Your browser is old and dusty. Try Google Chrome!

Details for sll0309

ORF sll0309
Accession NP_442106.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -240 -254 13.1759 0.0417
NP_441061.1_2 Reverse -246 -260 11.5043 0.051
NP_441061.1_2 Reverse -357 -371 3.8345 0.159
NP_441061.1_2 Forward -364 -350 1.57289 0.186
NP_440557.1_1 Reverse -246 -265 6.88262 0.148
NP_440795.1_7 Forward -364 -357 14.6904 0.0123
NP_440795.1_7 Reverse -357 -364 14.6904 0.0123
NP_440795.1_7 Forward -253 -246 11.3472 0.0978
NP_441418.1_6 Forward -248 -229 -18.9784 0.0841
NP_441418.1_6 Forward -365 -346 -20.65 0.121
NP_441418.1_6 Reverse -356 -375 -28.6149 0.206
NP_441418.1_6 Forward -260 -241 -28.9099 0.213
NP_441418.1_6 Forward -254 -235 -29.0082 0.215
NP_441418.1_6 Reverse -245 -264 -30.2865 0.267
NP_440897.1_6 Forward -254 -235 7.4718 0.0839
NP_440897.1_6 Forward -365 -346 0.293673 0.18
NP_441453.1_4 Reverse -356 -364 16.539 0.00633
NP_441453.1_4 Forward -365 -357 16.539 0.00633
NP_441453.1_4 Forward -254 -246 7.19758 0.0757
NP_441453.1_4 Forward -248 -240 6.80426 0.121
NP_441453.1_4 Reverse -239 -247 6.11594 0.121
NP_441453.1_4 Reverse -245 -253 4.93597 0.224
NP_441623.1_1 Reverse -363 -381 -2.63579 0.241
NP_442151.1_6 Forward -254 -240 15.2409 0.0251
NP_442151.1_6 Reverse -245 -259 14.0609 0.0406
NP_442151.1_6 Reverse -356 -370 10.9143 0.113
NP_442151.1_6 Forward -365 -351 8.75105 0.164
NP_442151.1_6 Reverse -239 -253 5.70279 0.266
NP_441818.1_1 Reverse -240 -251 14.8078 0.0426
NP_441818.1_1 Forward -364 -353 14.2178 0.0541
NP_440996.1_3 Forward -241 -223 12.9988 0.221
NP_440996.1_4 Forward -387 -377 17.5813 0.15
NP_442173.1_1 Forward -364 -356 15.4574 0.00633
NP_442173.1_1 Reverse -357 -365 15.4574 0.00633
NP_442173.1_1 Reverse -240 -248 12.0158 0.0316
NP_442173.1_1 Reverse -246 -254 5.62429 0.206
NP_442173.1_1 Forward -247 -239 4.83764 0.241
NP_442752.1_4 Forward -365 -358 13.8055 0.0199
NP_442752.1_4 Reverse -356 -363 13.8055 0.0199
NP_442752.1_4 Forward -248 -241 13.8055 0.0199
NP_442752.1_4 Forward -254 -247 10.8555 0.0846
NP_443027.1_4 Reverse -354 -364 7.35486 0.24
NP_442975.1_10 Reverse -352 -366 12.5853 0.0477
NP_442975.1_10 Reverse -241 -255 3.93223 0.249
NP_442975.1_10 Reverse -50 -64 3.53891 0.257
NP_440784.1_7 Forward -364 -357 15.9687 0.0123
NP_440784.1_7 Reverse -357 -364 15.9687 0.0123
NP_440784.1_7 Reverse -246 -253 12.4288 0.0475
NP_440784.1_7 Forward -253 -246 6.23397 0.241
NP_440784.1_7 Forward -247 -240 6.23397 0.241
NP_440784.1_7 Reverse -240 -247 6.13563 0.241
NP_442909.1_7 Reverse -240 -254 20.8451 0.0224
NP_442909.1_7 Reverse -357 -371 10.8154 0.131
NP_442861.1_4 Reverse -208 -227 -1.47628 0.297
NP_440061.1_9 Forward -367 -353 10.422 0.124
NP_440110.1_4 Reverse -234 -253 9.43923 0.125
NP_441476.1_5 Forward -259 -240 -6.98204 0.279
NP_440878.1_4 Reverse -268 -286 10.0489 0.29
NP_441499.1_3 Reverse -370 -380 16.6958 0.28
NP_442062.1_8 Forward -365 -355 17.6796 0.00193
NP_442062.1_8 Reverse -356 -366 17.3846 0.00193
NP_442062.1_8 Reverse -245 -255 4.50326 0.212
NP_441859.1_3 Forward -366 -347 1.37531 0.287
NP_440304.1_4 Reverse -354 -364 18.9579 0.00406
NP_440304.1_4 Forward -367 -357 1.84832 0.299
NP_442242.1_4 Forward -364 -357 14.3954 0.0124
NP_442242.1_4 Reverse -357 -364 14.3954 0.0124
NP_440044.1_8 Forward -364 -345 7.27595 0.0842
NP_440044.1_8 Reverse -240 -259 -4.03212 0.298
NP_441781.1_7 Reverse -239 -258 2.26107 0.21
NP_439918.1_2 Reverse -292 -311 -4.42544 0.277
NP_439918.1_3 Forward -368 -349 4.52268 0.264
NP_439923.1_5 Forward -64 -45 14.8474 0.0917
NP_441208.1_9 Forward -368 -354 6.98109 0.229
NP_442110.1_7 Forward -254 -240 7.76774 0.108
NP_442110.1_7 Reverse -356 -370 1.67122 0.222
NP_442110.1_7 Reverse -239 -253 0.88457 0.245
NP_440856.1_1 Forward -258 -239 -4.72043 0.259
NP_441083.1_5 Reverse -356 -366 20.3345 0.00053
NP_441083.1_5 Forward -365 -355 19.3512 0.000718
NP_441083.1_5 Reverse -239 -249 17.7779 0.00336
NP_441083.1_5 Reverse -245 -255 9.22315 0.0295
NP_441083.1_5 Forward -248 -238 7.05986 0.067
NP_441083.1_5 Forward -254 -244 0.865012 0.218
NP_441738.1_2 Forward -363 -356 15.28 0.0102
NP_441738.1_2 Reverse -358 -365 15.28 0.0102
NP_441738.1_2 Reverse -241 -248 15.28 0.0102
NP_441558.1_5 Reverse -243 -262 8.25926 0.155
NP_441558.1_5 Reverse -354 -373 4.81767 0.269
NP_440209.1_1 Reverse -356 -364 18.1123 0.00295
NP_440209.1_1 Forward -365 -357 18.1123 0.00295
NP_440209.1_1 Forward -248 -240 8.57422 0.0425
NP_440209.1_1 Forward -254 -246 8.37755 0.0576
NP_440209.1_1 Reverse -239 -247 5.52596 0.0821
NP_440209.1_1 Reverse -245 -253 5.32929 0.139
NP_442136.1_4 Forward -246 -227 5.60352 0.295
NP_442889.1_8 Reverse -353 -367 19.1735 0.0084
NP_442889.1_8 Reverse -236 -250 4.22722 0.27
NP_440407.1_6 Forward -246 -232 9.73436 0.299
NP_441770.1_5 Forward -274 -255 -1.86883 0.277
NP_440178.1_7 Reverse -355 -374 -20.2567 0.188
NP_440178.1_7 Reverse -238 -257 -22.9117 0.282
NP_440053.1_2 Forward -190 -171 10.1275 0.291
NP_442570.1_3 Forward -262 -243 -9.53865 0.299
NP_441716.1_1 Forward -254 -240 13.1759 0.0689
NP_441716.1_1 Reverse -356 -370 10.4227 0.0956
NP_441716.1_1 Forward -365 -351 10.226 0.0968
NP_442111.1_4 Forward -366 -352 19.2725 0.00439
NP_442111.1_4 Reverse -355 -369 9.63603 0.0593
NP_442111.1_4 Reverse -238 -252 7.37441 0.0975
NP_442111.1_4 Reverse -244 -258 3.24451 0.253
NP_441624.1_7 Forward -260 -246 11.111 0.213
NP_441163.1_1 Reverse -244 -261 5.44632 0.274
NP_440906.1_5 Forward -364 -357 15.8704 0.0124
NP_440906.1_5 Reverse -357 -364 15.8704 0.0124
NP_440906.1_5 Forward -253 -246 6.23397 0.234
NP_440906.1_5 Forward -247 -240 6.23397 0.234
NP_440906.1_5 Reverse -240 -247 6.13563 0.241
NP_440906.1_5 Reverse -246 -253 6.0373 0.262
NP_442596.1_9 Reverse -207 -226 15.4374 0.25
NP_440747.1_10 Forward -368 -356 24.7201 0.00036
NP_440747.1_10 Forward -257 -245 5.25052 0.0154
NP_440747.1_10 Reverse -353 -365 -2.02597 0.0196
NP_440747.1_10 Forward -251 -239 -11.9574 0.178
NP_440747.1_10 Reverse -242 -254 -12.1541 0.227
NP_442973.1_9 Reverse -369 -386 22.5807 0.0549
NP_441486.1_1 Forward -368 -354 12.8809 0.00979
NP_441486.1_1 Reverse -242 -256 11.7993 0.0143
NP_441486.1_1 Forward -251 -237 5.99778 0.0344
NP_441486.1_1 Reverse -353 -367 5.80112 0.0344
NP_441486.1_1 Forward -257 -243 -5.11362 0.222
NP_442634.1_4 Reverse -354 -368 -2.75368 0.156
NP_440403.1_4 Forward -374 -355 -8.06369 0.251
NP_440842.1_10 Forward -249 -235 2.65453 0.274
NP_440842.1_10 Reverse -353 -367 0.982901 0.296
NP_441014.1_5 Forward -259 -241 10.4422 0.263
NP_441014.1_8 Reverse -232 -251 -6.1954 0.276
NP_442848.1_1 Forward -371 -357 8.55439 0.0791
NP_442848.1_1 Forward -254 -240 6.88276 0.0791
NP_442848.1_1 Reverse -350 -364 -1.47537 0.263
NP_442848.1_1 Reverse -239 -253 -3.83532 0.273
NP_441012.1_4 Reverse -241 -254 6.50913 0.278
NP_443018.1_3 Forward -364 -357 14.8871 0.0123
NP_443018.1_3 Reverse -357 -364 14.8871 0.0123
NP_443018.1_3 Forward -253 -246 13.8055 0.024
NP_443018.1_3 Reverse -246 -253 13.6088 0.0352
NP_443018.1_3 Reverse -240 -247 11.7405 0.0655
NP_443018.1_3 Forward -247 -240 5.44732 0.193
NP_441316.1_7 Reverse -354 -369 4.69978 0.121
NP_441634.1_8 Forward -256 -242 -3.54032 0.295
NP_440376.1_1 Forward -365 -356 19.4693 0.000692
NP_440376.1_1 Reverse -356 -365 19.4693 0.000692
NP_440376.1_1 Forward -254 -245 6.48957 0.0963
NP_440376.1_1 Forward -248 -239 5.99792 0.111
NP_440376.1_1 Reverse -245 -254 -0.196935 0.285
NP_440376.1_1 Reverse -239 -248 -0.196935 0.285
NP_441588.1_4 Reverse -358 -368 9.02648 0.14
NP_442687.1_7 Reverse -355 -365 18.5646 0.0028
NP_442687.1_7 Forward -366 -356 8.92815 0.0994
NP_442687.1_7 Reverse -238 -248 5.97822 0.179
NP_442687.1_7 Reverse -244 -254 4.60159 0.243
NP_441013.1_2 Forward -259 -241 -3.12744 0.289
NP_440042.1_2 Reverse -229 -248 0.884433 0.213
NP_441422.1_7 Reverse -237 -254 -5.76269 0.247
NP_442658.1_1 Reverse -354 -364 14.8275 0.0188
NP_442658.1_1 Forward -367 -357 6.76441 0.214
NP_442658.1_1 Forward -256 -246 5.87944 0.246
NP_440141.1_4 Reverse -242 -261 -5.31042 0.296
NP_441971.1_4 Forward -249 -230 17.7965 0.237
NP_441855.2_4 Reverse -348 -367 12.2225 0.2
NP_442782.1_7 Reverse -348 -367 9.43923 0.133
NP_442782.1_7 Forward -256 -237 2.85105 0.193
NP_442496.1_5 Reverse -75 -93 6.31233 0.283
NP_441414.1_9 Forward -248 -229 1.86774 0.0705
NP_441414.1_9 Reverse -356 -375 -2.36049 0.114
NP_441414.1_9 Forward -365 -346 -6.39206 0.194
NP_441256.1_1 Reverse -242 -261 -5.01543 0.233
NP_442937.1_5 Forward -259 -240 15.1424 0.0621
NP_442937.1_5 Forward -370 -351 14.0608 0.0836
NP_441958.1_5 Reverse -355 -365 20.5312 0.000966
NP_441958.1_5 Forward -366 -356 12.2714 0.00183
NP_441958.1_5 Reverse -238 -248 0.865012 0.12
NP_441958.1_5 Forward -249 -239 0.865012 0.12
NP_441958.1_5 Forward -255 -245 -6.60814 0.283
NP_440450.1_5 Reverse -64 -83 16.7157 0.293
NP_440203.1_5 Reverse -248 -258 16.2041 0.0611
NP_440203.1_5 Reverse -242 -252 14.8275 0.0886
NP_440203.1_5 Reverse -359 -369 14.2375 0.0886
NP_439990.1_5 Forward -370 -357 11.3273 0.128
NP_442690.1_1 Forward -390 -371 -13.4719 0.262
NP_442911.1_2 Reverse -346 -365 13.2741 0.0118
NP_442911.1_2 Forward -375 -356 3.53937 0.0428
NP_442911.1_2 Forward -258 -239 -7.86702 0.221
NP_443055.1_6 Reverse -231 -249 9.75313 0.133
NP_443055.1_6 Forward -268 -250 4.93494 0.181
NP_440993.1_4 Reverse -245 -262 10.4619 0.213
NP_440827.1_3 Forward -259 -240 14.8474 0.186
NP_440138.1_6 Reverse -240 -259 9.24175 0.175
NP_440138.1_6 Forward -364 -345 3.9319 0.24
NP_441913.1_3 Reverse -373 -386 17.4413 0.218
NP_440615.1_2 Forward -380 -361 5.80098 0.296
NP_441099.1_5 Reverse -346 -365 -0.885524 0.1
NP_441099.1_5 Reverse -229 -248 -2.85214 0.127
NP_441099.1_5 Forward -375 -356 -8.35868 0.193
NP_442002.1_9 Reverse -355 -362 14.1004 0.074
NP_442002.1_9 Forward -241 -234 11.1505 0.185
NP_441712.1_1 Reverse -282 -301 9.23101 0.289
NP_441294.1_7 Reverse -241 -255 10.0185 0.213
NP_441646.1_1 Forward -261 -242 2.0644 0.221
NP_442438.1_10 Forward -370 -356 0.88457 0.213
NP_442438.1_10 Forward -253 -239 -0.983719 0.287
NP_441000.1_6 Reverse -238 -252 -5.31028 0.273
NP_440484.1_3 Reverse -281 -295 8.84938 0.281
NP_441674.1_2 Reverse -163 -182 4.916 0.299
NP_440147.1_4 Forward -367 -354 11.6223 0.0326
NP_440147.1_4 Reverse -354 -367 4.05085 0.173
NP_441175.1_7 Reverse -356 -375 17.5024 0.0564
NP_441175.1_7 Forward -248 -229 5.80098 0.271
NP_441550.1_8 Reverse -354 -364 15.4175 0.0132
NP_441550.1_8 Forward -367 -357 14.6309 0.0132
NP_441550.1_8 Reverse -237 -247 13.0576 0.0273
NP_441550.1_8 Forward -250 -240 11.091 0.0555
NP_441550.1_8 Reverse -243 -253 5.58445 0.242
NP_441550.1_8 Forward -256 -246 4.89613 0.281
NP_441916.1_7 Forward -365 -355 16.893 0.00407
NP_441916.1_7 Reverse -356 -366 10.3048 0.0261
NP_441041.1_4 Reverse -356 -375 -10.6203 0.235
NP_441041.1_4 Forward -260 -241 -11.5053 0.248
NP_441041.1_7 Forward -368 -356 8.58373 0.133
NP_441041.1_7 Forward -184 -172 7.90349 0.154
NP_440569.1_7 Reverse -239 -258 8.55425 0.286
NP_441547.1_2 Forward -259 -241 13.4905 0.0966
NP_441547.1_2 Reverse -345 -363 4.44404 0.249
NP_442004.1_6 Reverse -239 -253 13.1759 0.0937
NP_442004.1_6 Reverse -245 -259 7.27608 0.161
NP_442004.1_6 Reverse -356 -370 5.70279 0.184
NP_442004.1_6 Forward -365 -351 2.16287 0.273
NP_441725.1_4 Reverse -351 -365 9.04542 0.178
NP_441725.1_4 Forward -370 -356 3.53891 0.278
NP_441725.1_5 Forward -364 -354 21.0229 0.00533
NP_441725.1_5 Reverse -357 -367 2.04498 0.115
NP_441725.1_5 Reverse -240 -250 1.455 0.135
NP_441725.1_5 Forward -253 -243 0.0783647 0.215
NP_441725.1_5 Forward -247 -237 0.0783647 0.215
NP_441725.1_5 Reverse -246 -256 -0.511621 0.26
NP_439966.1_7 Reverse -243 -253 12.8609 0.0347
NP_439966.1_7 Reverse -354 -364 9.12434 0.119
NP_439966.1_7 Forward -367 -357 7.25606 0.15
NP_439966.1_7 Forward -250 -240 6.0761 0.195
NP_442941.1_3 Forward -364 -354 11.3864 0.0116
NP_442941.1_3 Reverse -357 -367 11.0914 0.0116
NP_442941.1_3 Reverse -240 -250 10.1081 0.024
NP_442941.1_3 Reverse -246 -256 1.25834 0.15
NP_442941.1_3 Forward -253 -243 0.766681 0.171
NP_440289.1_2 Reverse -353 -366 13.0973 0.0132
NP_440289.1_2 Forward -368 -355 -2.144 0.251
NP_440289.1_2 Forward -251 -238 -4.30728 0.286
NP_440983.1_5 Reverse -239 -258 -4.03212 0.251
NP_440260.1_8 Forward -263 -245 -2.83245 0.246
NP_441514.1_1 Forward -282 -272 13.7721 0.284
NP_442281.1_1 Forward -370 -356 18.2885 0.00454
NP_442281.1_1 Reverse -351 -365 12.2903 0.0385
NP_442281.1_1 Forward -259 -245 4.22722 0.203
NP_442281.1_1 Reverse -157 -171 3.04726 0.246
NP_442281.1_1 Reverse -234 -248 2.35894 0.269
NP_441079.1_3 Reverse -322 -341 11.5042 0.267
NP_442256.1_2 Reverse -354 -372 -7.84733 0.215
NP_442256.1_2 Reverse -237 -255 -7.84733 0.215
NP_442256.1_2 Forward -256 -238 -9.91228 0.299
NP_001035871.2_2 Forward -283 -264 14.287 0.296
NP_442012.1_1 Forward -371 -352 11.4058 0.0742
NP_442012.1_1 Reverse -350 -369 -0.000545616 0.249
NP_441556.1_10 Reverse -240 -254 10.4165 0.27
NP_442982.1_5 Forward -375 -356 -3.44213 0.298
NP_441196.1_8 Forward -300 -281 5.40766 0.23
NP_441644.1_6 Reverse -356 -366 17.3841 0.00127
NP_441644.1_6 Forward -365 -355 15.7125 0.0048
NP_441644.1_6 Reverse -239 -249 14.4342 0.0126
NP_441644.1_6 Reverse -245 -255 12.9592 0.0265
NP_441644.1_6 Forward -254 -244 11.9759 0.0408
NP_443049.1_6 Forward -249 -239 14.4711 0.114
NP_443049.1_6 Forward -255 -245 14.2759 0.126
NP_442215.1_2 Forward -367 -351 8.02334 0.0666
NP_442215.1_2 Reverse -354 -370 -2.10475 0.192
NP_442215.1_2 Reverse -243 -259 -3.28472 0.213
NP_442215.1_2 Forward -256 -240 -3.48138 0.216
NP_442215.1_2 Forward -26 -10 -4.56302 0.235
NP_442029.1_6 Forward -259 -240 16.4207 0.0997
NP_442247.1_8 Forward -367 -353 10.9143 0.247
NP_442247.1_10 Forward -269 -250 17.8957 0.181
NP_440253.1_2 Forward -365 -347 13.0972 0.0244
NP_440253.1_2 Reverse -356 -374 -3.71743 0.3
NP_440929.1_8 Forward -365 -356 19.2726 0.000701
NP_440929.1_8 Reverse -356 -365 19.2726 0.000701
NP_440929.1_8 Reverse -239 -248 7.07956 0.0713
NP_442933.1_10 Forward -365 -356 17.601 0.00325
NP_442933.1_10 Reverse -356 -365 17.601 0.00325
NP_442933.1_10 Forward -254 -245 5.70292 0.165
NP_441751.2_8 Reverse -357 -371 -0.885388 0.129
NP_441751.2_8 Forward -364 -350 -2.26202 0.132
NP_441751.2_8 Reverse -240 -254 -2.75368 0.133
NP_442554.1_4 Forward -279 -260 11.7992 0.246
NP_442554.1_8 Reverse -357 -367 15.3197 0.00882
NP_442554.1_8 Forward -364 -354 14.828 0.0108
NP_442554.1_8 Reverse -246 -256 14.238 0.0144
NP_442554.1_8 Reverse -240 -250 6.07655 0.126
NP_442554.1_8 Forward -253 -243 5.28991 0.153
NP_442554.1_8 Forward -247 -237 2.33998 0.274
NP_442970.1_1 Forward -276 -262 10.6112 0.269
NP_441762.1_7 Reverse -355 -367 8.9871 0.0142
NP_441762.1_7 Forward -366 -354 -6.94252 0.284
NP_441762.1_7 Forward -249 -237 -7.33585 0.287
NP_442313.1_5 Reverse -246 -265 5.11266 0.259
NP_442142.1_4 Reverse -242 -255 8.77016 0.108
NP_442142.1_4 Forward -257 -244 7.68852 0.132
NP_442142.1_4 Reverse -248 -261 6.90188 0.153
NP_442142.1_4 Reverse -353 -366 5.91857 0.178
NP_442142.1_4 Forward -368 -355 5.52525 0.188
NP_442292.1_1 Reverse -357 -366 18.486 0.00229
NP_442292.1_1 Reverse -246 -255 15.536 0.0107
NP_442292.1_1 Forward -364 -355 9.53783 0.0183
NP_442292.1_1 Reverse -240 -249 8.65285 0.0335
NP_442292.1_1 Forward -253 -244 -0.0986038 0.239
NP_442476.1_6 Forward -364 -350 0.88457 0.238
NP_442016.1_10 Forward -394 -375 6.39097 0.27
NP_442381.1_8 Reverse -228 -247 -13.8652 0.28
NP_443009.1_5 Forward -366 -355 15.7911 0.0107
NP_443009.1_5 Reverse -355 -366 11.1696 0.066
NP_443009.1_5 Forward -172 -161 8.71129 0.102
NP_441715.1_4 Reverse -357 -367 7.94484 0.107
NP_441715.1_4 Forward -364 -354 7.25653 0.108
NP_441715.1_4 Reverse -240 -250 4.99491 0.24
NP_440279.1_2 Forward -62 -43 13.4708 0.0927
NP_441198.1_8 Reverse -354 -364 13.076 0.108
NP_440379.1_5 Reverse -242 -261 -4.42544 0.215
NP_440464.1_10 Reverse -357 -367 13.0082 0.169
NP_440464.1_10 Reverse -246 -256 12.3397 0.233
NP_441468.1_1 Forward -364 -357 15.8704 0.0124
NP_441468.1_1 Reverse -357 -364 15.8704 0.0124
NP_441468.1_1 Forward -253 -246 13.8055 0.0242
NP_441468.1_1 Forward -247 -240 6.13563 0.209
NP_441468.1_1 Reverse -246 -253 6.0373 0.223
NP_441468.1_1 Reverse -240 -247 6.0373 0.223
NP_441020.2_6 Forward -250 -233 13.5102 0.0723
NP_441020.2_6 Reverse -354 -371 10.1669 0.151
NP_441020.2_6 Forward -367 -350 8.00365 0.212
NP_441015.1_10 Forward -259 -240 14.8474 0.0507
NP_441015.1_10 Forward -253 -234 -11.5053 0.298
NP_441673.1_1 Forward -365 -356 20.8459 0.000698
NP_441673.1_1 Reverse -356 -365 20.8459 0.000698
NP_441673.1_1 Forward -254 -245 1.37636 0.114
NP_441673.1_1 Forward -248 -239 1.37636 0.114
NP_441673.1_1 Reverse -245 -254 1.1797 0.163
NP_441673.1_1 Reverse -239 -248 1.1797 0.163
NP_441731.1_3 Forward -256 -237 -5.60541 0.284
NP_441826.1_2 Reverse -239 -253 12.3893 0.0284
NP_441826.1_2 Forward -371 -357 11.5043 0.0358
NP_441826.1_2 Forward -254 -240 4.12949 0.105
NP_441826.1_2 Reverse -350 -364 3.04785 0.115
NP_442490.1_9 Reverse -344 -363 1.76941 0.165
NP_442868.1_6 Forward -367 -357 9.81313 0.038
NP_442868.1_6 Reverse -354 -364 9.22315 0.0527
NP_442868.1_6 Forward -250 -240 0.176696 0.247
NP_442868.1_6 Forward -256 -246 0.0783647 0.248
NP_442868.1_6 Reverse -243 -253 -0.0199663 0.255
NP_442719.1_2 Reverse -127 -145 -8.43801 0.249
NP_442719.1_2 Forward -277 -259 -11.7812 0.296
NP_441056.1_1 Reverse -239 -258 0.786102 0.153
NP_441612.1_2 Reverse -356 -366 8.54929 0.21
NP_442361.1_3 Forward -371 -358 12.2123 0.208
NP_442427.1_8 Reverse -230 -249 6.78429 0.23
NP_441911.1_7 Reverse -51 -70 -19.0774 0.275
NP_442808.1_1 Reverse -238 -248 9.71433 0.0481
NP_442808.1_1 Reverse -355 -365 8.73102 0.0481
NP_442808.1_1 Forward -366 -356 8.63269 0.0481
NP_442808.1_1 Reverse -244 -254 6.46942 0.112
NP_442808.1_1 Reverse -171 -181 5.48612 0.151
NP_440145.1_3 Forward -375 -356 18.3873 0.00887
NP_442542.1_2 Reverse -237 -250 6.21414 0.232
NP_442050.1_5 Reverse -354 -364 15.8108 0.0091
NP_442050.1_5 Forward -367 -357 7.64939 0.243
NP_442050.1_5 Forward -250 -240 6.76441 0.282
NP_441114.1_3 Forward -400 -391 8.25953 0.231
NP_441114.1_3 Reverse -163 -172 6.29291 0.285
NP_440558.1_2 Reverse -347 -366 7.07928 0.124
NP_442724.1_1 Forward -277 -267 15.9097 0.278
NP_441878.1_6 Reverse -355 -365 20.2362 0.0046
NP_441878.1_6 Forward -366 -356 10.4031 0.0176
NP_441878.1_6 Forward -255 -245 1.65166 0.0795
NP_441878.1_6 Reverse -238 -248 0.57002 0.14
NP_441878.1_6 Reverse -244 -254 -0.41329 0.177
NP_441036.1_8 Reverse -355 -365 8.4365 0.174
NP_441036.1_8 Forward -366 -356 8.33817 0.174
NP_442650.1_2 Reverse -356 -370 8.16106 0.13
NP_442650.1_2 Reverse -245 -259 6.09611 0.134
NP_442650.1_2 Reverse -239 -253 2.75286 0.246
NP_441557.1_5 Forward -365 -356 19.9609 0.000699
NP_441557.1_5 Reverse -356 -365 19.9609 0.000699
NP_441557.1_5 Forward -254 -245 1.08137 0.0794
NP_441557.1_5 Forward -248 -239 1.08137 0.0794
NP_441557.1_5 Reverse -245 -254 0.589713 0.134
NP_441557.1_5 Reverse -239 -248 0.589713 0.134
NP_441445.1_1 Forward -263 -244 4.32602 0.195
NP_442267.1_6 Reverse -345 -364 19.0757 0.121
NP_442066.2_4 Forward -394 -375 -8.752 0.296
NP_442066.2_4 Forward -228 -209 -9.24366 0.296
NP_440101.1_10 Forward -260 -241 8.94757 0.171
NP_441458.1_10 Forward -263 -244 14.3558 0.0856
NP_442192.1_7 Forward -242 -224 15.8504 0.229
NP_442183.1_1 Forward -365 -351 20.6491 0.00378
NP_442183.1_1 Forward -248 -234 9.14437 0.101
NP_442183.1_1 Reverse -356 -370 7.47274 0.141
NP_442166.1_7 Reverse -246 -260 9.83269 0.19
NP_441459.1_8 Reverse -349 -362 15.0639 0.286
NP_441819.1_5 Forward -281 -262 10.7424 0.261
NP_439980.1_1 Forward -259 -240 17.0844 0.263
NP_441574.1_1 Reverse -327 -346 -1.08219 0.212
NP_442347.1_2 Reverse -357 -366 12.4878 0.056
NP_442347.1_2 Reverse -240 -249 10.3245 0.058
NP_442347.1_2 Forward -364 -355 3.34298 0.284
NP_442645.1_2 Forward -373 -354 -13.7669 0.164
NP_441411.1_3 Forward -140 -121 8.35759 0.148
NP_441037.1_4 Reverse -354 -364 9.65667 0.21
NP_441037.1_4 Forward -367 -357 7.9999 0.237
NP_441037.1_4 Forward -256 -246 6.73295 0.245
NP_442594.1_7 Forward -376 -357 6.29183 0.211
NP_441633.1_3 Forward -367 -354 10.5407 0.0286
NP_440136.1_2 Forward -364 -357 15.9687 0.0123
NP_440136.1_2 Reverse -357 -364 15.9687 0.0123
NP_440136.1_2 Forward -253 -246 6.52896 0.116
NP_440136.1_2 Forward -247 -240 6.23397 0.171
NP_440136.1_2 Reverse -246 -253 6.13563 0.193
NP_440136.1_2 Reverse -240 -247 6.13563 0.193
NP_442590.1_10 Reverse -239 -258 14.3558 0.123
NP_442998.1_5 Reverse -268 -278 9.02648 0.256
NP_442998.1_10 Forward -363 -356 15.5754 0.0102
NP_442998.1_10 Reverse -358 -365 15.5754 0.0102
NP_442998.1_10 Reverse -241 -248 15.5754 0.0102
NP_442998.1_10 Reverse -247 -254 6.13563 0.181
NP_440899.1_8 Forward -398 -379 -9.34199 0.262
NP_440299.1_1 Forward -369 -356 22.3398 0.000547
NP_440299.1_1 Reverse -352 -365 19.4882 0.00234
NP_440299.1_1 Reverse -241 -254 9.45847 0.0709
NP_440299.1_1 Forward -258 -245 4.24695 0.213
NP_440299.1_1 Forward -232 -219 2.18201 0.294
NP_441799.1_1 Reverse -235 -249 9.83206 0.0838
NP_441799.1_1 Reverse -352 -366 4.42388 0.25
NP_441799.1_1 Reverse -241 -255 4.22722 0.261
NP_441007.1_10 Forward -259 -246 0.314277 0.233
NP_441007.1_10 Reverse -351 -364 -0.865694 0.295
NP_441007.1_10 Forward -370 -357 -0.964025 0.296
NP_442201.1_10 Reverse -345 -364 -6.29373 0.184
NP_440256.1_1 Forward -368 -349 12.6841 0.0114
NP_440256.1_1 Forward -257 -238 -9.93197 0.291
NP_441559.1_8 Forward -370 -356 -6.78525 0.279
NP_440915.1_6 Forward -369 -355 11.5043 0.0256
NP_440915.1_6 Reverse -352 -366 5.40779 0.0903
NP_440915.1_6 Forward -252 -238 2.2612 0.121
NP_440915.1_6 Forward -258 -244 1.47456 0.138
NP_442158.1_4 Reverse -108 -118 11.3864 0.278
NP_441866.1_4 Forward -167 -154 12.564 0.282
NP_441704.1_8 Forward -265 -246 6.48849 0.262
NP_440134.1_2 Forward -250 -231 5.40766 0.298
NP_442452.1_8 Reverse -239 -253 12.3887 0.273
NP_440748.1_5 Reverse -242 -261 1.96607 0.224
NP_440695.1_6 Forward -112 -98 10.4114 0.265
NP_441939.1_3 Reverse -246 -265 8.16093 0.18
NP_439985.1_7 Reverse -239 -258 11.0125 0.18
NP_442386.1_9 Reverse -244 -253 14.3556 0.0289
NP_442386.1_9 Forward -366 -357 13.8639 0.0289
NP_442386.1_9 Forward -255 -246 11.799 0.0835
NP_442386.1_9 Reverse -171 -180 10.324 0.132
NP_442386.1_9 Reverse -250 -259 10.2257 0.136
NP_442386.1_9 Reverse -355 -364 6.39082 0.219
NP_442386.1_9 Forward -261 -252 4.62087 0.294
NP_442386.1_9 Reverse -238 -247 4.52254 0.297
NP_441340.1_5 Forward -364 -357 15.6737 0.0124
NP_441340.1_5 Reverse -357 -364 15.6737 0.0124
NP_441340.1_5 Forward -247 -240 13.5105 0.0314
NP_441340.1_5 Reverse -246 -253 13.5105 0.0314
NP_441340.1_5 Forward -253 -246 6.23397 0.132
NP_441340.1_5 Reverse -240 -247 5.84064 0.208
NP_442327.1_5 Forward -315 -297 18.5344 0.248
NP_442484.1_2 Forward -265 -246 1.47442 0.233
NP_442484.1_2 Reverse -240 -259 -1.37718 0.288
NP_440168.1_2 Forward -262 -243 5.211 0.258
NP_440168.1_4 Reverse -235 -254 -7.67036 0.291
NP_442240.1_2 Reverse -357 -376 -10.1286 0.137
NP_440586.1_8 Forward -364 -357 13.2151 0.026
NP_440586.1_8 Reverse -357 -364 13.2151 0.026
NP_440586.1_8 Reverse -246 -253 11.3468 0.0736
NP_440586.1_8 Forward -253 -246 9.47853 0.146
NP_440586.1_8 Reverse -240 -247 9.47853 0.146
NP_440586.1_8 Forward -247 -240 5.74197 0.283
NP_442251.1_6 Forward -364 -357 15.2804 0.0124
NP_442251.1_6 Reverse -357 -364 15.2804 0.0124
NP_440684.1_9 Forward -371 -357 8.65272 0.225
NP_441262.1_3 Reverse -356 -363 14.7888 0.0223
NP_441262.1_3 Forward -365 -358 14.7888 0.0223
NP_441262.1_3 Forward -248 -241 14.7888 0.0223
NP_441262.1_3 Forward -254 -247 5.25066 0.215
NP_443051.1_1 Reverse -355 -364 18.0926 0.00402
NP_443051.1_1 Forward -366 -357 10.4228 0.00754
NP_443051.1_1 Forward -249 -240 7.47288 0.0571
NP_443051.1_1 Forward -255 -246 0.688044 0.134
NP_443051.1_1 Reverse -238 -247 -1.18024 0.297
NP_441232.1_10 Reverse -345 -364 2.85105 0.239
NP_439937.1_9 Forward -366 -349 -7.13998 0.157
NP_439937.1_9 Reverse -238 -255 -9.40158 0.188
NP_439937.1_9 Reverse -160 -177 -14.9081 0.287
NP_442294.1_3 Reverse -258 -272 14.4536 0.239
NP_440626.1_1 Forward -247 -228 9.83173 0.256
NP_440439.1_1 Forward -368 -355 2.2809 0.136
NP_440439.1_1 Forward -251 -238 1.10092 0.162
NP_439943.1_7 Reverse -240 -259 3.04771 0.29
NP_440372.1_2 Forward -364 -357 16.3621 0.0124
NP_440372.1_2 Reverse -357 -364 16.3621 0.0124
NP_440372.1_2 Forward -247 -240 13.8055 0.0214
NP_440372.1_2 Forward -253 -246 6.62729 0.151
NP_440372.1_2 Reverse -246 -253 6.52896 0.188
NP_440372.1_2 Reverse -240 -247 6.52896 0.188
NP_440819.1_5 Forward -217 -209 7.98423 0.228
NP_440316.1_10 Forward -255 -245 7.84651 0.245
NP_442663.1_1 Reverse -42 -61 14.1583 0.116
NP_441803.1_2 Forward -259 -240 1.76941 0.226
NP_441803.1_2 Reverse -240 -259 0.884433 0.243
NP_439977.1_5 Forward -371 -352 4.32602 0.153
NP_439977.1_7 Forward -376 -357 15.0432 0.262
NP_440139.1_1 Reverse -350 -369 10.9134 0.0874
NP_440139.1_1 Forward -246 -227 1.96529 0.242
NP_441572.1_7 Reverse -350 -369 -3.63879 0.217
NP_442384.1_10 Forward -365 -352 18.3088 0.00492
NP_442384.1_10 Reverse -356 -369 17.4239 0.00585
NP_442384.1_10 Forward -254 -241 8.47575 0.0656
NP_442384.1_10 Reverse -239 -252 6.90245 0.092
NP_440364.1_2 Forward -259 -240 14.6161 0.278
NP_440364.1_6 Forward -261 -248 14.7683 0.275
NP_441018.1_7 Forward -258 -239 11.4058 0.185
NP_441018.1_7 Forward -369 -350 7.27595 0.273
NP_441018.1_7 Forward -55 -36 6.4893 0.286
NP_442790.1_4 Forward -257 -238 -15.9302 0.3
NP_442262.1_10 Forward -364 -357 14.1988 0.0123
NP_442262.1_10 Reverse -357 -364 14.1988 0.0123
NP_442262.1_10 Reverse -240 -247 13.2155 0.0213
NP_442262.1_10 Forward -253 -246 13.0188 0.0314
NP_442262.1_10 Reverse -246 -253 11.6422 0.092
NP_441689.1_5 Forward -250 -240 12.7626 0.113
NP_441689.1_5 Reverse -354 -364 8.63269 0.132
NP_441689.1_5 Forward -367 -357 5.78111 0.197
NP_440344.1_10 Reverse -349 -366 18.6234 0.00244
NP_440344.1_10 Reverse -232 -249 -5.56602 0.107
NP_440344.1_10 Forward -261 -244 -12.1542 0.243
NP_442910.1_1 Forward -372 -353 3.53937 0.118
NP_442910.1_1 Reverse -349 -368 -5.21209 0.254
NP_440562.1_10 Forward -374 -356 5.42735 0.289
NP_441965.1_3 Reverse -346 -365 8.94757 0.121
NP_441965.1_3 Forward -258 -239 7.66927 0.134
NP_441965.1_10 Reverse -353 -369 12.8416 0.105
NP_441965.1_10 Reverse -242 -258 9.98996 0.111
NP_441640.1_8 Reverse -240 -259 0.294447 0.194
NP_441640.1_8 Forward -259 -240 -4.52377 0.266
NP_441640.1_8 Forward -253 -234 -4.81876 0.269
NP_440297.1_9 Forward -364 -354 19.0562 0.0359
NP_440297.1_9 Forward -253 -243 0.57002 0.282
NP_440297.1_9 Reverse -246 -256 0.176696 0.282
NP_440297.1_9 Reverse -357 -367 -0.118297 0.282
NP_440297.1_9 Reverse -240 -250 -0.511621 0.289
NP_442187.1_3 Forward -249 -239 15.6147 0.105
NP_442187.1_3 Forward -255 -245 13.8447 0.241
NP_441592.1_4 Forward -254 -235 -3.93378 0.292
NP_440894.1_10 Reverse -234 -253 5.50599 0.229
NP_441894.1_1 Forward -221 -202 12.6841 0.0265
NP_440999.1_9 Forward -369 -355 0.982901 0.172
NP_440999.1_9 Reverse -241 -255 0.0979218 0.193
NP_440888.1_2 Reverse -239 -253 14.7486 0.0152
NP_440888.1_2 Forward -365 -351 9.73373 0.116
NP_440888.1_2 Reverse -356 -370 8.06211 0.172
NP_440888.1_2 Reverse -245 -259 6.48882 0.232
NP_440600.1_4 Reverse -231 -249 -3.6191 0.237
NP_440491.1_1 Reverse -242 -261 7.79413 0.258
NP_442225.1_10 Forward -264 -245 6.58682 0.282
NP_441123.1_4 Reverse -239 -253 17.8952 0.221
NP_441123.1_6 Forward -373 -355 11.6222 0.168
NP_440575.1_8 Forward -270 -251 -5.01543 0.27
NP_442077.1_9 Forward -398 -379 9.63589 0.0864
NP_441543.1_2 Reverse -357 -366 16.9127 0.00359
NP_441543.1_2 Reverse -246 -255 14.651 0.0119
NP_441543.1_2 Forward -364 -355 9.34117 0.0818
NP_441543.1_2 Reverse -240 -249 7.07956 0.131
NP_442845.1_2 Forward -254 -240 19.0758 0.0608
NP_442845.1_2 Forward -260 -246 7.37441 0.195
NP_442845.1_2 Reverse -239 -253 5.30946 0.237
NP_442845.1_2 Reverse -350 -364 4.22782 0.264
NP_442845.1_2 Forward -371 -357 4.03116 0.271
NP_441918.1_7 Reverse -355 -374 -0.4922 0.297
NP_441258.1_9 Reverse -242 -261 9.0459 0.234
NP_441469.1_8 Reverse -355 -364 13.3727 0.073
NP_441469.1_8 Forward -366 -357 6.48957 0.227
NP_441469.1_8 Forward -255 -246 5.3096 0.277
NP_443064.1_6 Forward -365 -355 13.8273 0.0796
NP_443064.1_6 Reverse -356 -366 12.5669 0.0796
NP_442578.1_7 Forward -364 -357 14.5921 0.026
NP_442578.1_7 Reverse -357 -364 14.5921 0.026
NP_442578.1_7 Forward -247 -240 6.0373 0.18
NP_441462.1_2 Forward -365 -355 20.1379 0.000967
NP_441462.1_2 Forward -248 -238 16.1063 0.00406
NP_441462.1_2 Reverse -356 -366 11.5831 0.00406
NP_441462.1_2 Forward -254 -244 -0.41329 0.225
NP_441621.1_7 Reverse -354 -368 -4.7203 0.242
NP_441929.1_3 Forward -113 -94 11.7008 0.165
NP_443062.1_1 Reverse -239 -257 3.57305 0.293
NP_443062.1_1 Reverse -356 -374 3.37804 0.3
NP_443062.1_6 Forward -373 -354 12.9791 0.0924
NP_440519.1_2 Reverse -101 -120 12.1925 0.194
NP_442204.1_1 Forward -258 -247 9.69511 0.0736
NP_442204.1_1 Forward -369 -358 8.7118 0.0852
NP_442204.1_1 Forward -252 -241 7.92515 0.108
NP_442204.1_1 Reverse -352 -363 0.353664 0.281
NP_442204.1_2 Forward -258 -239 6.98095 0.287
NP_442204.1_5 Reverse -235 -254 0.491109 0.261
NP_441560.1_10 Reverse -348 -367 6.39097 0.291
NP_440544.1_5 Forward -317 -310 13.8024 0.28
NP_440544.1_5 Reverse -207 -214 13.8024 0.28
NP_440516.1_2 Forward -19 -1 -0.669169 0.261
NP_440516.1_6 Reverse -230 -244 8.84875 0.246
NP_440516.1_8 Forward -248 -239 18.9776 0.00442
NP_440516.1_8 Forward -365 -356 16.9127 0.00442
NP_440516.1_8 Reverse -356 -365 16.9127 0.00442
NP_440516.1_8 Forward -254 -245 9.24284 0.0264
NP_440516.1_8 Reverse -239 -248 5.01461 0.118
NP_442428.1_5 Forward -364 -357 15.8704 0.0124
NP_442428.1_5 Reverse -357 -364 15.8704 0.0124
NP_442428.1_5 Forward -253 -246 14.1988 0.0242
NP_442428.1_5 Forward -247 -240 6.13563 0.209
NP_442428.1_5 Reverse -246 -253 6.0373 0.212
NP_442428.1_5 Reverse -240 -247 6.0373 0.212
NP_440673.1_2 Reverse -346 -365 9.12141 0.257
NP_440673.1_3 Forward -363 -356 12.4288 0.0426
NP_440673.1_3 Reverse -358 -365 12.4288 0.0426
NP_440673.1_3 Reverse -241 -248 12.4288 0.0426
NP_440673.1_3 Reverse -247 -254 11.6422 0.0724
NP_440673.1_3 Forward -400 -393 6.72562 0.277
NP_443048.1_9 Forward -323 -309 18.9518 0.0664
NP_441052.1_2 Reverse -356 -366 19.9412 0.00106
NP_441052.1_2 Reverse -245 -255 17.4829 0.00452
NP_441052.1_2 Reverse -239 -249 10.6981 0.0285
NP_441052.1_2 Forward -365 -355 10.4031 0.0285
NP_441052.1_2 Forward -254 -244 7.05986 0.0818
NP_442219.1_8 Reverse -241 -260 8.65027 0.241
NP_442219.1_9 Reverse -357 -366 17.7976 0.00718
NP_442219.1_9 Forward -253 -244 8.65285 0.0681
NP_442219.1_9 Forward -364 -355 8.25953 0.0681
NP_442219.1_9 Reverse -246 -255 7.96454 0.0696
NP_442219.1_9 Reverse -240 -249 7.96454 0.0696
NP_440436.1_4 Reverse -357 -366 17.2072 0.00233
NP_440436.1_4 Forward -364 -355 15.9289 0.00508
NP_440436.1_4 Reverse -246 -255 14.2573 0.0147
NP_440436.1_4 Reverse -240 -249 7.57079 0.124
NP_441884.1_9 Forward -257 -238 -21.83 0.266
NP_441884.1_9 Reverse -353 -372 -25.4683 0.29
NP_440314.1_9 Forward -364 -345 3.53937 0.0849
NP_441719.1_4 Forward -364 -357 16.3621 0.0124
NP_441719.1_4 Reverse -357 -364 16.3621 0.0124
NP_441719.1_4 Forward -247 -240 6.82395 0.0855
NP_441719.1_4 Forward -253 -246 6.62729 0.151
NP_441719.1_4 Reverse -246 -253 6.52896 0.188
NP_441719.1_4 Reverse -240 -247 6.52896 0.188
NP_441733.1_10 Forward -368 -355 5.62415 0.21
NP_441004.1_1 Forward -260 -241 -15.6352 0.276
NP_441004.1_1 Reverse -350 -369 -16.8151 0.287
NP_441004.1_2 Forward -250 -231 -0.885524 0.259
NP_442366.1_3 Reverse -355 -373 13.0972 0.0272
NP_442366.1_3 Reverse -238 -256 -5.09406 0.281
NP_442366.1_5 Forward -368 -358 14.0409 0.0497
NP_440129.1_10 Reverse -349 -363 6.19444 0.177
NP_442873.1_3 Reverse -229 -248 10.9134 0.169
NP_440296.1_10 Forward -257 -238 -14.4552 0.269
NP_442206.1_10 Reverse -356 -371 10.5996 0.122
NP_443054.1_2 Reverse -354 -368 3.44117 0.24
NP_441851.1_10 Reverse -355 -365 17.4829 0.0027
NP_441851.1_10 Forward -366 -356 15.8113 0.00552
NP_441851.1_10 Forward -255 -245 6.8632 0.153
NP_442856.1_7 Reverse -236 -255 -6.49039 0.298
NP_441668.1_4 Forward -375 -356 9.53756 0.121
NP_441668.1_4 Reverse -346 -365 -2.0655 0.286
NP_442515.1_1 Forward -366 -352 13.9626 0.0278
NP_442515.1_1 Forward -249 -235 -2.75368 0.279
NP_442515.1_1 Reverse -355 -369 -4.91696 0.298
NP_440593.1_3 Reverse -240 -259 18.7807 0.0616
NP_440338.1_4 Forward -337 -318 13.175 0.148
NP_440338.1_4 Forward -92 -73 4.81688 0.298
NP_441349.1_10 Forward -375 -356 -0.4922 0.0947
NP_441349.1_10 Reverse -346 -365 -3.93378 0.155
NP_441349.1_10 Forward -258 -239 -9.34199 0.289
NP_441409.1_6 Reverse -350 -369 -6.98204 0.14
NP_440432.1_9 Forward -364 -349 -2.08505 0.167
NP_442843.1_1 Reverse -252 -271 -11.8003 0.293
NP_439960.1_10 Forward -261 -243 4.83737 0.161
NP_440431.1_10 Forward -290 -276 14.6509 0.289
NP_442450.1_5 Reverse -354 -364 19.1546 0.0103
NP_442450.1_5 Reverse -237 -247 8.23984 0.13
NP_442450.1_5 Forward -367 -357 7.55152 0.13
NP_442450.1_5 Reverse -243 -253 6.66654 0.16
NP_440588.1_2 Forward -257 -238 15.2408 0.0142
NP_440588.1_2 Forward -374 -355 7.37428 0.0502
NP_440588.1_2 Reverse -236 -255 3.83436 0.0946
NP_440588.1_2 Reverse -347 -366 -4.6221 0.223
NP_442006.1_2 Reverse -88 -105 -16.2841 0.247
NP_442006.1_2 Reverse -251 -268 -17.0707 0.269
NP_442006.1_2 Reverse -245 -262 -17.8574 0.283
NP_441003.1_9 Forward -374 -355 8.84924 0.224
NP_442243.1_1 Forward -371 -353 2.77167 0.204
NP_441570.1_1 Reverse -356 -374 -8.43732 0.112
NP_441570.1_1 Forward -254 -236 -8.73231 0.12
NP_440078.1_4 Forward -265 -246 19.6656 0.0823
NP_440078.1_10 Reverse -356 -375 2.45773 0.269
NP_441078.1_4 Forward -365 -356 19.6659 0.0007
NP_441078.1_4 Reverse -356 -365 19.6659 0.0007
NP_441078.1_4 Forward -254 -245 7.66954 0.052
NP_441078.1_4 Reverse -245 -254 0.491382 0.188
NP_441078.1_4 Forward -248 -239 0.196389 0.205
NP_441078.1_4 Reverse -239 -248 -0.000272808 0.205
NP_442729.1_5 Forward -255 -245 8.63316 0.248
NP_442729.1_8 Reverse -352 -365 18.2105 0.0325
NP_442348.1_2 Reverse -258 -267 7.17789 0.285
NP_440526.1_3 Reverse -357 -368 8.02298 0.126
NP_440526.1_3 Reverse -246 -257 8.02298 0.126
NP_440526.1_3 Forward -364 -353 1.6315 0.267
NP_441432.1_8 Forward -366 -357 16.8143 0.00595
NP_441432.1_8 Forward -255 -246 14.0611 0.0258
NP_441432.1_8 Forward -249 -240 14.0611 0.0258
NP_441432.1_8 Reverse -355 -364 8.35786 0.0755
NP_441432.1_9 Reverse -129 -142 8.01662 0.295
NP_442320.1_8 Reverse -350 -364 13.5693 0.0144
NP_442320.1_8 Forward -254 -240 -3.93365 0.136
NP_442320.1_8 Forward -371 -357 -4.52363 0.171
NP_441732.1_2 Reverse -352 -368 -6.7263 0.0495
NP_441732.1_2 Forward -258 -242 -6.82463 0.0533
NP_441732.1_2 Forward -369 -353 -7.61128 0.0861
NP_441732.1_2 Reverse -241 -257 -17.641 0.281
NP_440497.1_2 Reverse -240 -259 10.4225 0.201
NP_442003.1_9 Reverse -75 -94 13.0775 0.167
NP_440760.1_1 Reverse -356 -375 2.85105 0.0212
NP_440760.1_1 Forward -248 -229 -12.6852 0.0945
NP_440760.1_1 Reverse -245 -264 -17.3068 0.197
NP_440760.1_1 Forward -365 -346 -18.8801 0.217
NP_442797.1_7 Reverse -238 -256 11.4255 0.167
NP_440199.1_10 Forward -251 -241 15.5163 0.0861
NP_440199.1_10 Reverse -242 -252 7.25653 0.231
NP_440713.1_4 Forward -258 -239 20.1573 0.0174
NP_442489.1_2 Reverse -240 -259 6.4893 0.175
NP_442489.1_2 Forward -259 -240 4.52268 0.217
NP_442489.1_7 Forward -365 -356 20.1576 0.000695
NP_442489.1_7 Reverse -356 -365 20.1576 0.000695
NP_442489.1_7 Forward -254 -245 8.1612 0.0294
NP_442489.1_7 Forward -248 -239 0.688044 0.152
NP_442489.1_7 Reverse -239 -248 0.688044 0.152
NP_442489.1_7 Reverse -245 -254 0.491382 0.178
NP_442079.1_7 Forward -364 -345 17.699 0.0744
NP_440559.1_1 Reverse -357 -366 17.4043 0.00658
NP_440559.1_1 Forward -364 -355 17.306 0.00658
NP_440559.1_1 Reverse -246 -255 7.76787 0.0918
NP_440559.1_1 Reverse -240 -249 7.76787 0.0918
NP_440559.1_1 Forward -247 -238 6.39124 0.134
NP_441659.2_8 Forward -365 -355 19.3512 0.000966
NP_441659.2_8 Reverse -356 -366 18.1713 0.00133
NP_441659.2_8 Reverse -245 -255 6.56821 0.0714
NP_441659.2_8 Reverse -239 -249 5.48657 0.106
NP_441659.2_8 Forward -248 -238 0.275027 0.27
NP_440284.1_9 Reverse -311 -330 13.1758 0.0721
NP_441040.1_2 Forward -256 -237 -13.8652 0.284
NP_442008.1_2 Reverse -236 -255 4.52268 0.237
NP_441800.1_3 Forward -259 -241 6.80398 0.286
NP_442346.1_5 Reverse -355 -365 17.9746 0.00128
NP_442346.1_5 Forward -366 -356 16.6963 0.00248
NP_442346.1_5 Reverse -244 -254 11.6814 0.0606
NP_442346.1_5 Forward -255 -245 7.45319 0.169
NP_442346.1_5 Reverse -238 -248 4.3066 0.291
NP_440545.1_3 Forward -369 -352 12.3302 0.0212
NP_440545.1_3 Forward -258 -241 1.51381 0.118
NP_440831.1_3 Forward -257 -238 22.6961 0.0129
NP_440486.1_6 Reverse -355 -374 5.30933 0.298
NP_440010.1_4 Reverse -241 -260 -3.04956 0.294
NP_440847.1_3 Reverse -232 -246 12.5853 0.24
NP_442875.1_7 Reverse -158 -177 15.7316 0.226
NP_442603.1_7 Forward -365 -351 16.8135 0.0284
NP_442603.1_7 Forward -254 -240 13.9619 0.0758
NP_442603.1_7 Reverse -356 -370 9.04542 0.158
NP_442603.1_7 Reverse -239 -253 8.65209 0.168
NP_442603.1_7 Forward -248 -234 6.29216 0.249
NP_441888.1_7 Forward -370 -356 3.44117 0.225
NP_441888.1_7 Reverse -351 -365 2.94952 0.225
NP_441833.1_4 Forward -364 -357 15.9687 0.0124
NP_441833.1_4 Reverse -357 -364 15.9687 0.0124
NP_441833.1_4 Reverse -240 -247 6.52896 0.0924
NP_441833.1_4 Forward -253 -246 6.23397 0.163
NP_441833.1_4 Forward -247 -240 6.23397 0.163
NP_441833.1_4 Reverse -246 -253 6.13563 0.198
NP_441329.1_6 Forward -281 -262 -2.24448 0.294
NP_442162.1_9 Forward -364 -357 16.2637 0.0124
NP_442162.1_9 Reverse -357 -364 16.2637 0.0124
NP_442162.1_9 Forward -247 -240 12.9205 0.0282
NP_442162.1_9 Reverse -240 -247 12.9205 0.0282
NP_442162.1_9 Forward -253 -246 6.62729 0.142
NP_442162.1_9 Reverse -246 -253 6.43063 0.208
NP_440671.1_4 Forward -254 -240 12.291 0.114
NP_440671.1_4 Forward -371 -357 10.1277 0.164
NP_440671.1_4 Reverse -350 -364 9.43936 0.184
NP_441973.1_6 Forward -170 -152 16.5203 0.27
NP_442943.1_1 Reverse -66 -81 4.73258 0.221
NP_442140.1_3 Reverse -357 -367 12.2714 0.0632
NP_442140.1_3 Reverse -246 -256 8.4365 0.119
NP_442140.1_3 Forward -247 -237 6.07655 0.184
NP_442140.1_3 Forward -364 -354 5.68323 0.198
NP_442140.1_3 Forward -253 -243 5.19158 0.221
NP_442140.1_3 Reverse -252 -262 3.71661 0.283
NP_441813.1_5 Reverse -354 -364 16.1063 0.01
NP_441813.1_5 Forward -367 -357 8.63316 0.0367
NP_441813.1_5 Forward -250 -240 6.17489 0.1
NP_441813.1_5 Reverse -243 -253 6.07655 0.104
NP_441813.1_5 Reverse -237 -247 5.68323 0.113
NP_440590.1_4 Reverse -357 -370 3.85419 0.0672
NP_440590.1_4 Reverse -240 -253 3.06754 0.0772
NP_440590.1_4 Reverse -246 -259 1.10092 0.133
NP_440590.1_4 Forward -364 -351 -4.60227 0.263
NP_440567.1_1 Forward -364 -350 11.7993 0.0267
NP_440567.1_1 Forward -253 -239 5.99778 0.0918
NP_440567.1_1 Reverse -240 -254 4.81781 0.111
NP_440567.1_1 Reverse -246 -260 4.22782 0.126
NP_440567.1_1 Reverse -357 -371 3.73617 0.137
NP_440567.1_1 Forward -247 -233 1.67122 0.196
NP_442497.1_10 Forward -364 -355 19.8626 0.00532
NP_442497.1_10 Reverse -357 -366 10.4228 0.0087
NP_442497.1_10 Forward -247 -238 1.08137 0.115
NP_442497.1_10 Reverse -246 -255 0.589713 0.153
NP_442497.1_10 Reverse -240 -249 0.589713 0.153
NP_440821.1_4 Reverse -354 -364 19.8429 0.00399
NP_440821.1_4 Forward -367 -357 9.41981 0.0286
NP_440821.1_4 Forward -250 -240 8.53483 0.0468
NP_440821.1_4 Reverse -243 -253 6.07655 0.1
NP_440821.1_4 Forward -256 -246 -0.314959 0.251
NP_440821.1_10 Forward -32 -14 21.141 0.0715
NP_440227.1_2 Reverse -260 -276 12.6449 0.271
NP_441239.1_9 Reverse -354 -366 11.7404 0.0551
NP_441239.1_9 Reverse -237 -249 9.18376 0.113
NP_441239.1_9 Forward -367 -355 6.92215 0.173
NP_441239.1_9 Reverse -243 -255 4.66053 0.248
NP_441951.1_6 Reverse -242 -261 8.75091 0.288
NP_441727.1_3 Reverse -232 -251 10.1275 0.169
NP_441727.1_3 Reverse -349 -368 6.19431 0.245
NP_441727.1_3 Forward -261 -242 4.62101 0.262
NP_441892.1_1 Forward -263 -246 5.44704 0.101
NP_441892.1_1 Reverse -289 -306 -1.43612 0.205
NP_440604.1_6 Forward -365 -346 -5.31042 0.271
NP_442270.1_9 Forward -265 -246 -7.76869 0.214
NP_442270.1_9 Forward -259 -240 -7.76869 0.214
NP_442643.1_1 Reverse -350 -369 -10.817 0.231
NP_441017.1_6 Reverse -352 -366 15.4369 0.103
NP_440212.1_5 Reverse -234 -253 14.4541 0.247
NP_440354.1_7 Forward -254 -236 10.8356 0.224
NP_440546.1_4 Forward -248 -238 14.9908 0.0459
NP_440546.1_4 Forward -365 -355 12.8578 0.0572
NP_440546.1_4 Forward -254 -244 10.6277 0.109
NP_440546.1_4 Reverse -356 -366 10.046 0.109
NP_441230.1_5 Reverse -240 -259 3.73603 0.193
NP_440462.1_6 Reverse -354 -364 7.84651 0.0699
NP_440462.1_6 Forward -367 -357 1.35667 0.294
NP_440868.1_4 Forward -369 -357 6.1355 0.0878
NP_440868.1_4 Forward -252 -240 6.1355 0.0878
NP_440868.1_4 Reverse -241 -253 0.137309 0.228
NP_442499.1_1 Forward -91 -72 3.83436 0.247
NP_442499.1_3 Forward -366 -348 4.14905 0.289
NP_442787.1_1 Forward -396 -377 10.6192 0.179
NP_442479.1_9 Reverse -74 -93 0.884433 0.191
NP_440812.1_2 Forward -199 -180 9.24257 0.249
NP_440696.1_3 Reverse -235 -253 -0.374176 0.243
NP_442039.1_4 Forward -364 -357 15.1821 0.0124
NP_442039.1_4 Reverse -357 -364 15.1821 0.0124
NP_442039.1_4 Forward -247 -240 11.6422 0.0747
NP_442039.1_4 Forward -253 -246 6.3323 0.289
NP_441811.1_8 Forward -254 -240 7.27608 0.251
NP_442829.1_2 Reverse -302 -318 15.3886 0.234
NP_440825.1_7 Reverse -357 -367 12.9096 0.152
NP_442837.1_3 Forward -364 -357 15.7721 0.0124
NP_442837.1_3 Reverse -357 -364 15.7721 0.0124
NP_442837.1_3 Forward -253 -246 6.0373 0.25
NP_442837.1_3 Forward -247 -240 6.0373 0.25
NP_442837.1_3 Reverse -240 -247 6.0373 0.25
NP_442837.1_3 Reverse -246 -253 5.93897 0.265
NP_442053.1_1 Forward -365 -356 18.3876 0.0007
NP_442053.1_1 Reverse -356 -365 18.3876 0.0007
NP_442053.1_1 Reverse -239 -248 14.4544 0.0114
NP_442053.1_1 Forward -254 -245 7.86621 0.0863
NP_442053.1_1 Forward -248 -239 7.86621 0.0863
NP_442053.1_1 Reverse -245 -254 6.39124 0.136
NP_440505.1_3 Forward -250 -240 14.7297 0.0176
NP_440505.1_3 Forward -367 -357 9.22315 0.122
NP_440505.1_3 Reverse -354 -364 7.55152 0.151
NP_441252.1_6 Reverse -390 -397 14.3954 0.168
NP_441203.1_1 Forward -364 -345 -2.16383 0.0636
NP_442844.1_5 Forward -323 -304 3.44025 0.26
NP_441408.2_7 Reverse -243 -262 -4.91709 0.288
NP_440914.1_1 Reverse -356 -366 17.5935 0.000537
NP_440914.1_1 Forward -254 -244 15.1537 0.00654
NP_440914.1_1 Reverse -239 -249 13.1043 0.0386
NP_440914.1_1 Forward -365 -355 8.51751 0.186
NP_441011.1_8 Forward -364 -355 14.356 0.0249
NP_441011.1_8 Forward -247 -238 9.24284 0.131
NP_441011.1_8 Reverse -357 -366 8.25953 0.144
NP_442101.1_10 Forward -373 -354 -8.65367 0.242
NP_442533.1_1 Forward -251 -232 -16.8151 0.277
NP_442533.1_6 Forward -365 -356 17.2076 0.00137
NP_442533.1_6 Reverse -356 -365 17.2076 0.00137
NP_442533.1_6 Reverse -245 -254 7.66954 0.0897
NP_442533.1_6 Forward -254 -245 6.8829 0.101
NP_442533.1_6 Reverse -239 -248 4.42462 0.179
NP_441482.1_7 Reverse -350 -364 15.7325 0.00937
NP_441482.1_7 Forward -371 -357 8.55439 0.0162
NP_441482.1_7 Forward -260 -246 -8.8502 0.193
NP_441482.1_7 Forward -254 -240 -8.94853 0.193
NP_439944.1_9 Forward -364 -354 17.3846 0.00516
NP_439944.1_9 Reverse -357 -367 10.5014 0.0887
NP_439944.1_9 Reverse -240 -250 9.22315 0.1
NP_439944.1_9 Forward -253 -243 7.55152 0.138
NP_441697.1_5 Reverse -330 -349 -9.69285 0.273
NP_442202.1_6 Forward -278 -259 9.43923 0.192
NP_440116.1_5 Forward -368 -351 23.6383 0.0128
NP_440116.1_5 Forward -251 -234 2.20212 0.279
NP_440116.1_8 Forward -364 -345 -5.80207 0.195
NP_441527.1_4 Reverse -305 -324 -4.82277 0.189
NP_440115.1_6 Forward -368 -358 9.32148 0.115
NP_440115.1_6 Forward -251 -241 8.4365 0.13
NP_440115.1_6 Forward -11 -1 6.96153 0.166
NP_440007.1_9 Forward -258 -244 9.5377 0.171
NP_440007.1_9 Reverse -352 -366 4.03116 0.267
NP_441972.1_5 Reverse -240 -259 -5.50708 0.222
NP_441972.1_5 Reverse -246 -265 -7.4737 0.249
NP_441106.1_1 Reverse -355 -364 9.73449 0.0311
NP_441106.1_1 Forward -366 -357 9.63616 0.0311
NP_441106.1_1 Forward -255 -246 6.48957 0.0895
NP_439903.1_6 Reverse -353 -372 6.09517 0.173
NP_439903.1_6 Reverse -242 -261 -0.197979 0.277
NP_441286.1_1 Forward -366 -354 23.9334 0.000767
NP_441286.1_1 Forward -255 -243 10.6587 0.0171
NP_441286.1_1 Forward -249 -237 5.05386 0.0259
NP_441286.1_1 Reverse -355 -367 3.48056 0.0467
NP_441286.1_1 Reverse -244 -256 -6.15587 0.251
NP_442674.1_3 Forward -262 -243 12.6833 0.174
NP_440670.1_8 Forward -365 -356 18.3876 0.000699
NP_440670.1_8 Reverse -356 -365 18.3876 0.000699
NP_440670.1_8 Forward -248 -239 8.75118 0.0606
NP_440670.1_8 Reverse -239 -248 6.19458 0.124
NP_440886.1_7 Reverse -355 -365 8.04271 0.0805
NP_440886.1_7 Forward -366 -356 7.94438 0.0805
NP_440886.1_7 Reverse -244 -254 7.64939 0.0865
NP_440886.1_7 Reverse -238 -248 6.76441 0.114
NP_442614.1_2 Forward -254 -240 5.80112 0.297
NP_442072.1_9 Reverse -355 -373 -13.5505 0.115
NP_440907.2_8 Forward -364 -354 9.81266 0.103
NP_440907.2_8 Reverse -357 -367 7.64939 0.117
NP_441021.1_1 Reverse -240 -259 1.27776 0.0848
NP_440326.1_5 Forward -367 -354 15.2606 0.179
NP_440841.1_4 Reverse -243 -262 -10.9153 0.29
NP_441626.1_2 Forward -364 -357 15.7721 0.0124
NP_441626.1_2 Reverse -357 -364 15.7721 0.0124
NP_441626.1_2 Forward -247 -240 12.2322 0.0511
NP_441626.1_2 Forward -253 -246 6.52896 0.137
NP_441626.1_2 Reverse -246 -253 5.93897 0.231
NP_441626.1_2 Reverse -240 -247 5.93897 0.231
NP_442365.1_7 Reverse -241 -260 -1.96717 0.198
NP_440107.1_5 Reverse -244 -263 -1.47551 0.178
NP_442794.1_1 Forward -369 -357 21.9668 0.00123
NP_442794.1_1 Forward -258 -246 19.4102 0.00716
NP_442794.1_1 Reverse -352 -364 7.4138 0.138
NP_442615.1_1 Forward -374 -356 -1.75081 0.132
NP_441962.1_4 Reverse -351 -370 -7.4737 0.189
NP_441962.1_4 Forward -370 -351 -9.53865 0.218
NP_441962.1_4 Forward -253 -234 -13.2752 0.271
NP_441962.1_4 Reverse -240 -259 -15.0452 0.297
NP_440387.1_1 Reverse -356 -372 20.3147 0.00303
NP_440387.1_1 Forward -365 -349 0.255197 0.129
NP_440387.1_1 Forward -254 -238 -4.66135 0.194
NP_440387.1_1 Reverse -239 -255 -5.34967 0.227
NP_441488.1_8 Forward -259 -245 11.9953 0.146
NP_441488.1_8 Forward -253 -239 10.5204 0.146
NP_440114.1_10 Forward -248 -234 10.226 0.151
NP_440766.1_4 Forward -252 -238 19.0758 0.0255
NP_440766.1_4 Forward -369 -355 6.19444 0.104
NP_440766.1_4 Reverse -352 -366 0.196253 0.298
NP_440766.1_5 Forward -274 -262 8.51522 0.277
NP_441237.1_9 Reverse -357 -367 14.828 0.0242
NP_441237.1_9 Reverse -246 -256 14.533 0.0323
NP_441237.1_9 Forward -247 -237 14.0414 0.0535
NP_442743.1_5 Reverse -240 -259 8.65258 0.148
NP_440457.1_1 Reverse -352 -364 16.8536 0.0455
NP_440457.1_1 Forward -252 -240 11.1504 0.092
NP_440457.1_1 Forward -369 -357 -0.452677 0.263
NP_440798.1_1 Reverse -219 -237 10.2519 0.294
NP_441436.1_8 Forward -366 -347 10.7175 0.262
NP_442509.1_9 Forward -365 -355 17.3841 0.00128
NP_442509.1_9 Forward -248 -238 13.1559 0.061
NP_442509.1_9 Reverse -172 -182 8.63269 0.192
NP_442509.1_9 Reverse -356 -366 8.14104 0.192
NP_441489.1_3 Forward -276 -262 9.08335 0.232
NP_441253.1_8 Forward -370 -356 14.4365 0.128
NP_442514.1_5 Reverse -231 -250 -7.47443 0.276
NP_440554.1_4 Forward -364 -354 6.96153 0.107
NP_440554.1_4 Reverse -240 -250 4.10993 0.201
NP_442862.1_3 Reverse -263 -280 7.70866 0.253
NP_442862.1_3 Reverse -262 -279 6.03703 0.267
NP_442862.1_3 Reverse -293 -310 5.44704 0.276
NP_441845.1_6 Reverse -344 -362 2.67408 0.245
NP_441885.1_5 Reverse -356 -366 20.9245 0.000538
NP_441885.1_5 Forward -365 -355 11.3864 0.00668
NP_441885.1_5 Forward -254 -244 2.04498 0.0868
NP_441885.1_5 Reverse -245 -255 1.84832 0.0957
NP_441885.1_5 Reverse -239 -249 1.25834 0.11
NP_441885.1_5 Forward -248 -238 -0.0199663 0.186
NP_440478.1_4 Forward -258 -239 20.944 0.0168
NP_440478.1_4 Forward -369 -350 15.0441 0.158
NP_442341.1_7 Forward -366 -352 16.1259 0.0186
NP_442341.1_7 Reverse -355 -369 13.8643 0.0334
NP_442341.1_7 Reverse -244 -258 5.99778 0.139
NP_442341.1_7 Reverse -238 -252 5.60446 0.151
NP_442341.1_9 Reverse -354 -368 9.24208 0.155
NP_442341.1_9 Reverse -243 -257 6.98048 0.208
NP_441173.1_9 Reverse -375 -383 10.9338 0.242
NP_442395.2_4 Reverse -238 -257 2.35861 0.223
NP_443000.1_7 Forward -367 -357 10.3048 0.0345
NP_443000.1_7 Reverse -354 -364 8.82982 0.0437
NP_443000.1_7 Forward -250 -240 7.35486 0.0859
NP_443000.1_7 Forward -256 -246 0.57002 0.294
NP_440507.2_3 Reverse -347 -366 12.9783 0.145
NP_440507.2_3 Reverse -236 -255 8.16011 0.261
NP_441842.1_10 Reverse -349 -363 13.8643 0.0667
NP_441842.1_10 Forward -255 -241 9.63603 0.186
NP_441842.1_10 Forward -261 -247 6.3911 0.291
NP_440275.1_3 Reverse -354 -364 10.0098 0.0454
NP_440275.1_3 Forward -367 -357 8.04317 0.0602
NP_440275.1_3 Forward -250 -240 5.5849 0.14
NP_442354.1_7 Reverse -353 -372 7.66927 0.216
NP_440804.1_7 Forward -387 -370 6.62629 0.289
NP_440149.1_8 Reverse -239 -258 0.884433 0.132
NP_440149.1_8 Reverse -245 -264 -3.54046 0.192
NP_440149.1_8 Forward -254 -235 -6.1954 0.244
NP_441105.1_3 Forward -265 -246 3.93269 0.0851
NP_441105.1_3 Forward -259 -240 -3.14714 0.173
NP_441105.1_3 Reverse -287 -306 -5.21209 0.214
NP_441105.1_3 Forward -376 -357 -6.1954 0.23
NP_441105.1_3 Reverse -345 -364 -9.63698 0.292
NP_440216.1_1 Forward -365 -351 -2.55701 0.0521
NP_440216.1_1 Reverse -356 -370 -10.3252 0.145
NP_440172.1_1 Forward -365 -355 16.303 0.00854
NP_440172.1_1 Reverse -356 -366 15.0247 0.00945
NP_440172.1_1 Forward -254 -244 13.2547 0.0215
NP_440172.1_1 Forward -248 -238 7.55152 0.0761
NP_440172.1_1 Reverse -239 -249 2.24165 0.279
NP_440172.1_6 Reverse -85 -104 8.94757 0.259
NP_442015.1_10 Forward -369 -356 19.8821 0.00366
NP_442015.1_10 Reverse -352 -365 11.1307 0.0375
NP_442015.1_10 Forward -258 -245 7.59077 0.0819
NP_442015.1_10 Reverse -241 -254 2.37923 0.193
NP_442015.1_10 Forward -252 -239 0.0192843 0.245
NP_441226.1_7 Forward -364 -357 14.4934 0.0123
NP_441226.1_7 Reverse -357 -364 14.4934 0.0123
NP_441226.1_7 Reverse -246 -253 14.1984 0.024
NP_441226.1_7 Forward -247 -240 12.7234 0.0312
NP_441226.1_7 Reverse -240 -247 11.5435 0.0757
NP_441757.1_3 Forward -249 -230 2.45773 0.155
NP_441111.1_7 Forward -364 -356 18.7023 0.00294
NP_441111.1_7 Reverse -357 -365 18.7023 0.00294
NP_441111.1_7 Reverse -246 -254 8.86921 0.0589
NP_441111.1_7 Reverse -240 -248 8.86921 0.0589
NP_442379.1_10 Forward -372 -355 0.628827 0.223
NP_441766.1_2 Forward -365 -356 17.5026 0.00297
NP_441766.1_2 Reverse -356 -365 17.5026 0.00297
NP_441766.1_2 Reverse -239 -248 14.7494 0.00772
NP_441766.1_2 Reverse -245 -254 8.45619 0.0593
NP_442417.1_5 Forward -365 -351 12.8809 0.0901
NP_442417.1_5 Reverse -356 -370 9.93102 0.124
NP_440416.1_9 Forward -372 -353 -15.3402 0.189
NP_440416.1_9 Forward -261 -242 -15.4385 0.191
NP_440416.1_9 Forward -255 -236 -16.1268 0.208
NP_440416.1_9 Reverse -238 -257 -17.5035 0.241
NP_442116.1_6 Reverse -262 -279 9.02838 0.235
NP_442116.1_6 Forward -152 -135 7.88248 0.254
NP_442403.1_8 Reverse -241 -260 -1.57384 0.258
NP_442154.1_1 Forward -262 -244 -15.4188 0.218
NP_442226.1_8 Forward -387 -377 16.6963 0.164
NP_440261.1_5 Reverse -163 -176 -6.86388 0.201
NP_440261.1_5 Forward -364 -351 -10.1088 0.201
NP_440261.1_5 Reverse -357 -370 -10.4038 0.201
NP_440988.1_10 Reverse -243 -257 19.1303 0.094
NP_440988.1_10 Reverse -354 -368 6.2542 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCATTGCCCAATTAATTTTGGCTGAATTAAACCTTGGCGATCGCCCTAGTAACACCATTATTAAATCCTTAACCCAATCTTCTTTTTCTTCTAATCCATGACCTATTCCATTTTGGCTAGCCAAATTTGGACAAAAAATCCGCCTTGGCGATGGCGATCGGGCAAATGGTGTTGCAATATCTCCGGGAAGAAAATAGAGTGGCCTATATCCGTATTATGGGCGTTTCCGGAGCATTGCTGATTTTATCAATATCCTAGAACAGTTGCCAAAAGAGCAGAGTCCTAATGAAAAATGTCCAGCTACTCCTTAACCTTGCCACAATCTTCAACTATTTAAGGGGTTAATTGTAGCCGTTTTGTTAGGTCTTAACCCTGTTATCATTTCCCTTCGGAGCCATCC

CDS

ATGGTCAATCTTCTCGTAATTAGTTTACGGATCGCCCCGGCAGCGGAAGCGGCATTTACTGAGTTTTACCACCATCACTACATTCCTAAATTATTAGAAGTTGTTCCTGAAATCACTACCGCCCGTCGCTACGAAGAATATGGAGTGGCCGGCAGTTTGAAGTGGTTCAGCAAACGCTTGCTCACGTTCTACGAATTAGCCCCCAATGTTTCTTTGGAGCAGATTAACTCTGCCCTGTCTCGCCCAGGGCGGGAAGAGGAAACCGCTACATGGCAACATTGGAAAGTTAATGCATTACAAGGTCTAAGCCGGGTAGCTTACCAACAAACCTATGCCCATTCCCGCCGTCCTTGGGATGGCATCTTTGGCAATCGTCCTTTTTTCCAAGTCAGCGTTGAAGTTAAACCGGAGGCGGAACCGGAATTTCGGGCCTGGTACGAAGAAAGCTATTTACCTAAAATTATGGCGGATGTGCCTACCTGGGCCGCTTGCCGTCGTTATACCAGCTTTGATCGGGACCCTGTAATCTACCACACCATTTATGAAACCGCGAACTTGGCAGACCTAGAAACATCCTTTGCCTCCATGCGGAGTGCCTACCTTTATGGTTCTAATGCCGACTGGGATCGCTGGGTAGGGACCGCCATTACCTATCAAGATGCAGCTAGTTATCGTCCTATTTTTCGCCGGCCAGGTTAA

Protein

MVNLLVISLRIAPAAEAAFTEFYHHHYIPKLLEVVPEITTARRYEEYGVAGSLKWFSKRLLTFYELAPNVSLEQINSALSRPGREEETATWQHWKVNALQGLSRVAYQQTYAHSRRPWDGIFGNRPFFQVSVEVKPEAEPEFRAWYEESYLPKIMADVPTWAACRRYTSFDRDPVIYHTIYETANLADLETSFASMRSAYLYGSNADWDRWVGTAITYQDAASYRPIFRRPG