Your browser is old and dusty. Try Google Chrome!

Details for sll0312

ORF sll0312
Accession NP_442102.1
Symbol
Category probable oligopeptides ABC transporter permease protein
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -159 -173 10.9143 0.262
NP_442711.1_1 Forward -223 -209 10.521 0.278
NP_441061.1_2 Forward -249 -235 11.2093 0.0531
NP_441061.1_2 Forward -95 -81 5.40779 0.137
NP_441061.1_2 Reverse -242 -256 1.67122 0.183
NP_440795.1_7 Forward -249 -242 14.6904 0.0123
NP_440795.1_7 Reverse -242 -249 14.6904 0.0123
NP_440795.1_7 Forward -391 -384 13.1171 0.0477
NP_440795.1_7 Reverse -381 -388 6.43063 0.265
NP_441418.1_6 Forward -392 -373 -13.6686 0.0777
NP_441605.1_4 Reverse -373 -392 7.27595 0.267
NP_442291.1_5 Forward -97 -81 13.1366 0.0306
NP_441453.1_4 Reverse -241 -249 16.539 0.00633
NP_441453.1_4 Forward -250 -242 16.539 0.00633
NP_441453.1_4 Reverse -87 -95 14.7691 0.0119
NP_441453.1_4 Forward -96 -88 6.80426 0.121
NP_441623.1_1 Reverse -32 -50 -4.50408 0.274
NP_442151.1_6 Reverse -241 -255 17.8958 0.00866
NP_442151.1_6 Forward -250 -236 13.4709 0.0512
NP_442151.1_6 Forward -96 -82 12.0943 0.0818
NP_442151.1_6 Reverse -346 -360 9.5377 0.145
NP_442151.1_6 Forward -392 -378 7.07942 0.211
NP_441818.1_1 Forward -95 -84 8.71129 0.28
NP_440226.1_1 Forward -250 -231 9.43923 0.0726
NP_440226.1_1 Reverse -241 -260 6.98095 0.115
NP_441630.1_3 Forward -258 -239 9.53756 0.0975
NP_440150.1_6 Reverse -84 -103 12.7825 0.107
NP_442173.1_1 Forward -249 -241 15.4574 0.00633
NP_442173.1_1 Reverse -242 -250 15.4574 0.00633
NP_442173.1_1 Forward -95 -87 12.0158 0.0316
NP_442173.1_1 Reverse -88 -96 12.0158 0.0316
NP_442173.1_1 Forward -382 -374 7.29591 0.176
NP_442752.1_4 Forward -250 -243 13.8055 0.0199
NP_442752.1_4 Reverse -241 -248 13.8055 0.0199
NP_442752.1_4 Forward -96 -89 13.8055 0.0199
NP_443027.1_4 Reverse -239 -249 15.3197 0.0437
NP_441812.1_3 Forward -251 -237 17.3058 0.0613
NP_442975.1_10 Reverse -237 -251 11.7987 0.0482
NP_442975.1_10 Reverse -83 -97 3.04726 0.263
NP_442975.1_10 Forward -254 -240 1.37564 0.299
NP_441675.1_4 Forward -301 -282 14.6508 0.177
NP_440784.1_7 Forward -249 -242 15.9687 0.0123
NP_440784.1_7 Reverse -242 -249 15.9687 0.0123
NP_440784.1_7 Forward -95 -88 6.23397 0.241
NP_440784.1_7 Reverse -88 -95 6.13563 0.241
NP_442909.1_7 Forward -95 -81 11.602 0.131
NP_440061.1_9 Reverse -85 -99 18.2885 0.00997
NP_441054.1_1 Reverse -234 -248 14.6509 0.213
NP_441476.1_6 Forward -139 -120 13.7649 0.286
NP_440878.1_9 Reverse -70 -89 -2.36049 0.26
NP_442062.1_8 Reverse -241 -251 17.3846 0.00193
NP_442062.1_8 Forward -250 -240 10.3048 0.0493
NP_442062.1_8 Forward -96 -86 7.94484 0.0848
NP_442062.1_8 Reverse -87 -97 7.55152 0.0946
NP_440761.1_4 Reverse -236 -255 -3.63879 0.132
NP_441900.1_2 Forward -365 -347 0.313405 0.258
NP_440304.1_4 Reverse -239 -249 18.9579 0.00406
NP_440304.1_4 Reverse -381 -391 5.19158 0.223
NP_440304.1_4 Forward -252 -242 1.84832 0.299
NP_442242.1_4 Forward -249 -242 14.3954 0.0124
NP_442242.1_4 Reverse -242 -249 14.3954 0.0124
NP_440044.1_8 Forward -95 -76 -1.47551 0.246
NP_441660.1_7 Forward -259 -240 13.9625 0.167
NP_441619.1_8 Reverse -235 -249 14.0603 0.114
NP_441619.1_8 Forward -256 -242 9.53707 0.215
NP_441208.1_9 Forward -253 -239 9.34103 0.215
NP_441594.1_6 Reverse -232 -251 3.04771 0.238
NP_441594.1_6 Reverse -374 -393 1.96607 0.259
NP_442110.1_7 Forward -250 -236 9.2427 0.0755
NP_442110.1_7 Forward -96 -82 5.89945 0.159
NP_441082.1_10 Reverse -120 -133 14.0806 0.236
NP_441082.1_10 Reverse -223 -236 9.36073 0.25
NP_442259.1_6 Reverse -317 -336 15.7324 0.221
NP_441083.1_5 Reverse -241 -251 20.3345 0.00053
NP_441083.1_5 Reverse -87 -97 19.0562 0.00147
NP_441083.1_5 Forward -96 -86 17.7779 0.00336
NP_441083.1_5 Forward -250 -240 11.2881 0.0159
NP_441083.1_5 Forward -392 -382 7.35486 0.0566
NP_441083.1_5 Reverse -383 -393 0.176696 0.241
NP_442827.1_8 Forward -258 -239 4.32522 0.137
NP_442827.1_8 Reverse -93 -112 -3.04956 0.296
NP_441434.1_7 Forward -248 -234 3.93283 0.225
NP_441738.1_2 Forward -248 -241 15.28 0.0102
NP_441738.1_2 Reverse -243 -250 15.28 0.0102
NP_441738.1_2 Reverse -89 -96 15.28 0.0102
NP_441738.1_2 Forward -46 -39 8.29857 0.176
NP_441558.1_5 Reverse -239 -258 15.4374 0.0418
NP_441558.1_5 Reverse -85 -104 4.71934 0.271
NP_440209.1_1 Reverse -241 -249 18.1123 0.00295
NP_440209.1_1 Forward -250 -242 18.1123 0.00295
NP_440209.1_1 Forward -96 -88 8.57422 0.0425
NP_440209.1_1 Reverse -87 -95 8.47588 0.0457
NP_440870.1_4 Reverse -75 -93 4.34571 0.163
NP_442889.1_8 Reverse -238 -252 18.7801 0.0097
NP_441713.1_1 Forward -102 -83 -15.4385 0.263
NP_441713.1_1 Reverse -235 -254 -16.4218 0.283
NP_441770.1_5 Reverse -233 -252 2.26107 0.238
NP_440178.1_7 Reverse -60 -79 -14.5535 0.155
NP_440178.1_7 Forward -97 -78 -15.0452 0.156
NP_440178.1_7 Forward -251 -232 -22.0267 0.249
NP_442462.1_2 Reverse -329 -348 2.3594 0.275
NP_442445.1_1 Reverse -236 -255 13.8641 0.213
NP_441716.1_1 Reverse -87 -101 10.3243 0.0963
NP_441716.1_1 Forward -96 -82 4.52282 0.255
NP_441716.1_1 Forward -392 -378 2.85119 0.289
NP_442111.1_4 Reverse -86 -100 13.3726 0.039
NP_442111.1_4 Forward -393 -379 6.98109 0.108
NP_442111.1_4 Forward -251 -237 3.93283 0.226
NP_440343.1_10 Reverse -80 -98 17.3246 0.162
NP_440906.1_5 Forward -249 -242 15.8704 0.0124
NP_440906.1_5 Reverse -242 -249 15.8704 0.0124
NP_440906.1_5 Forward -95 -88 6.23397 0.234
NP_440906.1_5 Reverse -88 -95 6.13563 0.241
NP_440747.1_10 Forward -99 -87 16.8536 0.00143
NP_440747.1_10 Forward -253 -241 14.887 0.00223
NP_440747.1_10 Reverse -238 -250 -1.92764 0.0192
NP_440747.1_10 Reverse -84 -96 -2.32097 0.0331
NP_440747.1_10 Reverse -380 -392 -11.5641 0.125
NP_440747.1_10 Forward -395 -383 -11.8591 0.161
NP_441130.1_10 Forward -252 -238 6.6861 0.181
NP_441130.1_10 Reverse -85 -99 5.50613 0.227
NP_441486.1_1 Reverse -238 -252 6.29277 0.0344
NP_441486.1_1 Reverse -84 -98 4.32615 0.0462
NP_441486.1_1 Forward -253 -239 -2.55701 0.175
NP_441486.1_1 Forward -99 -85 -5.90027 0.266
NP_442634.1_4 Forward -252 -238 -3.34366 0.161
NP_442634.1_4 Reverse -239 -253 -3.44199 0.161
NP_442634.1_4 Forward -394 -380 -4.52363 0.206
NP_440403.1_4 Reverse -374 -393 2.94938 0.126
NP_441014.1_8 Forward -109 -90 -0.983855 0.218
NP_441014.1_9 Reverse -334 -353 8.35759 0.18
NP_442848.1_1 Reverse -235 -249 -4.22864 0.282
NP_442848.1_5 Forward -96 -78 -3.12744 0.29
NP_442848.1_9 Forward -398 -379 1.86774 0.255
NP_443018.1_3 Forward -249 -242 14.8871 0.0123
NP_443018.1_3 Reverse -242 -249 14.8871 0.0123
NP_443018.1_3 Reverse -88 -95 11.7405 0.0655
NP_443018.1_3 Forward -109 -102 7.6106 0.156
NP_443018.1_3 Forward -95 -88 5.44732 0.193
NP_441316.1_7 Reverse -239 -254 -0.118434 0.199
NP_441316.1_7 Forward -252 -237 -1.79006 0.24
NP_441634.1_8 Forward -252 -238 5.1128 0.114
NP_441634.1_8 Forward -98 -84 -3.83532 0.295
NP_440376.1_1 Forward -250 -241 19.4693 0.000692
NP_440376.1_1 Reverse -241 -250 19.4693 0.000692
NP_440376.1_1 Forward -96 -87 15.7327 0.00625
NP_440376.1_1 Reverse -87 -96 9.63616 0.0385
NP_440376.1_1 Reverse -383 -392 7.57121 0.0716
NP_440376.1_1 Forward -392 -383 0.589713 0.267
NP_441588.1_4 Reverse -243 -253 15.9097 0.0369
NP_441588.1_4 Forward -248 -238 6.66654 0.185
NP_443065.1_7 Reverse -372 -391 23.9913 0.0257
NP_442687.1_7 Reverse -382 -392 15.3197 0.0173
NP_442687.1_7 Reverse -240 -250 9.02648 0.0994
NP_442687.1_7 Forward -251 -241 8.92815 0.0994
NP_442687.1_7 Forward -97 -87 6.66654 0.155
NP_442485.1_3 Forward -394 -375 1.57275 0.223
NP_441422.1_7 Forward -252 -235 -5.36936 0.247
NP_441763.1_10 Reverse -230 -249 11.405 0.143
NP_440360.1_10 Forward -248 -234 4.62115 0.227
NP_442658.1_1 Reverse -239 -249 15.9091 0.00966
NP_442658.1_1 Forward -252 -242 6.76441 0.214
NP_442205.1_9 Reverse -235 -251 15.5948 0.0259
NP_442205.1_9 Reverse -81 -97 -3.18639 0.28
NP_441414.1_9 Reverse -241 -260 11.0125 0.0193
NP_441414.1_9 Forward -96 -77 -7.76869 0.225
NP_442937.1_5 Forward -101 -82 6.58763 0.275
NP_441958.1_5 Reverse -240 -250 21.2195 0.000805
NP_441958.1_5 Forward -251 -241 12.2714 0.00183
NP_441958.1_5 Forward -97 -87 10.0098 0.0167
NP_441958.1_5 Reverse -86 -96 2.43831 0.0422
NP_441958.1_5 Forward -393 -383 1.35667 0.0987
NP_441958.1_5 Reverse -382 -392 1.16001 0.114
NP_442836.1_5 Forward -243 -224 5.70265 0.185
NP_439905.1_1 Forward -249 -236 9.45906 0.219
NP_439905.1_1 Reverse -242 -255 9.16406 0.221
NP_440984.1_7 Forward -255 -241 20.7474 0.00322
NP_440984.1_7 Reverse -236 -250 10.4227 0.126
NP_440984.1_7 Reverse -82 -96 8.94771 0.133
NP_439990.1_5 Forward -101 -88 14.0806 0.0889
NP_439990.1_5 Forward -255 -242 7.59077 0.19
NP_439990.1_5 Reverse -236 -249 5.32916 0.298
NP_442911.1_2 Forward -260 -241 11.3075 0.0131
NP_441580.1_6 Forward -326 -307 -3.3438 0.235
NP_440153.1_5 Forward -95 -81 17.5025 0.0482
NP_442064.1_1 Forward -255 -236 -7.17871 0.236
NP_443055.1_6 Forward -110 -92 10.0481 0.131
NP_440138.1_6 Reverse -82 -101 1.86696 0.273
NP_441348.1_3 Reverse -82 -101 22.3206 0.0199
NP_441099.1_5 Forward -106 -87 -11.1119 0.271
NP_440809.1_9 Reverse -78 -96 -6.56903 0.225
NP_441294.1_7 Reverse -83 -97 13.1862 0.0727
NP_441294.1_7 Reverse -237 -251 8.96266 0.269
NP_441646.1_1 Forward -103 -84 9.63589 0.125
NP_441646.1_1 Forward -257 -238 3.44104 0.207
NP_442438.1_10 Reverse -236 -250 2.75286 0.168
NP_442438.1_10 Reverse -82 -96 -0.0987402 0.248
NP_440484.1_3 Reverse -239 -253 10.4227 0.242
NP_440147.1_4 Forward -252 -239 20.1771 0.00228
NP_440147.1_4 Forward -394 -381 7.78743 0.0619
NP_440147.1_4 Forward -98 -85 6.90245 0.0803
NP_440147.1_4 Reverse -239 -252 3.75586 0.181
NP_440147.1_4 Reverse -85 -98 -0.0790467 0.271
NP_441175.1_7 Reverse -241 -260 4.916 0.294
NP_441550.1_8 Reverse -239 -249 17.4824 0.00754
NP_441550.1_8 Forward -252 -242 14.6309 0.0132
NP_441550.1_8 Forward -98 -88 13.8442 0.0207
NP_441550.1_8 Reverse -85 -95 11.3859 0.0503
NP_441550.1_8 Reverse -381 -391 7.74772 0.149
NP_441550.1_8 Reverse -106 -116 6.27276 0.214
NP_441916.1_7 Forward -250 -240 18.9579 0.00144
NP_441916.1_7 Reverse -241 -251 10.3048 0.0261
NP_441916.1_7 Reverse -383 -393 5.5849 0.128
NP_441916.1_10 Reverse -233 -252 4.62101 0.223
NP_441041.1_7 Reverse -238 -250 18.3015 0.00558
NP_441041.1_7 Forward -51 -39 9.36115 0.114
NP_442396.1_5 Forward -254 -241 21.1604 0.00421
NP_442004.1_6 Forward -250 -236 5.89945 0.181
NP_441725.1_5 Forward -249 -239 8.92815 0.0553
NP_441725.1_5 Reverse -242 -252 2.04498 0.115
NP_441725.1_5 Forward -95 -85 1.55333 0.133
NP_441725.1_5 Forward -391 -381 -0.41329 0.251
NP_439966.1_7 Reverse -85 -95 14.8275 0.0177
NP_439966.1_7 Reverse -239 -249 13.8442 0.0234
NP_439966.1_7 Forward -252 -242 7.25606 0.15
NP_439966.1_7 Forward -98 -88 5.58445 0.216
NP_439966.1_9 Reverse -239 -248 0.983037 0.253
NP_442941.1_3 Reverse -242 -252 11.0914 0.0116
NP_442941.1_3 Forward -249 -239 10.9931 0.0116
NP_442941.1_3 Forward -95 -85 10.2065 0.0213
NP_442941.1_3 Reverse -88 -98 9.41981 0.0319
NP_440289.1_2 Reverse -238 -251 11.7207 0.018
NP_440289.1_2 Forward -395 -382 -3.71729 0.267
NP_440289.1_2 Reverse -167 -180 -3.91395 0.273
NP_440289.1_2 Reverse -380 -393 -4.89726 0.294
NP_440289.1_4 Reverse -237 -256 14.4541 0.126
NP_442281.1_1 Reverse -236 -250 12.9786 0.0319
NP_442281.1_1 Forward -255 -241 8.25877 0.0832
NP_442281.1_1 Reverse -82 -96 6.98048 0.111
NP_442901.1_4 Reverse -69 -88 -1.27885 0.284
NP_442256.1_2 Forward -98 -80 -0.570838 0.14
NP_442256.1_2 Reverse -239 -257 -8.83064 0.236
NP_440437.1_1 Forward -102 -83 2.0644 0.139
NP_442049.1_6 Forward -104 -85 6.68596 0.215
NP_441087.1_6 Reverse -193 -211 11.1298 0.212
NP_442068.1_4 Forward -334 -315 7.66846 0.23
NP_441644.1_6 Forward -250 -240 19.0557 0.000803
NP_441644.1_6 Reverse -241 -251 17.3841 0.00127
NP_441644.1_6 Reverse -87 -97 17.0891 0.00219
NP_441644.1_6 Forward -392 -382 9.81266 0.0678
NP_441644.1_6 Forward -96 -86 7.74772 0.117
NP_441644.1_6 Reverse -194 -204 4.60114 0.233
NP_440867.1_10 Forward -111 -92 0.687771 0.299
NP_442215.1_2 Reverse -239 -255 2.91013 0.107
NP_442215.1_2 Forward -252 -236 -3.08806 0.209
NP_442215.1_2 Forward -181 -165 -3.48138 0.216
NP_440253.1_2 Reverse -87 -105 2.47742 0.137
NP_440929.1_8 Forward -250 -241 19.2726 0.000701
NP_440929.1_8 Reverse -241 -250 19.2726 0.000701
NP_440929.1_8 Reverse -87 -96 16.5193 0.00413
NP_440929.1_8 Forward -96 -87 9.53783 0.0296
NP_442933.1_10 Forward -250 -241 17.601 0.00325
NP_442933.1_10 Reverse -241 -250 17.601 0.00325
NP_442933.1_10 Reverse -87 -96 8.06287 0.0885
NP_442933.1_10 Forward -96 -87 7.96454 0.0937
NP_442933.1_10 Reverse -383 -392 4.42462 0.246
NP_441751.2_8 Forward -249 -235 19.8624 0.00678
NP_441751.2_8 Reverse -242 -256 -2.06536 0.132
NP_441751.2_8 Forward -391 -377 -3.63866 0.152
NP_441751.2_8 Reverse -88 -102 -4.52363 0.174
NP_442554.1_8 Forward -249 -239 19.1546 0.00369
NP_442554.1_8 Reverse -242 -252 15.3197 0.00882
NP_442554.1_8 Forward -95 -85 13.5497 0.018
NP_442554.1_8 Reverse -88 -98 6.37155 0.12
NP_441762.1_7 Forward -251 -239 2.59558 0.0676
NP_441762.1_7 Reverse -240 -252 0.530633 0.0747
NP_442142.1_4 Reverse -238 -251 11.6217 0.054
NP_442142.1_4 Forward -99 -86 3.85363 0.243
NP_442142.1_4 Forward -253 -240 3.55864 0.251
NP_442292.1_1 Reverse -242 -251 18.486 0.00229
NP_442292.1_1 Forward -249 -240 17.5026 0.00435
NP_442292.1_1 Forward -95 -86 8.75118 0.0306
NP_442292.1_1 Reverse -88 -97 8.65285 0.0335
NP_442476.1_6 Reverse -242 -256 4.12949 0.149
NP_442476.1_6 Forward -180 -166 -0.295402 0.294
NP_440895.1_6 Forward -102 -89 10.049 0.202
NP_442381.1_8 Reverse -380 -399 -14.7502 0.284
NP_443009.1_2 Forward -248 -229 1.76941 0.216
NP_443009.1_5 Forward -251 -240 14.5128 0.02
NP_443009.1_5 Reverse -240 -251 10.1862 0.0792
NP_443009.1_5 Reverse -382 -393 4.8764 0.226
NP_441715.1_4 Reverse -242 -252 7.94484 0.107
NP_441715.1_4 Reverse -88 -98 7.55152 0.108
NP_441715.1_4 Forward -249 -239 7.25653 0.108
NP_441715.1_4 Forward -95 -85 5.09324 0.233
NP_440620.1_4 Forward -312 -298 13.8579 0.281
NP_441198.1_8 Reverse -239 -249 15.4199 0.0427
NP_440464.1_10 Reverse -242 -252 13.0082 0.169
NP_441468.1_1 Forward -249 -242 15.8704 0.0124
NP_441468.1_1 Reverse -242 -249 15.8704 0.0124
NP_441468.1_1 Forward -95 -88 6.13563 0.209
NP_441468.1_1 Reverse -88 -95 6.0373 0.223
NP_441015.1_10 Reverse -236 -255 3.14605 0.14
NP_441015.1_10 Forward -101 -82 -10.4236 0.284
NP_441673.1_1 Forward -250 -241 20.8459 0.000698
NP_441673.1_1 Reverse -241 -250 20.8459 0.000698
NP_441673.1_1 Forward -96 -87 11.1111 0.0121
NP_441673.1_1 Reverse -87 -96 11.0128 0.018
NP_441673.1_1 Forward -392 -383 1.67135 0.0404
NP_441673.1_1 Reverse -383 -392 1.47469 0.0936
NP_441731.1_3 Forward -104 -85 -3.83545 0.284
NP_441826.1_2 Reverse -377 -391 9.83269 0.0545
NP_441826.1_2 Reverse -81 -95 4.22782 0.104
NP_441826.1_2 Forward -256 -242 -1.47537 0.248
NP_441826.1_2 Reverse -235 -249 -2.36035 0.271
NP_441330.1_1 Forward -81 -62 -7.37537 0.183
NP_442811.1_2 Forward -186 -167 -1.08219 0.255
NP_442868.1_6 Forward -252 -242 9.81313 0.038
NP_442868.1_6 Forward -98 -88 9.51814 0.0447
NP_442868.1_6 Reverse -239 -249 8.63316 0.0555
NP_442868.1_6 Reverse -381 -391 7.55152 0.0746
NP_442868.1_6 Reverse -85 -95 0.0783647 0.248
NP_442868.1_6 Forward -394 -384 -0.41329 0.295
NP_442719.1_2 Reverse -296 -314 -7.15971 0.232
NP_441251.1_7 Reverse -35 -48 12.3107 0.266
NP_441612.1_2 Reverse -241 -251 8.54929 0.21
NP_442361.1_3 Reverse -254 -267 8.27909 0.285
NP_442808.1_1 Reverse -86 -96 9.22267 0.0481
NP_442808.1_1 Reverse -240 -250 8.73102 0.0481
NP_442808.1_1 Forward -251 -241 8.63269 0.0481
NP_442808.1_1 Forward -335 -325 5.78111 0.141
NP_442808.1_1 Reverse -211 -221 1.74956 0.281
NP_442808.1_1 Reverse -188 -198 1.06124 0.296
NP_441101.1_10 Forward -100 -81 -7.27704 0.29
NP_441101.1_10 Forward -396 -377 -7.76869 0.292
NP_440145.1_3 Forward -106 -87 6.09597 0.0557
NP_440145.1_3 Reverse -231 -250 1.47442 0.128
NP_442542.1_2 Forward -98 -85 8.77074 0.149
NP_442542.1_9 Reverse -234 -248 5.01387 0.279
NP_442050.1_5 Reverse -239 -249 17.1874 0.00812
NP_442050.1_5 Reverse -85 -95 14.3359 0.0206
NP_442050.1_5 Forward -252 -242 7.64939 0.243
NP_441114.1_3 Forward -108 -99 6.29291 0.285
NP_442789.1_4 Forward -394 -375 -1.57384 0.219
NP_442792.1_5 Reverse -177 -194 13.1169 0.266
NP_441878.1_6 Reverse -240 -250 10.5014 0.0176
NP_441878.1_6 Forward -251 -241 10.4031 0.0176
NP_441878.1_6 Forward -393 -383 1.65166 0.0795
NP_441878.1_6 Reverse -382 -392 0.865012 0.132
NP_441878.1_6 Forward -97 -87 0.668351 0.139
NP_441878.1_6 Reverse -86 -96 0.57002 0.14
NP_441036.1_8 Reverse -240 -250 15.713 0.00724
NP_441036.1_8 Forward -251 -241 8.33817 0.174
NP_441036.1_8 Forward -97 -87 7.05986 0.21
NP_441557.1_5 Forward -250 -241 19.9609 0.000699
NP_441557.1_5 Reverse -241 -250 19.9609 0.000699
NP_441557.1_5 Forward -96 -87 10.2261 0.0144
NP_441557.1_5 Reverse -87 -96 10.1278 0.0188
NP_441557.1_5 Forward -392 -383 0.786375 0.106
NP_441557.1_5 Reverse -383 -392 0.589713 0.134
NP_441445.1_1 Reverse -78 -97 13.6675 0.057
NP_441590.1_4 Forward -334 -315 2.16195 0.297
NP_442066.2_4 Forward -392 -373 -9.34199 0.298
NP_442066.2_9 Reverse -237 -250 19.3905 0.00844
NP_442066.2_9 Reverse -300 -313 15.4572 0.0838
NP_442066.2_9 Forward -254 -241 11.1307 0.154
NP_441308.1_8 Reverse -239 -249 12.4681 0.218
NP_440101.1_3 Reverse -236 -255 0.884433 0.289
NP_442183.1_1 Forward -250 -236 18.9775 0.0065
NP_442183.1_1 Reverse -172 -186 9.34103 0.0986
NP_442166.1_7 Reverse -88 -102 9.83269 0.19
NP_442397.1_9 Reverse -241 -260 2.55606 0.273
NP_441116.1_9 Forward -210 -196 12.291 0.256
NP_440979.1_4 Forward -360 -341 17.4032 0.205
NP_442135.1_8 Reverse -230 -248 16.5388 0.207
NP_441549.1_9 Forward -254 -236 -5.78238 0.198
NP_442347.1_2 Reverse -242 -251 12.4878 0.056
NP_442347.1_2 Reverse -88 -97 10.3245 0.058
NP_442347.1_2 Forward -249 -240 3.34298 0.284
NP_441037.1_4 Reverse -239 -249 16.5761 0.0168
NP_441037.1_4 Forward -252 -242 7.9999 0.237
NP_441037.1_4 Reverse -381 -391 7.12278 0.237
NP_442317.1_6 Forward -255 -236 1.67108 0.298
NP_441633.1_3 Forward -252 -239 10.8357 0.0286
NP_441633.1_3 Forward -394 -381 3.75586 0.0699
NP_441633.1_3 Forward -98 -85 -6.37223 0.248
NP_440136.1_2 Forward -249 -242 15.9687 0.0123
NP_440136.1_2 Reverse -242 -249 15.9687 0.0123
NP_440136.1_2 Forward -95 -88 6.23397 0.171
NP_440136.1_2 Reverse -88 -95 6.13563 0.193
NP_442590.1_10 Reverse -81 -100 3.04771 0.297
NP_442998.1_5 Forward -212 -202 14.3364 0.149
NP_442998.1_5 Forward -51 -41 10.7964 0.204
NP_442998.1_5 Reverse -78 -88 9.91146 0.232
NP_442998.1_5 Forward -211 -201 9.32148 0.243
NP_442998.1_10 Forward -248 -241 15.5754 0.0102
NP_442998.1_10 Reverse -243 -250 15.5754 0.0102
NP_442998.1_10 Reverse -89 -96 15.5754 0.0102
NP_442998.1_10 Reverse -57 -64 7.21728 0.144
NP_442998.1_10 Forward -94 -87 5.84064 0.235
NP_440299.1_1 Forward -254 -241 12.9984 0.0319
NP_440299.1_1 Forward -100 -87 10.7368 0.0541
NP_440299.1_1 Reverse -379 -392 5.32859 0.18
NP_441799.1_1 Forward -254 -240 16.8135 0.0129
NP_441799.1_1 Reverse -237 -251 13.7653 0.03
NP_441799.1_1 Reverse -83 -97 9.93039 0.082
NP_440977.1_5 Forward -286 -273 16.0466 0.219
NP_442504.1_10 Reverse -281 -300 10.8159 0.153
NP_441007.1_10 Reverse -236 -249 23.9137 0.00218
NP_441007.1_10 Forward -255 -242 8.57408 0.112
NP_442334.1_2 Reverse -98 -115 -7.72931 0.297
NP_442201.1_10 Forward -261 -242 -13.8652 0.278
NP_440256.1_1 Forward -99 -80 6.4893 0.0296
NP_442961.1_7 Forward -249 -230 7.66927 0.271
NP_442007.1_8 Forward -251 -233 9.6548 0.269
NP_441559.1_8 Forward -101 -87 2.75286 0.143
NP_441559.1_8 Forward -203 -189 -7.57189 0.295
NP_440915.1_6 Forward -100 -86 10.6193 0.0301
NP_440915.1_6 Reverse -237 -251 4.42448 0.0953
NP_440915.1_6 Reverse -379 -393 3.8345 0.1
NP_440915.1_6 Forward -254 -240 2.85119 0.111
NP_440717.1_1 Forward -249 -230 5.50599 0.272
NP_442866.1_6 Forward -98 -79 12.1925 0.182
NP_441464.1_8 Forward -250 -236 9.14437 0.192
NP_442453.1_6 Forward -328 -314 15.2089 0.286
NP_441939.1_3 Reverse -242 -261 6.09597 0.253
NP_441494.1_6 Reverse -236 -249 9.55739 0.227
NP_441494.1_6 Reverse -378 -391 8.9674 0.227
NP_439985.1_7 Reverse -81 -100 8.35759 0.18
NP_442993.1_1 Forward -250 -234 16.0865 0.00959
NP_442993.1_1 Forward -96 -80 -8.88958 0.176
NP_440677.1_6 Forward -105 -86 15.5357 0.131
NP_442386.1_9 Forward -251 -242 13.8639 0.0289
NP_442386.1_9 Reverse -86 -95 10.029 0.142
NP_442386.1_9 Reverse -240 -249 6.39082 0.219
NP_442386.1_9 Forward -191 -182 5.50585 0.25
NP_442386.1_9 Reverse -331 -340 5.40752 0.253
NP_442054.1_4 Forward -202 -183 11.8975 0.275
NP_441340.1_5 Forward -249 -242 15.6737 0.0124
NP_441340.1_5 Reverse -242 -249 15.6737 0.0124
NP_441340.1_5 Forward -95 -88 13.5105 0.0314
NP_441340.1_5 Reverse -88 -95 5.84064 0.208
NP_441340.1_9 Forward -52 -42 8.15881 0.256
NP_441271.1_4 Forward -368 -349 18.0915 0.118
NP_440168.1_4 Forward -106 -87 -7.4737 0.283
NP_440168.1_9 Forward -394 -375 -0.983855 0.273
NP_440586.1_8 Forward -249 -242 13.2151 0.026
NP_440586.1_8 Reverse -242 -249 13.2151 0.026
NP_440586.1_8 Reverse -88 -95 9.47853 0.146
NP_440586.1_8 Forward -95 -88 5.74197 0.283
NP_442251.1_6 Forward -249 -242 15.2804 0.0124
NP_442251.1_6 Reverse -242 -249 15.2804 0.0124
NP_440684.1_9 Forward -256 -242 12.9793 0.168
NP_440684.1_9 Reverse -81 -95 6.78443 0.29
NP_441262.1_3 Reverse -241 -248 14.7888 0.0223
NP_441262.1_3 Forward -250 -243 14.7888 0.0223
NP_441262.1_3 Forward -96 -89 14.7888 0.0223
NP_440027.1_8 Forward -99 -80 18.8781 0.127
NP_443051.1_1 Reverse -240 -249 19.5676 0.00335
NP_443051.1_1 Forward -251 -242 10.4228 0.00754
NP_443051.1_1 Forward -97 -88 7.47288 0.0571
NP_443051.1_1 Reverse -86 -95 0.589713 0.143
NP_443051.1_1 Forward -393 -384 -1.08191 0.281
NP_439984.1_3 Forward -257 -243 17.4035 0.0932
NP_440439.1_1 Reverse -238 -251 3.16588 0.119
NP_440439.1_1 Reverse -84 -97 0.117615 0.202
NP_440439.1_1 Forward -99 -86 -0.275709 0.211
NP_439943.1_4 Reverse -221 -240 12.1925 0.197
NP_440372.1_2 Forward -249 -242 16.3621 0.0124
NP_440372.1_2 Reverse -242 -249 16.3621 0.0124
NP_440372.1_2 Forward -95 -88 13.8055 0.0214
NP_440372.1_2 Reverse -88 -95 6.52896 0.188
NP_440574.1_2 Reverse -81 -100 10.6192 0.209
NP_441803.1_2 Forward -202 -183 9.73422 0.095
NP_440589.1_4 Reverse -75 -94 14.1591 0.204
NP_440139.1_1 Forward -398 -379 6.68515 0.139
NP_441572.1_7 Reverse -377 -396 -5.21209 0.253
NP_442384.1_10 Reverse -87 -100 17.7189 0.00567
NP_442384.1_10 Reverse -241 -254 15.8506 0.00946
NP_442384.1_10 Reverse -383 -396 2.2809 0.23
NP_442384.1_10 Forward -96 -83 0.314277 0.294
NP_441018.1_7 Reverse -224 -243 10.8159 0.194
NP_442790.1_4 Reverse -374 -393 3.83436 0.0729
NP_442790.1_4 Forward -259 -240 -0.885524 0.0987
NP_442790.1_4 Reverse -232 -251 -6.68705 0.144
NP_442790.1_4 Forward -105 -86 -15.8318 0.297
NP_442262.1_10 Forward -249 -242 14.1988 0.0123
NP_442262.1_10 Reverse -242 -249 14.1988 0.0123
NP_442262.1_10 Reverse -88 -95 13.2155 0.0213
NP_442262.1_10 Forward -109 -102 8.8889 0.219
NP_441689.1_5 Reverse -85 -95 13.0576 0.0844
NP_441689.1_5 Reverse -239 -249 8.43603 0.132
NP_441689.1_5 Forward -252 -242 5.78111 0.197
NP_441814.1_5 Reverse -266 -285 9.53756 0.229
NP_440344.1_10 Reverse -234 -251 -7.43431 0.117
NP_440531.1_6 Reverse -233 -252 -5.40875 0.297
NP_442910.1_1 Reverse -376 -395 -4.42544 0.254
NP_442832.1_3 Forward -257 -238 12.0942 0.288
NP_440562.1_10 Forward -105 -87 12.1139 0.206
NP_441965.1_10 Reverse -238 -254 12.4482 0.105
NP_441640.1_8 Reverse -88 -107 12.7825 0.0746
NP_442102.1_3 Forward -106 -87 18.6823 0.0935
NP_442102.1_4 Forward -299 -280 17.3057 0.222
NP_442102.1_7 Forward -55 -36 15.2408 0.223
NP_440297.1_9 Reverse -242 -252 -0.118297 0.282
NP_440297.1_9 Forward -249 -239 -0.314959 0.282
NP_440297.1_9 Forward -95 -85 -0.41329 0.283
NP_441896.1_3 Reverse -17 -36 -2.36049 0.281
NP_441896.1_5 Forward -185 -178 12.2322 0.273
NP_440894.1_2 Forward -351 -332 3.83436 0.172
NP_441679.1_6 Reverse -76 -95 7.86593 0.09
NP_440999.1_9 Reverse -379 -393 12.291 0.0414
NP_440999.1_9 Reverse -237 -251 10.9143 0.0483
NP_440999.1_9 Forward -100 -86 0.392915 0.187
NP_440888.1_2 Forward -250 -236 14.5519 0.0168
NP_440888.1_2 Reverse -87 -101 14.1586 0.02
NP_440888.1_2 Reverse -241 -255 9.73373 0.116
NP_440888.1_2 Forward -96 -82 8.06211 0.172
NP_440888.1_2 Forward -237 -223 7.07881 0.208
NP_440600.1_4 Forward -258 -240 5.42735 0.105
NP_440491.1_1 Reverse -238 -257 9.54836 0.21
NP_442277.1_4 Forward -119 -100 2.55527 0.243
NP_442033.1_10 Forward -394 -375 -11.6036 0.255
NP_441543.1_2 Reverse -242 -251 16.9127 0.00359
NP_441543.1_2 Forward -249 -240 15.9293 0.00518
NP_441543.1_2 Forward -95 -86 7.57121 0.113
NP_441543.1_2 Reverse -88 -97 7.07956 0.131
NP_442845.1_2 Forward -256 -242 17.1092 0.0608
NP_442845.1_2 Reverse -235 -249 16.4209 0.0636
NP_442845.1_2 Forward -96 -82 6.78443 0.202
NP_442845.1_2 Reverse -81 -95 5.89945 0.22
NP_442845.1_2 Reverse -326 -340 5.1128 0.243
NP_441834.1_7 Reverse -229 -248 15.3391 0.248
NP_441178.1_6 Forward -105 -86 2.26028 0.27
NP_441319.1_8 Forward -102 -84 14.2771 0.108
NP_440982.1_1 Forward -335 -316 3.34192 0.297
NP_441469.1_8 Forward -393 -384 8.35786 0.227
NP_441469.1_8 Reverse -240 -249 6.5879 0.227
NP_441469.1_8 Forward -251 -242 6.48957 0.227
NP_443064.1_6 Reverse -241 -251 12.5669 0.0796
NP_443064.1_6 Forward -96 -86 11.4034 0.13
NP_443064.1_6 Forward -250 -240 10.8217 0.13
NP_443064.1_6 Reverse -87 -97 10.4338 0.153
NP_443064.1_6 Forward -342 -332 9.3673 0.226
NP_443064.1_6 Forward -392 -382 8.78555 0.271
NP_442578.1_7 Forward -249 -242 14.5921 0.026
NP_442578.1_7 Reverse -242 -249 14.5921 0.026
NP_442578.1_7 Forward -391 -384 9.87221 0.122
NP_442578.1_7 Forward -95 -88 6.0373 0.18
NP_441462.1_2 Forward -250 -240 20.2362 0.000805
NP_441462.1_2 Reverse -241 -251 11.5831 0.00406
NP_441462.1_2 Forward -96 -86 9.81313 0.0143
NP_441462.1_2 Reverse -383 -393 8.82982 0.03
NP_441462.1_2 Reverse -87 -97 1.74999 0.0811
NP_441462.1_2 Forward -392 -382 0.963343 0.109
NP_441621.1_7 Forward -252 -238 -5.31028 0.25
NP_441929.1_9 Forward -145 -126 15.1698 0.269
NP_443062.1_1 Forward -96 -78 4.93815 0.244
NP_443062.1_1 Forward -250 -232 3.96308 0.279
NP_442204.1_1 Forward -100 -89 11.5634 0.0565
NP_442204.1_5 Reverse -231 -250 8.75091 0.111
NP_440516.1_8 Forward -250 -241 16.9127 0.00442
NP_440516.1_8 Reverse -241 -250 16.9127 0.00442
NP_440516.1_8 Forward -96 -87 16.9127 0.00442
NP_440516.1_8 Reverse -87 -96 14.8477 0.00685
NP_440516.1_8 Forward -400 -391 -0.590259 0.283
NP_442080.1_7 Reverse -312 -331 1.47442 0.215
NP_442428.1_5 Forward -249 -242 15.8704 0.0124
NP_442428.1_5 Reverse -242 -249 15.8704 0.0124
NP_442428.1_5 Forward -95 -88 6.13563 0.209
NP_442428.1_5 Reverse -88 -95 6.0373 0.212
NP_440673.1_3 Forward -248 -241 12.4288 0.0426
NP_440673.1_3 Reverse -243 -250 12.4288 0.0426
NP_440673.1_3 Reverse -89 -96 12.4288 0.0426
NP_440673.1_3 Forward -108 -101 10.5605 0.123
NP_440865.1_9 Forward -398 -379 -6.98204 0.238
NP_440865.1_9 Reverse -81 -100 -7.57203 0.247
NP_441052.1_2 Reverse -241 -251 19.9412 0.00106
NP_441052.1_2 Forward -250 -240 10.4031 0.0285
NP_441052.1_2 Forward -96 -86 10.4031 0.0285
NP_441052.1_2 Reverse -87 -97 10.1081 0.0295
NP_442219.1_9 Reverse -242 -251 17.7976 0.00718
NP_442219.1_9 Forward -249 -240 8.25953 0.0681
NP_442219.1_9 Forward -95 -86 8.06287 0.0696
NP_442219.1_9 Reverse -88 -97 7.96454 0.0696
NP_440436.1_4 Reverse -242 -251 17.2072 0.00233
NP_440436.1_4 Forward -249 -240 9.24241 0.0871
NP_440436.1_4 Forward -95 -86 7.66912 0.124
NP_440436.1_4 Reverse -88 -97 7.57079 0.124
NP_441884.1_9 Reverse -238 -257 -14.2585 0.138
NP_440314.1_9 Forward -249 -230 1.67108 0.0872
NP_439982.1_10 Reverse -44 -63 14.0608 0.238
NP_441719.1_4 Forward -249 -242 16.3621 0.0124
NP_441719.1_4 Reverse -242 -249 16.3621 0.0124
NP_441719.1_4 Forward -95 -88 6.82395 0.0855
NP_441719.1_4 Reverse -88 -95 6.52896 0.188
NP_441733.1_10 Reverse -238 -251 8.77074 0.135
NP_441004.1_1 Forward -256 -237 -16.9135 0.287
NP_442366.1_3 Forward -251 -233 -4.70074 0.275
NP_442366.1_5 Forward -253 -243 15.4175 0.0374
NP_439949.1_7 Reverse -36 -50 15.2409 0.215
NP_441115.1_4 Reverse -240 -258 15.653 0.0361
NP_442206.1_10 Reverse -87 -102 1.2582 0.236
NP_440328.1_4 Forward -256 -237 8.55425 0.113
NP_440328.1_4 Reverse -208 -227 -0.688862 0.286
NP_443054.1_2 Forward -252 -238 2.94952 0.24
NP_441851.1_10 Forward -251 -241 15.8113 0.00552
NP_441851.1_10 Reverse -240 -250 8.53483 0.114
NP_441851.1_10 Reverse -331 -341 8.4365 0.116
NP_441851.1_10 Reverse -351 -361 6.37155 0.172
NP_441851.1_10 Forward -97 -87 6.17489 0.182
NP_441851.1_10 Reverse -86 -96 5.97822 0.19
NP_442011.1_1 Forward -251 -232 -0.295539 0.268
NP_442856.1_7 Reverse -232 -251 4.62101 0.133
NP_442856.1_7 Forward -105 -86 -5.01543 0.27
NP_441668.1_4 Forward -260 -241 17.994 0.0435
NP_442515.1_1 Reverse -382 -396 11.8976 0.0376
NP_442515.1_1 Forward -97 -83 6.78443 0.0974
NP_442515.1_1 Forward -251 -237 6.48943 0.0975
NP_442515.1_1 Reverse -240 -254 4.71948 0.107
NP_442515.1_1 Forward -393 -379 -2.95034 0.284
NP_441982.1_6 Forward -306 -297 13.8222 0.274
NP_440165.1_5 Reverse -86 -105 -6.58872 0.238
NP_440940.1_7 Reverse -373 -391 6.99988 0.213
NP_441349.1_10 Reverse -77 -96 1.17943 0.0845
NP_441349.1_10 Reverse -231 -250 -5.31042 0.198
NP_442024.1_4 Reverse -78 -97 12.9791 0.197
NP_441409.1_6 Forward -102 -83 -9.63698 0.189
NP_440432.1_9 Reverse -384 -399 -4.83832 0.224
NP_440474.1_8 Forward -249 -235 19.0751 0.0423
NP_441477.1_10 Reverse -80 -98 4.14905 0.203
NP_441477.1_10 Forward -124 -106 -0.964162 0.296
NP_440431.1_3 Reverse -240 -259 4.916 0.09
NP_442450.1_5 Forward -252 -242 7.55152 0.13
NP_440588.1_2 Forward -105 -86 -3.44213 0.186
NP_440588.1_2 Reverse -232 -251 -6.29373 0.276
NP_441031.1_1 Forward -142 -123 6.91914 0.259
NP_442006.1_2 Reverse -92 -109 -17.3657 0.274
NP_441570.1_1 Forward -96 -78 -10.1089 0.16
NP_440078.1_4 Forward -261 -242 10.3242 0.265
NP_441078.1_4 Forward -250 -241 19.6659 0.0007
NP_441078.1_4 Reverse -241 -250 19.6659 0.0007
NP_441078.1_4 Forward -96 -87 9.93116 0.0203
NP_441078.1_4 Reverse -87 -96 9.83282 0.0226
NP_441078.1_4 Forward -392 -383 0.688044 0.164
NP_441078.1_4 Reverse -383 -392 0.29472 0.205
NP_442729.1_8 Forward -254 -241 10.639 0.125
NP_441528.1_3 Forward -93 -74 21.2345 0.0623
NP_442348.1_2 Reverse -39 -48 17.011 0.055
NP_442348.1_2 Reverse -266 -275 11.4061 0.235
NP_441094.1_6 Reverse -234 -251 8.00291 0.273
NP_440526.1_3 Forward -249 -238 11.6612 0.0646
NP_440526.1_3 Reverse -242 -253 1.04151 0.267
NP_441432.1_8 Reverse -240 -249 16.8143 0.00595
NP_441432.1_8 Forward -251 -242 16.8143 0.00595
NP_441432.1_8 Forward -97 -88 14.0611 0.0258
NP_441432.1_8 Reverse -86 -95 6.98123 0.112
NP_441432.1_8 Reverse -227 -236 3.04799 0.268
NP_441333.1_1 Reverse -363 -373 12.0666 0.241
NP_442320.1_8 Reverse -235 -249 -1.18038 0.0817
NP_442320.1_8 Forward -256 -242 -4.52363 0.171
NP_442320.1_8 Reverse -81 -95 -6.29359 0.277
NP_442344.1_7 Forward -249 -230 -6.49039 0.171
NP_442344.1_7 Forward -95 -76 -7.96535 0.198
NP_442344.1_7 Reverse -242 -261 -9.14533 0.239
NP_441732.1_2 Forward -100 -84 -6.62797 0.0495
NP_441732.1_2 Reverse -237 -253 -15.4778 0.147
NP_441732.1_2 Forward -254 -238 -16.5594 0.174
NP_441732.1_2 Reverse -83 -99 -17.5427 0.27
NP_440760.1_1 Reverse -241 -260 -4.13045 0.0392
NP_440760.1_1 Forward -250 -231 -4.81876 0.0475
NP_442797.1_7 Forward -103 -85 5.23069 0.216
NP_442797.1_7 Reverse -324 -342 -0.570838 0.284
NP_442797.1_7 Reverse -375 -393 -0.7675 0.287
NP_441945.1_10 Reverse -336 -355 8.25926 0.273
NP_441057.1_3 Reverse -317 -336 -11.1119 0.223
NP_442298.1_10 Forward -89 -70 11.5042 0.239
NP_441023.1_1 Reverse -87 -105 14.4738 0.18
NP_441072.1_2 Reverse -372 -391 6.29264 0.283
NP_442489.1_2 Reverse -110 -129 5.89931 0.187
NP_442489.1_7 Forward -250 -241 20.1576 0.000695
NP_442489.1_7 Reverse -241 -250 20.1576 0.000695
NP_442489.1_7 Reverse -87 -96 10.5211 0.0102
NP_442489.1_7 Forward -96 -87 10.4228 0.0151
NP_442489.1_7 Forward -392 -383 0.983037 0.121
NP_442489.1_7 Reverse -383 -392 0.786375 0.152
NP_441706.1_10 Forward -253 -234 9.3409 0.245
NP_441452.1_1 Forward -358 -339 13.3725 0.292
NP_440386.1_3 Reverse -295 -314 -4.22878 0.221
NP_440559.1_1 Reverse -242 -251 17.4043 0.00658
NP_440559.1_1 Forward -95 -86 14.651 0.0144
NP_440559.1_1 Forward -249 -240 8.65285 0.0586
NP_440559.1_1 Reverse -88 -97 7.76787 0.0918
NP_441659.2_8 Forward -250 -240 20.9245 0.000805
NP_441659.2_8 Reverse -241 -251 18.1713 0.00133
NP_441659.2_8 Reverse -87 -97 15.0247 0.00732
NP_441659.2_8 Forward -96 -86 8.63316 0.0405
NP_441659.2_8 Reverse -383 -393 6.56821 0.0714
NP_441659.2_8 Forward -392 -382 0.176696 0.271
NP_441022.1_1 Forward -302 -293 10.491 0.299
NP_442913.1_10 Reverse -232 -251 5.89931 0.0676
NP_442913.1_10 Reverse -78 -97 -1.7705 0.176
NP_442008.1_2 Forward -99 -80 3.44104 0.254
NP_442776.1_6 Reverse -239 -258 14.9458 0.11
NP_440779.1_5 Reverse -101 -118 -14.0225 0.238
NP_442346.1_5 Forward -251 -241 16.6963 0.00248
NP_442346.1_5 Reverse -240 -250 16.303 0.00248
NP_442346.1_5 Reverse -382 -392 9.7148 0.118
NP_442346.1_5 Forward -97 -87 7.55152 0.165
NP_442346.1_5 Reverse -86 -96 6.8632 0.188
NP_442346.1_5 Forward -393 -383 5.19158 0.256
NP_440545.1_3 Forward -254 -237 -3.50107 0.206
NP_440545.1_3 Reverse -379 -396 -3.79607 0.212
NP_440545.1_3 Reverse -83 -100 -4.77938 0.232
NP_440025.1_1 Forward -298 -279 6.88262 0.243
NP_440831.1_3 Reverse -78 -97 11.241 0.163
NP_440459.1_2 Reverse -239 -256 12.4285 0.149
NP_440459.1_2 Forward -98 -81 7.41366 0.291
NP_440010.1_5 Forward -41 -22 18.584 0.172
NP_440010.1_10 Reverse -75 -94 8.94757 0.211
NP_440010.1_10 Reverse -371 -390 1.37609 0.3
NP_442900.1_1 Forward -224 -205 -1.37718 0.195
NP_440847.1_3 Forward -109 -95 11.9953 0.254
NP_442603.1_7 Reverse -87 -101 15.1419 0.052
NP_442603.1_7 Forward -96 -82 12.487 0.0998
NP_442603.1_7 Reverse -241 -255 10.422 0.126
NP_440449.1_6 Reverse -233 -251 14.1889 0.0983
NP_440449.1_6 Forward -258 -240 10.6874 0.149
NP_441047.1_2 Reverse -338 -357 0.0977854 0.239
NP_441833.1_4 Forward -249 -242 15.9687 0.0124
NP_441833.1_4 Reverse -242 -249 15.9687 0.0124
NP_441833.1_4 Reverse -88 -95 6.52896 0.0924
NP_441833.1_4 Forward -95 -88 6.23397 0.163
NP_442699.1_8 Forward -72 -53 -13.0786 0.275
NP_442162.1_9 Forward -249 -242 16.2637 0.0124
NP_442162.1_9 Reverse -242 -249 16.2637 0.0124
NP_442162.1_9 Forward -95 -88 12.9205 0.0282
NP_442162.1_9 Reverse -88 -95 12.9205 0.0282
NP_440671.1_4 Forward -389 -375 7.66941 0.21
NP_440671.1_4 Reverse -81 -95 6.3911 0.248
NP_442140.1_3 Reverse -242 -252 12.2714 0.0632
NP_442140.1_3 Reverse -88 -98 8.23984 0.122
NP_442140.1_3 Forward -249 -239 7.94484 0.124
NP_442021.1_3 Forward -256 -237 -6.29373 0.257
NP_440875.1_9 Forward -248 -238 16.8403 0.0145
NP_440875.1_9 Reverse -89 -99 8.37203 0.233
NP_441813.1_5 Reverse -85 -95 12.7631 0.0192
NP_441813.1_5 Reverse -239 -249 8.73149 0.0367
NP_441813.1_5 Forward -252 -242 8.63316 0.0367
NP_441813.1_5 Forward -98 -88 8.4365 0.0432
NP_441813.1_5 Forward -394 -384 -0.806614 0.285
NP_441227.1_7 Reverse -88 -107 15.2979 0.212
NP_440590.1_4 Reverse -242 -255 7.88576 0.0493
NP_440590.1_4 Reverse -88 -101 5.13249 0.0585
NP_440590.1_4 Forward -249 -236 2.96921 0.0783
NP_440590.1_4 Forward -95 -82 2.47756 0.0879
NP_440567.1_1 Forward -249 -235 15.9292 0.0166
NP_440567.1_1 Reverse -242 -256 10.6193 0.034
NP_442497.1_10 Forward -249 -240 17.601 0.00813
NP_442497.1_10 Reverse -242 -251 10.4228 0.0087
NP_442497.1_10 Forward -391 -382 0.688044 0.141
NP_442497.1_10 Forward -95 -86 0.688044 0.141
NP_442497.1_10 Reverse -88 -97 0.589713 0.153
NP_442497.1_10 Reverse -384 -393 0.491382 0.162
NP_440821.1_4 Reverse -239 -249 10.7964 0.0146
NP_440821.1_4 Forward -252 -242 9.41981 0.0286
NP_440821.1_4 Reverse -85 -95 8.4365 0.0503
NP_440821.1_4 Reverse -381 -391 0.373358 0.18
NP_440821.1_4 Forward -98 -88 -0.314959 0.251
NP_441239.1_9 Reverse -239 -251 14.887 0.0247
NP_441239.1_9 Forward -252 -240 3.38223 0.285
NP_441239.1_9 Reverse -85 -97 3.08724 0.296
NP_441892.1_1 Reverse -374 -391 5.74204 0.0999
NP_441892.1_1 Reverse -232 -249 -3.20608 0.235
NP_442044.1_1 Forward -95 -76 -12.8819 0.273
NP_440796.1_3 Reverse -80 -98 7.3932 0.29
NP_442270.1_9 Reverse -230 -249 -11.3086 0.27
NP_442643.1_3 Forward -236 -217 -5.80207 0.261
NP_441017.1_6 Reverse -83 -97 11.2087 0.273
NP_440212.1_3 Reverse -190 -209 11.1109 0.158
NP_440354.1_5 Forward -99 -80 3.14605 0.239
NP_441617.1_6 Forward -257 -238 -3.93378 0.265
NP_440546.1_4 Forward -250 -240 13.5365 0.0459
NP_440546.1_4 Forward -96 -86 11.0156 0.0991
NP_440546.1_4 Reverse -241 -251 10.046 0.109
NP_440546.1_4 Reverse -87 -97 7.42815 0.241
NP_440546.1_4 Reverse -101 -111 6.45857 0.296
NP_440675.1_9 Reverse -76 -90 19.9608 0.164
NP_440462.1_6 Reverse -239 -249 19.4496 0.00371
NP_440462.1_6 Reverse -85 -95 4.79825 0.183
NP_440462.1_6 Forward -252 -242 1.35667 0.294
NP_442611.1_1 Reverse -87 -106 -0.688862 0.268
NP_440868.1_4 Reverse -237 -249 9.47875 0.0482
NP_440868.1_4 Forward -254 -242 8.10212 0.0602
NP_440868.1_4 Reverse -83 -95 6.1355 0.0878
NP_440868.1_4 Forward -100 -88 5.44718 0.0977
NP_442499.1_3 Forward -251 -233 5.23069 0.282
NP_442402.1_6 Reverse -36 -45 13.1761 0.289
NP_442402.1_9 Reverse -322 -341 9.3409 0.277
NP_441848.1_4 Forward -56 -40 6.97771 0.3
NP_441084.1_6 Reverse -239 -253 15.9372 0.0707
NP_440653.1_10 Reverse -242 -261 7.37428 0.203
NP_442039.1_4 Forward -249 -242 15.1821 0.0124
NP_442039.1_4 Reverse -242 -249 15.1821 0.0124
NP_442039.1_4 Forward -95 -88 11.6422 0.0747
NP_441811.1_8 Forward -256 -242 5.89945 0.289
NP_442829.1_2 Reverse -280 -296 13.0694 0.287
NP_441926.1_3 Forward -250 -234 7.04003 0.17
NP_440825.1_7 Reverse -242 -252 12.9096 0.152
NP_442696.1_2 Forward -251 -233 10.1472 0.22
NP_442837.1_3 Forward -249 -242 15.7721 0.0124
NP_442837.1_3 Reverse -242 -249 15.7721 0.0124
NP_442837.1_3 Forward -95 -88 6.0373 0.25
NP_442837.1_3 Reverse -88 -95 6.0373 0.25
NP_440160.1_1 Reverse -349 -368 11.1077 0.232
NP_440160.1_9 Reverse -86 -105 9.3409 0.241
NP_442053.1_1 Forward -250 -241 18.3876 0.0007
NP_442053.1_1 Reverse -241 -250 18.3876 0.0007
NP_442053.1_1 Reverse -87 -96 16.6177 0.00257
NP_442053.1_1 Forward -96 -87 8.65285 0.0741
NP_440505.1_3 Forward -98 -88 16.7946 0.00614
NP_440505.1_3 Reverse -239 -249 15.418 0.0114
NP_440505.1_3 Forward -252 -242 9.22315 0.122
NP_440505.1_3 Reverse -85 -95 6.46988 0.18
NP_440505.1_7 Forward -230 -211 -1.57384 0.276
NP_441252.1_6 Reverse -330 -337 11.6422 0.288
NP_442532.1_7 Forward -250 -236 5.60446 0.171
NP_441408.2_7 Reverse -239 -258 4.22769 0.191
NP_440914.1_1 Reverse -241 -251 17.5935 0.000537
NP_440914.1_1 Forward -250 -240 16.3248 0.00196
NP_440914.1_1 Reverse -87 -97 15.6417 0.00456
NP_440914.1_1 Forward -96 -86 13.3971 0.0303
NP_441011.1_8 Forward -249 -240 16.6177 0.00602
NP_441011.1_8 Reverse -242 -251 8.25953 0.144
NP_440068.1_1 Reverse -317 -336 1.17943 0.238
NP_442533.1_6 Forward -250 -241 17.2076 0.00137
NP_442533.1_6 Reverse -241 -250 17.2076 0.00137
NP_442533.1_6 Reverse -87 -96 14.2577 0.0132
NP_442533.1_6 Forward -392 -383 11.9961 0.0343
NP_442533.1_6 Forward -96 -87 7.47288 0.0898
NP_442535.1_9 Forward -105 -87 -4.11075 0.262
NP_441482.1_7 Forward -102 -88 -10.4235 0.209
NP_441482.1_7 Reverse -235 -249 -10.5218 0.209
NP_441482.1_7 Reverse -377 -391 -10.7185 0.213
NP_439944.1_9 Forward -249 -239 17.7779 0.00341
NP_439944.1_9 Reverse -242 -252 10.5014 0.0887
NP_439944.1_9 Forward -95 -85 9.7148 0.1
NP_441028.1_6 Forward -105 -95 6.46942 0.23
NP_441028.1_6 Reverse -205 -215 6.37109 0.23
NP_441527.1_8 Reverse -236 -255 2.3594 0.279
NP_440115.1_6 Forward -99 -89 16.008 0.0325
NP_440115.1_6 Reverse -238 -248 7.84651 0.146
NP_440115.1_6 Reverse -380 -390 6.76487 0.167
NP_440115.1_6 Reverse -169 -179 5.97822 0.206
NP_440115.1_6 Reverse -98 -108 5.19158 0.265
NP_440007.1_9 Forward -100 -86 6.19444 0.231
NP_441602.1_3 Forward -255 -236 -3.24547 0.243
NP_441106.1_1 Reverse -240 -249 18.486 0.0028
NP_441106.1_1 Forward -251 -242 9.63616 0.0311
NP_439903.1_6 Reverse -238 -257 8.4551 0.136
NP_442588.1_6 Reverse -90 -109 -2.26216 0.291
NP_441286.1_1 Forward -251 -239 14.6903 0.00418
NP_441286.1_1 Forward -97 -85 11.937 0.0108
NP_441286.1_1 Reverse -240 -252 3.48056 0.0467
NP_441286.1_1 Reverse -86 -98 3.08724 0.05
NP_441286.1_1 Forward -393 -381 -4.38592 0.156
NP_440670.1_8 Forward -250 -241 18.3876 0.000699
NP_440670.1_8 Reverse -241 -250 18.3876 0.000699
NP_440670.1_8 Forward -96 -87 18.0926 0.00136
NP_440670.1_8 Reverse -87 -96 15.831 0.00494
NP_440886.1_7 Reverse -240 -250 8.04271 0.0805
NP_440886.1_7 Forward -251 -241 7.94438 0.0805
NP_440886.1_7 Reverse -86 -96 6.66608 0.115
NP_442614.1_2 Reverse -241 -255 8.06273 0.255
NP_442614.1_2 Forward -96 -82 6.48943 0.291
NP_442614.1_2 Reverse -87 -101 5.80112 0.297
NP_442072.1_9 Forward -251 -233 -11.7806 0.0798
NP_442072.1_9 Reverse -240 -258 -20.3354 0.204
NP_442213.1_5 Reverse -73 -92 -1.08219 0.293
NP_440907.2_8 Forward -249 -239 19.1541 0.00362
NP_440907.2_8 Reverse -173 -183 8.14104 0.117
NP_440907.2_8 Reverse -242 -252 7.64939 0.117
NP_441021.1_1 Forward -249 -230 -7.17871 0.182
NP_440962.1_1 Reverse -283 -302 14.7491 0.258
NP_441463.1_3 Reverse -77 -96 -8.65367 0.272
NP_441626.1_2 Forward -249 -242 15.7721 0.0124
NP_441626.1_2 Reverse -242 -249 15.7721 0.0124
NP_441626.1_2 Forward -95 -88 12.2322 0.0511
NP_441626.1_2 Reverse -88 -95 5.93897 0.231
NP_442365.1_7 Forward -100 -81 -3.14714 0.212
NP_442365.1_7 Reverse -83 -102 -4.42544 0.245
NP_442794.1_1 Forward -100 -88 10.2654 0.0721
NP_442794.1_1 Forward -254 -242 9.28209 0.0795
NP_442615.1_1 Reverse -232 -250 22.1436 0.00306
NP_442615.1_1 Forward -259 -241 14.0805 0.0106
NP_442615.1_1 Forward -105 -87 -4.79907 0.194
NP_441962.1_4 Reverse -236 -255 -8.45701 0.2
NP_440387.1_1 Forward -250 -234 16.1848 0.0047
NP_440387.1_1 Reverse -241 -257 5.17175 0.0343
NP_440387.1_1 Forward -392 -376 -3.57971 0.162
NP_440387.1_1 Reverse -87 -103 -4.1697 0.178
NP_440855.1_3 Reverse -74 -93 16.0265 0.116
NP_440855.1_5 Forward -252 -233 4.03023 0.287
NP_441431.1_2 Reverse -238 -252 14.3553 0.0681
NP_441431.1_2 Forward -113 -99 8.75042 0.207
NP_441431.1_3 Reverse -340 -359 9.63589 0.236
NP_441488.1_8 Forward -101 -87 9.43874 0.153
NP_441836.1_2 Reverse -235 -254 2.3594 0.174
NP_441993.1_1 Reverse -377 -396 5.65007 0.198
NP_441993.1_1 Reverse -81 -100 5.06532 0.208
NP_440143.1_1 Reverse -349 -368 12.8808 0.284
NP_440114.1_10 Forward -250 -236 19.9608 0.00349
NP_440114.1_10 Reverse -101 -115 9.93102 0.159
NP_440114.1_10 Forward -96 -82 8.25939 0.21
NP_441425.1_6 Reverse -296 -306 16.008 0.252
NP_442698.1_10 Reverse -234 -253 0.0977854 0.297
NP_440754.1_3 Reverse -347 -365 12.6055 0.201
NP_440287.1_5 Forward -341 -322 8.84842 0.286
NP_440287.1_6 Forward -259 -240 12.4875 0.127
NP_440766.1_4 Forward -100 -86 1.76955 0.214
NP_441237.1_9 Reverse -242 -252 14.828 0.0242
NP_442103.1_2 Forward -352 -334 7.98318 0.266
NP_442867.1_8 Forward -109 -90 8.25926 0.237
NP_440457.1_1 Forward -100 -88 9.87208 0.092
NP_440798.1_6 Forward -95 -82 4.8375 0.143
NP_441984.1_3 Reverse -237 -255 5.52568 0.282
NP_440473.1_1 Reverse -84 -103 12.7035 0.213
NP_440473.1_9 Reverse -230 -249 2.65439 0.0985
NP_440473.1_9 Reverse -90 -109 -7.96535 0.241
NP_442509.1_9 Forward -400 -390 10.0093 0.192
NP_442509.1_9 Reverse -383 -393 8.53436 0.192
NP_442509.1_9 Reverse -241 -251 8.14104 0.192
NP_442509.1_9 Forward -250 -240 8.04271 0.192
NP_440554.1_4 Forward -249 -239 15.418 0.0199
NP_440554.1_4 Reverse -88 -98 5.97822 0.128
NP_441885.1_5 Reverse -241 -251 20.9245 0.000538
NP_441885.1_5 Forward -96 -86 18.6629 0.00274
NP_441885.1_5 Forward -250 -240 11.3864 0.00668
NP_441885.1_5 Reverse -87 -97 11.0914 0.00874
NP_440478.1_4 Forward -100 -81 20.4523 0.019
NP_441428.1_8 Forward -258 -239 5.30933 0.228
NP_442341.1_7 Reverse -86 -100 9.2427 0.0751
NP_442341.1_7 Forward -251 -237 9.04604 0.0795
NP_442341.1_7 Reverse -240 -254 5.21113 0.165
NP_442341.1_7 Forward -393 -379 4.52282 0.188
NP_442341.1_7 Forward -97 -83 4.52282 0.188
NP_442341.1_9 Forward -98 -84 9.04542 0.159
NP_441756.1_5 Forward -395 -376 -4.91709 0.297
NP_440423.1_6 Reverse -233 -252 -15.3402 0.229
NP_443000.1_7 Reverse -239 -249 10.7964 0.0345
NP_443000.1_7 Forward -252 -242 10.3048 0.0345
NP_443000.1_7 Forward -98 -88 10.2065 0.0355
NP_443000.1_7 Reverse -85 -95 7.25653 0.0927
NP_441842.1_10 Reverse -234 -248 7.27608 0.264
NP_440275.1_3 Reverse -239 -249 18.6629 0.0082
NP_440275.1_3 Forward -98 -88 12.5664 0.0316
NP_440275.1_3 Reverse -381 -391 8.73149 0.0602
NP_440275.1_3 Forward -252 -242 8.04317 0.0602
NP_442932.1_9 Reverse -235 -254 5.40766 0.266
NP_440560.1_5 Reverse -284 -303 11.7395 0.218
NP_440091.1_1 Reverse -83 -95 4.5622 0.138
NP_440091.1_1 Reverse -237 -249 3.2839 0.163
NP_439962.1_4 Forward -245 -226 -3.24547 0.249
NP_441875.1_10 Reverse -209 -223 12.4876 0.232
NP_441105.1_3 Reverse -230 -249 8.55425 0.0482
NP_441105.1_3 Forward -261 -242 6.58763 0.0592
NP_441105.1_3 Reverse -56 -75 -8.85033 0.279
NP_440216.1_1 Reverse -241 -255 -0.787057 0.0284
NP_440216.1_1 Forward -96 -82 -1.47537 0.0328
NP_440216.1_1 Forward -250 -236 -1.8687 0.0412
NP_440216.1_1 Reverse -87 -101 -2.75368 0.0574
NP_440216.1_1 Reverse -383 -397 -4.22864 0.103
NP_440172.1_1 Forward -250 -240 17.5813 0.00421
NP_440172.1_1 Reverse -241 -251 15.0247 0.00945
NP_440172.1_1 Reverse -87 -97 12.0747 0.0322
NP_440172.1_1 Forward -96 -86 5.28991 0.146
NP_440172.1_1 Forward -392 -382 4.0116 0.208
NP_440249.1_2 Forward -304 -294 15.9091 0.241
NP_440167.1_3 Reverse -373 -392 13.5691 0.182
NP_442015.1_10 Forward -100 -87 11.6223 0.0372
NP_442015.1_10 Reverse -83 -96 7.00078 0.0993
NP_442015.1_10 Forward -254 -241 1.39592 0.204
NP_442015.1_10 Reverse -379 -392 1.19926 0.21
NP_441226.1_7 Forward -249 -242 14.4934 0.0123
NP_441226.1_7 Reverse -242 -249 14.4934 0.0123
NP_441226.1_7 Forward -95 -88 12.7234 0.0312
NP_441226.1_7 Reverse -88 -95 11.5435 0.0757
NP_441226.1_7 Forward -382 -375 7.1186 0.218
NP_441111.1_7 Forward -249 -241 18.7023 0.00294
NP_441111.1_7 Reverse -242 -250 18.7023 0.00294
NP_441111.1_7 Forward -95 -87 8.96754 0.0463
NP_441111.1_7 Reverse -88 -96 8.86921 0.0589
NP_441111.1_7 Forward -391 -383 -0.472234 0.131
NP_441111.1_7 Reverse -384 -392 -0.668896 0.274
NP_442379.1_10 Reverse -234 -251 -1.53445 0.223
NP_441766.1_2 Forward -250 -241 17.5026 0.00297
NP_441766.1_2 Reverse -241 -250 17.5026 0.00297
NP_441766.1_2 Reverse -87 -96 13.9627 0.0114
NP_441766.1_2 Forward -96 -87 7.76787 0.0714
NP_441766.1_2 Forward -392 -383 4.62128 0.172
NP_441766.1_2 Forward -383 -374 2.16301 0.262
NP_442417.1_5 Reverse -337 -351 6.88276 0.201
NP_440416.1_1 Forward -400 -381 -14.0619 0.284
NP_440416.1_1 Forward -250 -231 -14.4552 0.288
NP_440416.1_9 Forward -103 -84 -6.98204 0.0951
NP_440416.1_9 Forward -245 -226 -17.1101 0.231
NP_440416.1_9 Reverse -80 -99 -17.7985 0.247
NP_440416.1_9 Forward -238 -219 -19.4701 0.275
NP_443052.1_8 Reverse -77 -96 -7.86702 0.164
NP_443052.1_8 Reverse -231 -250 -9.63698 0.193
NP_442226.1_8 Reverse -141 -151 13.0581 0.274
NP_440261.1_5 Reverse -242 -255 -0.865694 0.0655
NP_440261.1_5 Forward -249 -236 -1.16069 0.0662
NP_440261.1_5 Reverse -88 -101 -4.89726 0.178
NP_440261.1_5 Forward -391 -378 -10.5021 0.201
NP_440261.1_5 Forward -95 -82 -12.4687 0.297
NP_440988.1_10 Reverse -85 -99 13.8056 0.159
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGTAATCGGGCGGTCACCCCGGTCGGTAAAACTATACATTTCCTTCCCCACCACATCTGTGGCTTCCCCAATACCCCGCTCAAACAGGGAAGTCTGCTCAAAAATTGGGGTGCGAATTTCTTGATACAAAGCCCGGTCTAAAATGCTTTTGGCGATCGCCTCTACCCACTGCCAGTAGTTGGTTTCCGGGGGCAAAATGTCACGGGTTCCACGAATGGCTTGGATAGCTCCCATAGTTCGGCTCAGTTCCTGTCAAACAAATACGTTCCTAACCTTAGCGGATTCCGAGGACCCATTGCTCCCTGGCGATCGGCATCTGCACCAAGAAAAGGCTTAGGCTATATTGACTAGGAAAAATCCCCAGATAGGATCTAACCAGCAGTTCTTAATTCAGTAATCC

CDS

ATGCGCAATCCCCTCCGTTGGCTCCAAAATGACGACTTTGCCTATGTTGTCCAGCGGTTGATAGAAGGGCTGATTACCTTATTGCTAGCATCCCTATTAAGCTTTGCCATTGTTCAGCTAGCCCCCGGCAGTTATCTCGACACCCTCCAGCAAAATCCGAAAATTTCCCCAGAAACCCTGCAACAGCTAAAAGTTCAATTTGGCTTGGATCAACCTTGGTATGTGCAATATTGGCGCTGGCTCACCCAAGTGGTGACCCGTTTCAATTTTGGTGAAAGCTTTGTCTATAACCGTTCCGTTGCTTCCCTACTAATAGAACGGATTCCCGCCACCCTACTACTAGCCATAACATCTATCATTCTCACCTGGGCGATCGCCATTCCCTTGGGCATTGTGGGGGCCGTACAGCAAAACACATTCATAGACCGGAGTTTGCGGGTAATCAGCTACATCGGCCAAGGATTTCCTAGTTTTATCACTGCCCTACTTTTATTATTTCTTGCCCAATCCGTTTCACCCCTGTTGCCGGTGGGGGACATGACCAGCATTGATTTTGCCGAATTTTCTTGGCCCCATAAGGTTTGGGACGTGGCTTGGCACATGATTTTACCTACCCTCGCTTTGAGCATCACCAGTTTTGCTGGATTACAAAGGTTGATGCGAGGCCAATTGCTTGATGTGTTGCGCCAGGACTACATTCAAACTGCCAGGGCTAAGGGTTTGCCCGAAAATCGGGTCATTTACGTCCATGCCCTCCGTAATGCCATCAACCCTCTGATCACCATTCTGGGCTTTGAATTTGCTAGCTTACTCAGTGGCGCTTTTATCGCCGAATTTTTCTTTAATTGGCCCGGTTTAGGTCGTCTAATTCTCCAAGCAGTCACCGCCCAGGATCTGTATCTAGTGATGGGCAGTTTAATGATGGGGGCAACTCTCCTCATCGTTGGTAATCTTCTGGCGGACTTACTGCTGAAATTTACCGATCCCCGTATTCAGTTGGCGGATCTGAAATAG

Protein

MRNPLRWLQNDDFAYVVQRLIEGLITLLLASLLSFAIVQLAPGSYLDTLQQNPKISPETLQQLKVQFGLDQPWYVQYWRWLTQVVTRFNFGESFVYNRSVASLLIERIPATLLLAITSIILTWAIAIPLGIVGAVQQNTFIDRSLRVISYIGQGFPSFITALLLLFLAQSVSPLLPVGDMTSIDFAEFSWPHKVWDVAWHMILPTLALSITSFAGLQRLMRGQLLDVLRQDYIQTARAKGLPENRVIYVHALRNAINPLITILGFEFASLLSGAFIAEFFFNWPGLGRLILQAVTAQDLYLVMGSLMMGATLLIVGNLLADLLLKFTDPRIQLADLK