGTTAGACAAACTACGTTATTTACAGGCTTTCATGTGTGAAAAAATAAGCTATGTACACTGGCTAAGGGAGTTAGCACTAAGGTGA

Protein

MVGTGKNKIESRVVIFTHDNSEFRLVTNLPIESKEIEGVSDEKIAEIYKKRWQIELLWKFLKMHLKLNRLIAKNENAIGIQIYTCIIAYLILKLLVIPKEAGTTMLDKLRYLQAFMCEKISYVHWLRELALR