Your browser is old and dusty. Try Google Chrome!

Details for sll0315

ORF sll0315
Accession NP_442095.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY203i: 2443391 - 2443924, join 2444874 - 2445513]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_2 Forward -75 -57 15.7521 0.0797
NP_442272.1_2 Reverse -318 -337 11.7928 0.232
NP_440226.1_1 Reverse -177 -196 8.25926 0.0904
NP_441098.1_3 Forward -21 -2 -0.56821 0.25
NP_442062.1_8 Forward -186 -176 3.12662 0.285
NP_442972.1_1 Reverse -127 -145 14.4978 0.217
NP_442242.1_4 Forward -185 -178 9.47889 0.251
NP_441208.1_9 Reverse -47 -61 8.94771 0.219
NP_442110.1_7 Forward -186 -172 0.196253 0.266
NP_440769.1_8 Forward -329 -310 6.78429 0.286
NP_441083.1_2 Reverse -296 -313 17.246 0.284
NP_441434.1_7 Reverse -73 -87 1.57289 0.299
NP_442111.1_4 Forward -187 -173 3.8345 0.229
NP_441495.1_2 Forward -367 -348 9.63589 0.299
NP_442330.1_4 Forward -359 -340 12.8967 0.286
NP_441014.1_10 Reverse -224 -243 -1.18128 0.257
NP_442848.1_1 Forward -360 -346 -2.55701 0.263
NP_442687.1_7 Reverse -176 -186 7.05986 0.142
NP_441077.1_2 Forward -212 -193 2.43462 0.273
NP_440236.1_2 Forward -46 -28 -4.99573 0.277
NP_440184.1_7 Reverse -59 -78 13.5099 0.28
NP_442937.1_5 Forward -349 -330 6.09597 0.288
NP_442321.1_4 Reverse -39 -58 -7.76869 0.284
NP_441317.1_4 Reverse -51 -65 14.143 0.161
NP_441317.1_4 Reverse -53 -67 14.0475 0.161
NP_442816.1_7 Reverse -190 -209 14.5621 0.0872
NP_439905.1_5 Forward -242 -228 16.0275 0.288
NP_440388.1_7 Forward -32 -13 0.491109 0.251
NP_441646.1_1 Reverse -325 -344 3.04771 0.21
NP_441000.1_6 Reverse -176 -190 -4.81863 0.252
NP_441041.1_4 Forward -234 -215 -0.000545616 0.0918
NP_442996.1_7 Forward -210 -191 14.0542 0.252
NP_441725.1_5 Forward -185 -175 6.17489 0.115
NP_442941.1_2 Reverse -122 -141 11.3154 0.295
NP_441644.1_6 Forward -186 -176 3.71617 0.267
NP_442933.1_1 Reverse -194 -213 16.4719 0.167
NP_442933.1_2 Forward -212 -194 9.55118 0.257
NP_440919.1_1 Reverse -172 -191 -7.67036 0.28
NP_441741.1_6 Reverse -43 -62 7.96426 0.249
NP_441715.1_4 Forward -353 -343 4.50326 0.27
NP_440464.1_10 Reverse -389 -399 12.1487 0.253
NP_441731.1_7 Reverse -356 -375 0.884433 0.298
NP_442253.1_5 Forward -344 -327 1.31714 0.171
NP_441826.1_2 Reverse -171 -185 0.786239 0.172
NP_442427.1_8 Forward -195 -176 4.916 0.288
NP_441849.1_2 Reverse -7 -26 1.76618 0.245
NP_442718.1_2 Forward -24 -5 -5.11376 0.292
NP_440084.1_8 Reverse -39 -53 11.9481 0.241
NP_440084.1_8 Forward -259 -245 10.0383 0.271
NP_440084.1_8 Reverse -253 -267 8.60589 0.299
NP_440101.1_3 Reverse -172 -191 2.94938 0.242
NP_441458.1_8 Forward -148 -129 2.0038 0.295
NP_442919.1_3 Forward -67 -48 32.3539 0.000000334
NP_442347.1_2 Forward -313 -304 11.2095 0.056
NP_442645.1_2 Reverse -323 -342 -17.9951 0.267
NP_441633.1_3 Forward -188 -175 -6.56889 0.259
NP_440899.1_8 Reverse -8 -27 -10.3253 0.277
NP_440299.1_1 Forward -80 -67 2.87033 0.269
NP_440977.1_1 Forward -87 -68 37.3652 0.000000188
NP_440977.1_4 Forward -22 -3 37.8569 0.000000502
NP_442860.1_7 Forward -67 -49 8.22348 0.283
NP_441179.1_9 Reverse -362 -372 8.63269 0.284
NP_441704.1_8 Reverse -203 -222 7.27514 0.245
NP_441494.1_6 Reverse -172 -185 6.31247 0.289
NP_443028.1_4 Forward -208 -189 13.7292 0.252
NP_442474.1_1 Forward -59 -40 -4.22878 0.297
NP_441027.1_3 Reverse -124 -143 15.5553 0.263
NP_440586.1_8 Forward -372 -365 5.8403 0.283
NP_442251.1_6 Forward -185 -178 10.3639 0.134
NP_440699.1_1 Forward -72 -53 3.10306 0.288
NP_442262.1_2 Forward -59 -40 15.3417 0.247
NP_440531.1_6 Reverse -356 -375 1.76941 0.169
NP_440999.1_9 Reverse -173 -187 0.589577 0.18
NP_442454.1_2 Reverse -133 -152 12.1748 0.251
NP_441319.1_5 Forward -185 -166 8.65258 0.282
NP_442637.1_1 Forward -53 -34 -3.54046 0.16
NP_442637.1_7 Reverse -3 -22 3.73603 0.166
NP_440603.1_4 Reverse -72 -91 9.43923 0.221
NP_442219.1_9 Reverse -178 -187 5.50626 0.153
NP_442366.1_3 Forward -355 -337 -4.60241 0.274
NP_442694.1_4 Reverse -48 -57 14.8477 0.164
NP_441354.1_1 Forward -53 -34 4.22769 0.213
NP_440463.1_3 Reverse -265 -284 18.7807 0.187
NP_440874.1_2 Reverse -5 -24 20.5519 0.0141
NP_442843.1_1 Forward -372 -353 -11.4069 0.291
NP_439950.1_3 Forward -47 -28 3.14605 0.293
NP_440483.1_1 Reverse -295 -314 -3.83545 0.218
NP_441539.1_1 Forward -271 -257 14.1586 0.284
NP_442348.1_2 Reverse -48 -57 6.68623 0.299
NP_441432.1_9 Reverse -21 -34 11.604 0.221
NP_441432.1_9 Reverse -142 -155 10.6345 0.245
NP_441333.1_1 Reverse -54 -64 12.9245 0.217
NP_441333.1_1 Reverse -280 -290 12.6385 0.233
NP_442320.1_8 Forward -192 -178 -4.4253 0.168
NP_440386.1_3 Forward -23 -4 -4.72043 0.221
NP_440559.1_1 Reverse -178 -187 4.42462 0.277
NP_442913.1_10 Reverse -168 -187 -3.63879 0.214
NP_441923.1_6 Forward -372 -358 9.34103 0.278
NP_443022.1_9 Forward -388 -369 16.9124 0.199
NP_441329.1_6 Forward -73 -54 5.1084 0.191
NP_441329.1_6 Forward -71 -52 -3.00842 0.294
NP_440912.1_3 Reverse -51 -70 10.52 0.254
NP_442199.1_5 Forward -381 -362 -3.54046 0.208
NP_442140.1_3 Forward -372 -362 9.61647 0.104
NP_441692.1_2 Forward -42 -23 34.317 0.000000227
NP_440875.1_9 Reverse -366 -376 11.8762 0.147
NP_440821.1_4 Reverse -175 -185 -0.41329 0.257
NP_442402.1_4 Reverse -380 -399 -6.09781 0.25
NP_441848.1_7 Reverse -14 -33 0.195343 0.228
NP_440653.1_10 Forward -245 -226 6.39097 0.211
NP_440805.1_4 Forward -170 -151 8.25963 0.277
NP_441959.1_8 Reverse -7 -20 10.4446 0.286
NP_442532.1_1 Forward -68 -54 11.8628 0.215
NP_442203.1_1 Forward -210 -196 14.4309 0.254
NP_441527.1_4 Forward -34 -15 0.715766 0.134
NP_441527.1_4 Forward -205 -186 -12.6531 0.292
NP_442673.1_7 Reverse -53 -72 16.6629 0.13
NP_441825.1_4 Reverse -47 -57 13.8447 0.249
NP_441753.1_10 Forward -359 -340 1.67108 0.257
NP_440326.1_9 Reverse -5 -24 11.5033 0.274
NP_442842.1_10 Reverse -14 -33 5.22221 0.207
NP_439958.1_2 Forward -27 -13 17.5025 0.115
NP_442090.1_2 Reverse -230 -249 7.01823 0.281
NP_442698.1_10 Forward -70 -51 7.86593 0.233
NP_442698.1_10 Forward -174 -155 -1.27885 0.297
NP_442087.1_7 Reverse -37 -56 -3.73788 0.285
NP_442743.1_1 Reverse -354 -373 11.8967 0.241
NP_442867.1_8 Reverse -356 -375 5.211 0.276
NP_442680.1_5 Forward -40 -21 4.07754 0.227
NP_442297.1_10 Forward -38 -19 17.404 0.11
NP_441984.1_3 Forward -384 -366 6.01734 0.276
NP_441436.1_6 Reverse -338 -357 9.73422 0.26
NP_441489.1_3 Forward -30 -16 8.79688 0.232
NP_441489.1_3 Reverse -303 -317 7.84196 0.244
NP_440081.1_2 Forward -21 -2 19.2075 0.165
NP_443037.1_7 Forward -265 -246 -11.1119 0.282
NP_440628.1_1 Forward -66 -56 13.6803 0.279
NP_443000.1_7 Forward -188 -178 6.56821 0.123
NP_440679.1_5 Forward -376 -357 5.80098 0.292
NP_441635.1_2 Forward -48 -29 10.074 0.283
NP_441207.1_7 Forward -23 -9 8.67452 0.282
NP_440175.1_7 Reverse -21 -39 8.97275 0.282
NP_441105.1_3 Forward -197 -178 -7.67036 0.258
NP_440216.1_9 Reverse -366 -375 5.99792 0.289
NP_440198.1_10 Forward -235 -216 6.88262 0.296
NP_442834.1_9 Forward -375 -356 5.11266 0.268
NP_442116.1_6 Forward -23 -6 5.87715 0.289
NP_442564.1_10 Forward -278 -264 12.4876 0.244
NP_442046.1_9 Forward -205 -191 17.8958 0.194
NP_440261.1_5 Forward -185 -172 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTTGAGGATAGAACGCATGAATAACCCTGCCATGGTTGAGAAGGGCAGAGAGCGTTGGTGAGCATAGTCCAACCCTTTTAGTTAGTATTGAACCCAATGTTGCTGCTAGTAAAACAAACAATGCTCCTTGGATCAGATTTGCAATTTGCAGAGTTTGTAAAGATACAGGAATTGCAGTTGAATCGACAACTAAAGACAACATTAAAAATGAACTAGCGATTACACCCGGTACACATAAACAAAACAATAAGAGAGTTAATTTATAATCTATTTTCATGTCCAATTTCTGTTGAACTCATCAGTTGTATGAAATCAGAAGTGTTGAACGATAGTTATAAAGAGAAAAAAAGCCCTTTAAAATGATAGAATAAAGGGCAGAAATATTAGAATAATTGAAGAG

CDS

ATGATATCAAATTTTGGACATATTGTCAAAACTTATCTATCTAATTTTCCTAAAGATGACTACCCAGTATTAGACACATTTAAGTTTGTGAGTATCTGGTTAGGATTAGTGTTAGACCAGAGCCAGACAAGCATGAGGAGTATGTTTAAAAGACTGAACTTACGAGGAGAGACAGTCGATATATCTACATTCTCAAAGGCAAGCAAAAAAAGGGATGTGGGAGTTTTTAGAGAAATAATATTTTCCTTAAAAAAGGAATTGTCGAAAAGGAAGGAAATTAAGCAGGGAGAATTAGAAATATTTCCTCTCGATTCAACCATTGTCAGCATAACTAGTAAGTTGATGTGGAACCTTGGATTTCATCAGGTAAAAGTATTCAGTGGGATTAACTTATCAACAGGGATTCCGGGGGGAATAGTAATTCACTTTGGACAAGGTCATGATAATAAATATGGGAATGAAACAATAGAAGAGACTCCAGAAAATGGAGTAGCAGTAATGGATAGAGGATTTTGTGACTTACAGAGAATCAAGAGATTACAAAAGGAGAATATAGTAGTTTCAAATAAAGCTGAGACGCTAAACGCCACAGTAAGAACGGATAATTTCATCAAGAGACGTGTCAATAGGAGCGTACATTCTAGCTCGTTTCAAGGCACTAAAGTCATGCTCAATATCATTTAA

Protein

MISNFGHIVKTYLSNFPKDDYPVLDTFKFVSIWLGLVLDQSQTSMRSMFKRLNLRGETVDISTFSKASKKRDVGVFREIIFSLKKELSKRKEIKQGELEIFPLDSTIVSITSKLMWNLGFHQVKVFSGINLSTGIPGGIVIHFGQGHDNKYGNETIEETPENGVAVMDRGFCDLQRIKRLQKENIVVSNKAETLNATVRTDNFIKRRVNRSVHSSSFQGTKVMLNII