Your browser is old and dusty. Try Google Chrome!

Details for sll0301

ORF sll0301
Accession NP_441956.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441818.1_9 Reverse -193 -212 -10.9153 0.299
NP_441098.1_3 Forward -90 -71 -1.81236 0.277
NP_441098.1_3 Reverse -70 -89 -2.96081 0.28
NP_442752.1_4 Forward -389 -382 5.44732 0.202
NP_440613.1_3 Forward -277 -258 10.0292 0.196
NP_441802.1_1 Reverse -42 -61 6.29264 0.269
NP_441802.1_1 Reverse -327 -346 5.211 0.286
NP_440304.1_4 Reverse -99 -109 13.5497 0.051
NP_440304.1_4 Reverse -66 -76 3.81494 0.292
NP_440916.1_1 Reverse -27 -41 21.7307 0.0228
NP_442602.1_3 Reverse -168 -187 -0.4922 0.221
NP_441200.1_4 Reverse -325 -344 10.6192 0.189
NP_442742.1_1 Reverse -187 -206 14.3558 0.209
NP_442742.1_9 Reverse -105 -124 -6.1954 0.222
NP_442896.1_7 Reverse -149 -168 6.78429 0.0921
NP_441082.1_10 Forward -48 -35 7.88576 0.293
NP_441925.1_4 Reverse -137 -156 -9.24438 0.216
NP_441083.1_3 Reverse -194 -204 13.7459 0.195
NP_441083.1_5 Reverse -380 -390 4.79825 0.13
NP_441434.1_1 Forward -90 -76 10.6112 0.233
NP_441434.1_1 Forward -32 -18 8.03294 0.26
NP_441738.1_2 Reverse -382 -389 10.2652 0.101
NP_441645.1_6 Reverse -147 -161 14.4536 0.193
NP_440447.1_1 Reverse -35 -53 8.57394 0.194
NP_440447.1_5 Reverse -33 -43 12.9597 0.291
NP_442570.1_3 Forward -330 -311 -7.27704 0.269
NP_440331.1_5 Reverse -128 -147 -8.85033 0.142
NP_442111.1_3 Forward -28 -15 11.9983 0.298
NP_442973.1_5 Forward -119 -100 12.3892 0.206
NP_440842.1_10 Reverse -59 -73 1.67122 0.286
NP_443018.1_3 Reverse -313 -320 9.38056 0.128
NP_440376.1_1 Forward -328 -319 5.80125 0.119
NP_440376.1_1 Forward -389 -380 -0.000272808 0.285
NP_440580.1_8 Forward -145 -126 12.3883 0.0832
NP_442687.1_7 Forward -322 -312 4.20827 0.262
NP_441846.1_10 Forward -156 -137 -23.01 0.275
NP_440781.1_1 Forward -400 -386 15.3392 0.247
NP_440642.1_10 Forward -182 -168 1.37564 0.293
NP_441682.1_2 Forward -203 -184 1.76941 0.241
NP_442658.1_1 Reverse -60 -70 11.1893 0.0915
NP_441414.1_9 Forward -389 -370 -3.93378 0.143
NP_441256.1_8 Forward -395 -376 4.71934 0.272
NP_441958.1_5 Forward -322 -312 -2.57657 0.28
NP_440203.1_5 Reverse -382 -392 10.206 0.235
NP_442690.1_1 Reverse -14 -33 -15.6352 0.28
NP_440369.1_6 Reverse -187 -206 13.2741 0.17
NP_443055.1_6 Reverse -312 -330 4.93494 0.181
NP_442002.1_1 Forward -330 -312 -0.7675 0.192
NP_442002.1_1 Forward -165 -147 -0.865831 0.192
NP_441654.1_7 Reverse -356 -375 11.6619 0.285
NP_440377.1_1 Forward -34 -17 10.3074 0.298
NP_441916.1_7 Reverse -294 -304 3.81494 0.202
NP_440345.1_5 Reverse -79 -93 15.5754 0.263
NP_441041.1_7 Forward -113 -101 9.55551 0.109
NP_440569.1_10 Reverse -242 -261 8.92807 0.231
NP_441725.1_4 Reverse -354 -368 9.53707 0.153
NP_439966.1_7 Reverse -378 -388 7.15773 0.154
NP_441514.1_1 Reverse -13 -23 15.9684 0.274
NP_442281.1_1 Reverse -307 -321 3.8339 0.217
NP_442575.1_8 Reverse -50 -69 8.84924 0.124
NP_441556.1_10 Reverse -258 -272 10.5138 0.267
NP_441644.1_6 Reverse -312 -322 9.616 0.0728
NP_440652.1_6 Reverse -39 -58 15.0441 0.292
NP_442029.1_6 Forward -162 -143 6.68596 0.234
NP_440780.1_1 Forward -36 -17 8.25963 0.274
NP_442926.1_4 Forward -158 -140 17.4237 0.245
NP_442554.1_4 Reverse -157 -176 6.4893 0.291
NP_442554.1_8 Reverse -313 -323 3.12662 0.239
NP_442142.1_1 Reverse -323 -342 11.9958 0.259
NP_443009.1_5 Reverse -100 -111 4.18809 0.259
NP_440405.1_3 Forward -141 -122 19.4328 0.0618
NP_440015.1_8 Forward -151 -133 19.6853 0.184
NP_442099.1_1 Forward -380 -362 12.7038 0.292
NP_441731.1_3 Forward -397 -378 -6.29373 0.29
NP_441956.1_9 Forward -205 -186 4.42435 0.277
NP_442868.1_6 Reverse -318 -328 4.3066 0.18
NP_442719.1_2 Forward -32 -14 -9.02799 0.259
NP_442719.1_2 Forward -184 -166 -10.6013 0.278
NP_441612.1_2 Forward -38 -28 14.9389 0.21
NP_441612.1_2 Reverse -222 -232 14.3581 0.21
NP_440869.1_6 Forward -300 -281 2.94938 0.245
NP_442050.1_5 Reverse -378 -388 8.63269 0.223
NP_440558.1_2 Reverse -266 -285 -2.36049 0.226
NP_441878.1_6 Forward -322 -312 0.668351 0.139
NP_441878.1_6 Reverse -311 -321 0.668351 0.139
NP_441878.1_6 Forward -328 -318 -7.88644 0.278
NP_441534.1_5 Forward -268 -249 7.7676 0.261
NP_441590.1_4 Reverse -136 -155 9.14342 0.249
NP_441590.1_4 Forward -325 -306 3.83357 0.29
NP_441590.1_4 Reverse -319 -338 1.6703 0.299
NP_442066.2_9 Reverse -376 -389 7.6891 0.212
NP_442183.1_1 Forward -389 -375 12.4876 0.0579
NP_441116.1_9 Forward -381 -367 14.1593 0.229
NP_442347.1_2 Reverse -109 -118 13.4711 0.056
NP_442594.1_8 Forward -383 -364 3.44104 0.282
NP_440136.1_1 Reverse -19 -35 9.7926 0.238
NP_442334.1_2 Forward -390 -373 -14.1208 0.297
NP_441559.1_8 Reverse -185 -199 -6.78525 0.279
NP_441559.1_8 Reverse -184 -198 -7.57189 0.295
NP_441395.1_6 Forward -89 -70 13.3207 0.299
NP_440915.1_6 Forward -393 -379 5.30946 0.091
NP_440915.1_6 Forward -325 -311 -2.75368 0.28
NP_441464.1_1 Reverse -380 -399 12.5858 0.24
NP_440026.1_2 Forward -56 -37 12.5858 0.297
NP_440677.1_6 Forward -398 -379 14.1591 0.167
NP_442386.1_10 Forward -155 -142 4.14919 0.265
NP_440059.1_3 Reverse -302 -321 8.35677 0.22
NP_441132.1_3 Forward -337 -318 11.7008 0.181
NP_442240.1_2 Reverse -295 -314 -16.5201 0.247
NP_442959.1_5 Forward -36 -17 9.93088 0.224
NP_443051.1_5 Forward -376 -357 6.29264 0.256
NP_439937.1_9 Reverse -143 -160 -0.945159 0.122
NP_439937.1_9 Forward -178 -161 -9.30325 0.184
NP_439937.1_9 Reverse -142 -159 -11.3682 0.251
NP_439937.1_9 Reverse -343 -360 -12.9415 0.278
NP_442783.1_8 Reverse -275 -294 19.5664 0.0719
NP_440819.1_5 Reverse -328 -336 7.8859 0.266
NP_440819.1_5 Forward -38 -30 7.68924 0.266
NP_440316.1_10 Forward -322 -312 8.04317 0.24
NP_440139.1_1 Forward -327 -308 7.37347 0.133
NP_442384.1_10 Reverse -312 -325 6.50913 0.0995
NP_441877.1_5 Reverse -14 -33 -0.787193 0.282
NP_442572.1_2 Reverse -139 -158 11.8975 0.159
NP_441018.1_7 Forward -160 -141 7.07928 0.277
NP_442262.1_10 Reverse -313 -320 9.47889 0.187
NP_441689.1_4 Forward -102 -83 13.2252 0.23
NP_441335.1_5 Reverse -194 -213 15.4374 0.234
NP_440297.1_8 Reverse -54 -72 17.2271 0.151
NP_440297.1_9 Reverse -313 -323 -0.216628 0.282
NP_440999.1_9 Reverse -143 -157 -0.197071 0.201
NP_441543.1_3 Reverse -143 -157 12.6836 0.163
NP_441319.1_3 Forward -346 -327 12.7825 0.256
NP_440982.1_1 Reverse -312 -331 4.71854 0.294
NP_443064.1_3 Forward -169 -150 5.40766 0.298
NP_442578.1_5 Reverse -143 -162 9.63589 0.227
NP_440071.1_6 Forward -158 -144 13.611 0.261
NP_440516.1_8 Forward -389 -380 -0.590259 0.283
NP_442428.1_8 Forward -203 -184 2.16274 0.224
NP_440783.1_5 Forward -334 -315 4.03102 0.15
NP_442545.1_7 Reverse -174 -193 19.3707 0.131
NP_442120.1_10 Reverse -62 -81 -13.4719 0.285
NP_440992.1_5 Forward -213 -194 12.375 0.297
NP_441004.1_1 Forward -204 -185 -17.2085 0.29
NP_442813.1_4 Forward -172 -153 0.491109 0.197
NP_442813.1_4 Forward -171 -152 -8.45701 0.299
NP_443054.1_2 Reverse -99 -113 0.491246 0.262
NP_442208.1_5 Forward -51 -32 -10.6203 0.299
NP_441542.1_4 Reverse -276 -290 4.32615 0.264
NP_441668.1_4 Forward -382 -363 -1.18052 0.27
NP_441982.1_6 Forward -39 -30 12.4854 0.275
NP_442689.1_8 Reverse -18 -35 -3.8944 0.255
NP_442689.1_8 Reverse -75 -92 -8.61428 0.294
NP_441349.1_10 Forward -282 -263 2.45773 0.0748
NP_442843.1_1 Forward -387 -368 -10.1286 0.276
NP_441477.1_5 Reverse -265 -284 6.68596 0.278
NP_441124.1_5 Forward -27 -17 14.918 0.21
NP_441124.1_5 Reverse -80 -90 10.7163 0.286
NP_442006.1_2 Forward -153 -136 -15.6941 0.228
NP_440483.1_1 Reverse -153 -172 -8.94866 0.297
NP_442348.1_2 Forward -368 -359 7.57121 0.28
NP_442443.1_1 Reverse -182 -201 -2.85214 0.264
NP_442443.1_1 Forward -203 -184 -3.83545 0.267
NP_441432.1_8 Forward -273 -264 3.24465 0.252
NP_443024.1_2 Reverse -144 -157 17.2266 0.167
NP_441737.1_1 Reverse -367 -386 7.07928 0.169
NP_440199.1_10 Forward -306 -296 15.123 0.0861
NP_439900.1_4 Reverse -265 -279 19.2718 0.136
NP_439935.1_1 Reverse -16 -35 6.58763 0.28
NP_442400.1_10 Reverse -348 -361 8.36957 0.278
NP_442400.1_10 Forward -90 -77 7.12818 0.298
NP_441659.2_8 Reverse -312 -322 2.14332 0.211
NP_442749.1_5 Reverse -6 -23 10.2482 0.192
NP_441040.1_2 Forward -337 -318 -10.6203 0.248
NP_442849.1_1 Forward -315 -301 9.73436 0.229
NP_440315.1_1 Reverse -196 -215 15.8307 0.0957
NP_442346.1_5 Forward -273 -263 7.84651 0.156
NP_442346.1_5 Forward -322 -312 6.37155 0.205
NP_440352.1_5 Forward -47 -28 10.3196 0.278
NP_441856.1_6 Forward -200 -186 17.9942 0.142
NP_441629.1_3 Forward -212 -193 -3.34455 0.277
NP_442551.1_4 Forward -189 -174 -3.65835 0.292
NP_442900.1_1 Forward -55 -36 -5.50708 0.238
NP_440847.1_3 Reverse -381 -395 17.5018 0.115
NP_442603.1_9 Reverse -310 -328 3.46073 0.293
NP_443026.1_5 Forward -154 -135 4.03102 0.283
NP_442943.1_1 Forward -33 -18 5.78533 0.21
NP_442943.1_1 Forward -259 -244 5.59392 0.21
NP_442140.1_3 Reverse -313 -323 4.69992 0.238
NP_441671.1_10 Forward -284 -265 0.0977854 0.285
NP_440590.1_4 Reverse -190 -203 -3.61896 0.255
NP_441239.1_9 Reverse -310 -322 11.5437 0.0589
NP_441239.1_9 Reverse -142 -154 7.4138 0.161
NP_441239.1_9 Reverse -378 -390 5.15219 0.227
NP_440400.1_1 Reverse -371 -390 1.6703 0.263
NP_442669.1_1 Forward -263 -244 29.4004 0.0000171
NP_442669.1_1 Reverse -124 -143 4.52268 0.127
NP_442643.1_3 Forward -204 -185 -5.50708 0.261
NP_440833.1_6 Forward -25 -11 7.47213 0.278
NP_442052.1_8 Reverse -60 -70 13.8447 0.253
NP_442809.1_6 Forward -278 -259 1.47442 0.272
NP_440546.1_4 Forward -321 -311 13.2456 0.0557
NP_440546.1_4 Reverse -312 -322 8.78555 0.171
NP_442465.1_7 Forward -262 -244 16.4404 0.296
NP_440401.1_5 Forward -237 -223 17.8958 0.16
NP_442479.1_9 Forward -34 -15 3.04771 0.191
NP_442479.1_9 Forward -24 -5 -6.68705 0.266
NP_442479.1_9 Forward -25 -6 -11.1119 0.273
NP_442402.1_1 Reverse -21 -40 17.5024 0.107
NP_442402.1_2 Reverse -26 -40 10.5204 0.292
NP_442402.1_4 Reverse -21 -40 5.01354 0.144
NP_442402.1_4 Forward -181 -162 -1.08295 0.189
NP_442402.1_4 Reverse -20 -39 -8.75273 0.284
NP_442402.1_6 Forward -41 -32 14.1594 0.241
NP_442402.1_10 Reverse -29 -39 13.0576 0.204
NP_442402.1_10 Forward -173 -163 12.6642 0.204
NP_441848.1_4 Forward -33 -17 8.50558 0.288
NP_441848.1_4 Reverse -7 -23 7.74165 0.288
NP_441848.1_7 Reverse -356 -375 -0.886293 0.244
NP_441848.1_7 Reverse -355 -374 -1.47628 0.251
NP_442923.1_4 Forward -204 -185 17.2074 0.0132
NP_440825.1_6 Forward -382 -363 7.7676 0.285
NP_442696.1_6 Reverse -141 -160 -2.55715 0.147
NP_440505.1_3 Forward -200 -190 8.1415 0.147
NP_440351.1_1 Reverse -148 -167 25.3688 0.000823
NP_440351.1_1 Forward -173 -154 -1.08219 0.222
NP_440914.1_1 Reverse -62 -72 7.83437 0.219
NP_441699.1_9 Forward -386 -370 21.6913 0.134
NP_442533.1_1 Forward -163 -144 -8.26035 0.202
NP_442533.1_1 Forward -162 -143 -17.5035 0.289
NP_442533.1_6 Forward -321 -312 4.71961 0.177
NP_442533.1_6 Reverse -312 -321 3.83464 0.202
NP_442533.1_6 Reverse -319 -328 1.96635 0.28
NP_440263.1_5 Forward -172 -158 6.98109 0.294
NP_442232.1_3 Reverse -54 -73 -15.9302 0.299
NP_442269.1_1 Forward -322 -303 11.6025 0.119
NP_441697.1_5 Reverse -15 -34 -10.4568 0.279
NP_441028.1_6 Reverse -30 -40 14.6309 0.158
NP_441028.1_6 Forward -172 -162 8.3377 0.216
NP_441028.1_6 Forward -230 -220 5.38779 0.255
NP_443045.1_5 Forward -393 -380 18.7283 0.119
NP_441972.1_3 Forward -399 -380 16.0274 0.146
NP_439903.1_6 Forward -57 -38 -0.0996487 0.276
NP_442588.1_8 Reverse -153 -172 6.68596 0.238
NP_442213.1_5 Forward -338 -319 -2.36049 0.295
NP_440028.1_6 Forward -165 -147 10.8356 0.277
NP_440841.1_4 Forward -323 -304 -6.98204 0.22
NP_442615.1_1 Forward -119 -101 -7.06068 0.273
NP_441065.1_3 Reverse -120 -139 15.0441 0.23
NP_441836.1_2 Forward -284 -265 6.4893 0.115
NP_441174.1_4 Reverse -220 -230 16.9913 0.184
NP_440358.1_1 Reverse -225 -239 18.5841 0.151
NP_440358.1_8 Forward -256 -237 -0.885524 0.274
NP_442805.1_3 Reverse -32 -51 18.9699 0.144
NP_440114.1_10 Forward -321 -307 7.47274 0.235
NP_440114.1_10 Reverse -312 -326 6.09611 0.285
NP_440114.1_10 Forward -389 -375 5.80112 0.292
NP_440935.1_4 Forward -340 -322 18.0129 0.209
NP_441425.1_2 Forward -111 -92 13.0324 0.247
NP_440287.1_5 Forward -184 -165 9.83173 0.286
NP_440293.1_3 Forward -396 -377 2.75272 0.194
NP_439988.1_3 Forward -325 -311 10.226 0.228
NP_440457.1_1 Forward -393 -381 10.0687 0.092
NP_440457.1_1 Forward -325 -313 8.59377 0.101
NP_441801.1_4 Reverse -181 -191 3.12662 0.231
NP_442680.1_5 Forward -39 -20 9.05975 0.154
NP_440942.1_3 Reverse -159 -178 1.17943 0.298
NP_440942.1_6 Reverse -142 -161 4.32522 0.289
NP_440142.1_9 Forward -345 -331 11.9953 0.289
NP_441332.1_4 Reverse -14 -33 3.6377 0.293
NP_442509.1_9 Reverse -380 -390 7.15773 0.234
NP_441489.1_3 Forward -40 -26 9.46532 0.232
NP_442514.1_5 Reverse -316 -335 0.195343 0.178
NP_442862.1_3 Reverse -7 -24 5.15205 0.28
NP_441885.1_5 Forward -272 -262 -0.904945 0.241
NP_441173.1_9 Reverse -351 -359 13.1954 0.184
NP_441173.1_9 Reverse -31 -39 13.1954 0.184
NP_441173.1_9 Reverse -276 -284 10.2454 0.261
NP_441173.1_9 Forward -171 -163 10.1471 0.261
NP_442395.2_4 Forward -222 -203 1.76863 0.234
NP_442513.1_5 Forward -345 -326 6.39016 0.282
NP_440560.1_5 Forward -174 -155 17.6202 0.0646
NP_443046.1_1 Forward -397 -378 20.6064 0.0291
NP_442275.1_1 Reverse -270 -289 -0.295539 0.295
NP_441902.1_3 Reverse -162 -172 12.9817 0.23
NP_441105.1_3 Reverse -51 -70 -6.1954 0.23
NP_441105.1_3 Reverse -283 -302 -9.63698 0.292
NP_440172.1_1 Reverse -101 -111 2.83163 0.264
NP_440416.1_9 Reverse -311 -330 -20.8467 0.289
NP_442116.1_6 Forward -33 -16 13.421 0.172
NP_442116.1_6 Reverse -16 -33 5.59067 0.293
NP_442116.1_6 Reverse -118 -135 5.3042 0.299
NP_442226.1_3 Reverse -278 -297 23.0496 0.0227
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TATTGCAGCCGGGGGATTGGGTCAATTTAGAGGGGGATATTTTGGGTAAATATGCGGCCCGATTTTTGTCCCGGGGTCGGGCCATGGGTCAAACAAAGGACATCGATCTAGCCTTTTTGGCGGAACATGGCTACGGCTAAGAAAGTGTTTGAAAAGTGCAAGGCTAGGTATTTATCCCCCTAAATCGACCCACTAAAGCTCCGGCAATACTGGGGGAGTTTCACTCAGTTTCCCCCCAAATTTGGGGGGTCAGGGGGGCTTTTGAAACATGCTCTAAGAATTTTGGGATCAGAAATTGCCTTTTAAATTCAAATTTAATCAAATTAAATTGCCTTTGCTCCACCCAATTGTTTTGCTAGGCTGGGGAAAAATATTGCAAAATTTGCCTAGACTTGCTCCT

CDS

ATGTCTTCTTTCCTCGTTTTTAGCTGGCGGCGATGGTTACAAATACTCATCCTGGCGATCGCCTTGGTGTTGCTCTGGGCGCCATCGGCCTTGGCCCAAGCCAATACGGTGAACTATACCTACGGAGATCTGGCCCGATCAGATTTTTCCCACCAGGATTTGAATAAGGCGGTATTTGCGGCGGCGGATTTACGGGAAAGCAATTTTGAGGGCAGTGATCTCAGCTTTTCCATCCTCACCGATGCAGTTTTTCTCCATGCCAGTTTACGGGGAGCGAATCTAAGTGGTTCCCTCGTAGACCGGGTTACCCTGGATTTTGCCGACCTGCGGGACACTATTTTCACCGAGGCGATCGCCACCCGCACCCGTTTTTACGACACCGATATCACCGGGGCCGACTTCAGCGATGCGGTGATTGATGCTTACCAAGTCAAGCTGATGTGTGAACGGGCGGAGGGAGTTAATCCAGTGACAGGGGTAGCTACCAGGGATAGTTTGGGTTGCAGATAG

Protein

MSSFLVFSWRRWLQILILAIALVLLWAPSALAQANTVNYTYGDLARSDFSHQDLNKAVFAAADLRESNFEGSDLSFSILTDAVFLHASLRGANLSGSLVDRVTLDFADLRDTIFTEAIATRTRFYDTDITGADFSDAVIDAYQVKLMCERAEGVNPVTGVATRDSLGCR