Your browser is old and dusty. Try Google Chrome!

Details for sll0300

ORF sll0300
Accession NP_441957.1
Symbol ribC
Category Riboflavin
Definition riboflavin synthase alpha chain
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -47 -61 8.65272 0.0856
NP_441061.1_2 Reverse -115 -129 6.09611 0.126
NP_440557.1_1 Forward -190 -171 -1.27885 0.271
NP_440897.1_6 Reverse -201 -220 -3.14789 0.233
NP_441453.1_4 Forward -61 -53 4.34598 0.257
NP_441623.1_1 Forward -83 -65 -3.6191 0.262
NP_441818.1_9 Reverse -44 -63 -3.63879 0.228
NP_440348.1_2 Reverse -51 -70 19.194 0.162
NP_442752.1_4 Reverse -338 -345 10.8555 0.0846
NP_443027.1_4 Reverse -50 -60 9.7148 0.153
NP_443027.1_4 Forward -63 -53 5.87989 0.294
NP_442909.1_7 Forward -82 -68 7.96378 0.194
NP_442861.1_1 Forward -336 -317 16.3224 0.218
NP_440061.1_9 Forward -57 -43 7.96378 0.185
NP_441054.1_4 Reverse -269 -287 -2.3408 0.23
NP_442062.1_8 Reverse -46 -56 2.92996 0.292
NP_440044.1_8 Reverse -339 -358 -3.93378 0.295
NP_440370.1_10 Reverse -371 -390 9.24257 0.231
NP_442110.1_7 Forward -61 -47 3.93283 0.209
NP_441925.1_4 Forward -84 -65 -9.53937 0.222
NP_440856.1_7 Reverse -80 -99 -9.63698 0.294
NP_441738.1_2 Forward -286 -279 8.29857 0.176
NP_442570.1_3 Forward -63 -44 2.26107 0.189
NP_440538.1_10 Forward -57 -38 12.5858 0.235
NP_441624.1_7 Forward -61 -47 9.2427 0.223
NP_441624.1_7 Reverse -115 -129 6.78443 0.275
NP_441163.1_4 Forward -71 -52 11.7587 0.297
NP_440747.1_10 Forward -58 -46 -11.7607 0.142
NP_442634.1_4 Forward -63 -49 -4.22864 0.19
NP_440842.1_10 Forward -164 -150 1.67122 0.286
NP_441012.1_4 Reverse -48 -61 8.18076 0.272
NP_441012.1_4 Forward -59 -46 6.70579 0.276
NP_443018.1_3 Forward -60 -53 12.5271 0.0523
NP_443018.1_3 Reverse -53 -60 12.5271 0.0523
NP_440376.1_1 Forward -55 -46 4.62128 0.154
NP_440376.1_1 Forward -168 -159 2.06468 0.236
NP_442687.1_7 Reverse -45 -55 4.79825 0.234
NP_442485.1_3 Reverse -41 -60 9.0459 0.123
NP_441013.1_2 Forward -66 -48 7.29564 0.208
NP_441422.1_7 Forward -63 -46 -1.0428 0.178
NP_442658.1_1 Forward -63 -53 5.97777 0.242
NP_440318.1_1 Forward -377 -358 1.27776 0.284
NP_440203.1_5 Reverse -49 -59 14.4342 0.0886
NP_441754.1_6 Reverse -372 -391 15.1424 0.129
NP_439990.1_7 Forward -336 -317 12.4875 0.18
NP_442064.1_4 Forward -65 -46 9.24175 0.209
NP_440993.1_4 Reverse -46 -63 12.4285 0.171
NP_442002.1_9 Forward -333 -326 11.1505 0.185
NP_441712.1_1 Forward -39 -20 9.23101 0.289
NP_441041.1_4 Forward -61 -42 -4.13045 0.13
NP_441041.1_4 Forward -161 -142 -7.67036 0.191
NP_441041.1_4 Forward -197 -178 -13.1769 0.282
NP_440569.1_10 Forward -341 -322 16.6629 0.0915
NP_440703.1_9 Reverse -355 -368 4.83694 0.293
NP_440260.1_8 Reverse -43 -61 -5.58572 0.275
NP_441514.1_4 Reverse -267 -286 14.7358 0.226
NP_442281.1_1 Forward -66 -52 3.8339 0.217
NP_440437.1_1 Forward -98 -79 -3.54046 0.239
NP_442049.1_4 Forward -60 -41 -5.21209 0.279
NP_441087.1_6 Forward -348 -330 -3.61981 0.296
NP_441556.1_10 Reverse -41 -55 11.5845 0.223
NP_441644.1_6 Forward -61 -51 10.796 0.0609
NP_442215.1_2 Reverse -44 -60 -1.02311 0.177
NP_442215.1_2 Forward -132 -116 -6.92296 0.281
NP_442177.1_5 Forward -273 -259 7.66941 0.293
NP_440566.1_10 Reverse -172 -189 19.1151 0.201
NP_442554.1_8 Forward -60 -50 11.4848 0.0355
NP_442554.1_8 Reverse -53 -63 2.33998 0.274
NP_442142.1_4 Reverse -49 -62 7.39353 0.141
NP_442292.1_1 Forward -60 -51 4.22796 0.181
NP_442999.1_1 Reverse -293 -312 17.994 0.0235
NP_442381.1_8 Forward -371 -352 -7.96535 0.207
NP_442406.1_9 Reverse -45 -64 1.67108 0.274
NP_442076.1_5 Reverse -299 -318 5.60432 0.292
NP_440183.1_9 Reverse -54 -73 -14.2585 0.263
NP_440379.1_5 Reverse -43 -62 8.16093 0.133
NP_441468.1_1 Reverse -53 -60 3.97235 0.277
NP_441468.1_1 Forward -60 -53 3.97235 0.277
NP_441020.2_6 Forward -171 -154 6.62702 0.26
NP_441020.2_7 Forward -89 -70 6.78348 0.276
NP_441015.1_10 Reverse -47 -66 5.80098 0.112
NP_441015.1_10 Reverse -81 -100 -8.55534 0.276
NP_441339.1_4 Forward -62 -43 7.27595 0.145
NP_440265.1_7 Forward -61 -47 14.8469 0.281
NP_441876.1_9 Forward -50 -40 10.4026 0.293
NP_441330.1_1 Forward -66 -47 -15.6352 0.289
NP_441764.1_8 Reverse -265 -275 11.3107 0.284
NP_442868.1_6 Reverse -158 -168 3.12662 0.202
NP_442719.1_2 Reverse -314 -332 -11.3879 0.291
NP_441612.1_2 Forward -210 -200 12.5186 0.21
NP_442227.1_2 Forward -99 -80 2.94938 0.223
NP_442808.1_1 Reverse -158 -168 2.43787 0.266
NP_442775.1_6 Forward -66 -47 10.8159 0.277
NP_442050.1_8 Reverse -80 -99 14.9603 0.272
NP_442342.1_9 Forward -63 -47 3.50012 0.26
NP_440558.1_2 Reverse -43 -62 12.8808 0.0742
NP_442576.1_2 Forward -331 -312 13.5691 0.242
NP_442789.1_4 Reverse -81 -100 -2.75381 0.242
NP_442789.1_4 Reverse -41 -60 -6.78538 0.288
NP_441878.1_6 Reverse -45 -55 1.55333 0.0937
NP_441878.1_6 Forward -56 -46 -6.70647 0.194
NP_441445.1_1 Reverse -77 -96 3.73603 0.208
NP_442066.2_4 Forward -92 -73 -8.65367 0.294
NP_442419.1_2 Forward -66 -47 -3.3438 0.259
NP_441739.1_2 Forward -331 -315 2.61447 0.288
NP_440101.1_3 Reverse -78 -97 1.57275 0.27
NP_441549.1_9 Reverse -42 -60 -8.43732 0.228
NP_442594.1_8 Reverse -368 -387 1.57275 0.299
NP_441633.1_3 Reverse -154 -167 -4.60227 0.205
NP_441633.1_3 Forward -57 -44 -6.96221 0.283
NP_442590.1_10 Reverse -40 -59 4.62101 0.273
NP_442998.1_5 Forward -334 -324 15.5163 0.149
NP_440640.1_6 Reverse -47 -66 4.62101 0.212
NP_441007.1_10 Reverse -375 -388 0.215946 0.241
NP_440256.1_1 Reverse -49 -68 3.24438 0.0553
NP_440256.1_1 Forward -350 -331 -8.94866 0.27
NP_441559.1_8 Forward -173 -159 -5.01529 0.245
NP_441559.1_8 Forward -60 -46 -6.58858 0.279
NP_441559.1_8 Reverse -318 -332 -6.78525 0.279
NP_440915.1_6 Forward -65 -51 -0.492064 0.197
NP_441179.1_9 Forward -63 -53 13.6475 0.246
NP_442031.1_3 Forward -73 -54 10.6192 0.164
NP_440306.1_4 Forward -182 -163 6.58763 0.299
NP_442957.1_9 Reverse -38 -57 18.879 0.0919
NP_440677.1_1 Forward -225 -206 7.37428 0.239
NP_442386.1_9 Forward -62 -53 13.1756 0.0406
NP_440570.1_5 Forward -65 -46 2.75272 0.234
NP_441340.1_5 Reverse -53 -60 4.07068 0.239
NP_441340.1_5 Forward -60 -53 4.07068 0.239
NP_440586.1_1 Reverse -42 -61 -5.40875 0.285
NP_440586.1_8 Forward -60 -53 7.61025 0.227
NP_440586.1_8 Reverse -53 -60 7.61025 0.227
NP_439984.1_1 Reverse -310 -329 11.162 0.258
NP_439937.1_9 Forward -57 -40 -10.0899 0.221
NP_440408.1_7 Forward -130 -111 9.93088 0.253
NP_440408.1_7 Reverse -46 -65 6.88262 0.298
NP_440819.1_5 Reverse -237 -245 15.8507 0.185
NP_440819.1_5 Reverse -367 -375 7.8859 0.266
NP_439977.1_5 Forward -67 -48 -2.55715 0.284
NP_442384.1_10 Reverse -159 -172 1.39592 0.26
NP_441018.1_7 Forward -65 -46 11.3075 0.188
NP_442262.1_10 Forward -60 -53 10.4622 0.145
NP_442262.1_10 Reverse -53 -60 10.4622 0.145
NP_440297.1_8 Forward -169 -151 10.6389 0.262
NP_440297.1_9 Forward -60 -50 9.51814 0.0917
NP_440297.1_9 Reverse -47 -57 3.91327 0.253
NP_442280.1_10 Forward -65 -47 4.87002 0.292
NP_442147.1_2 Reverse -57 -76 9.14423 0.293
NP_440491.1_1 Reverse -80 -99 7.4043 0.268
NP_442033.1_10 Reverse -44 -63 -11.8986 0.26
NP_442845.1_2 Reverse -46 -60 7.57108 0.195
NP_441469.1_8 Forward -62 -53 5.60459 0.258
NP_443064.1_6 Forward -347 -337 9.46426 0.219
NP_442337.1_6 Reverse -33 -52 13.3488 0.257
NP_441306.1_10 Reverse -37 -51 14.3553 0.25
NP_441621.1_7 Forward -391 -377 3.24451 0.116
NP_443062.1_1 Forward -61 -43 4.2556 0.268
NP_442204.1_1 Reverse -48 -59 0.550326 0.281
NP_442204.1_5 Forward -165 -146 2.45773 0.212
NP_442204.1_9 Forward -65 -47 17.1322 0.235
NP_442428.1_5 Forward -60 -53 4.36568 0.271
NP_442428.1_5 Reverse -53 -60 4.36568 0.271
NP_442120.1_10 Reverse -40 -59 -15.8318 0.296
NP_442823.1_8 Reverse -5 -24 11.8975 0.275
NP_441867.1_2 Reverse -89 -108 -5.50708 0.189
NP_440436.1_4 Reverse -53 -62 4.42421 0.265
NP_442873.1_5 Forward -87 -68 10.6184 0.246
NP_441115.1_4 Reverse -51 -69 13.883 0.067
NP_443054.1_2 Forward -57 -43 1.37622 0.247
NP_442622.1_1 Reverse -105 -124 -12.7836 0.276
NP_441542.1_4 Forward -326 -312 3.93283 0.264
NP_442856.1_7 Reverse -43 -62 -3.14714 0.241
NP_442515.1_1 Forward -56 -42 1.86788 0.147
NP_441540.1_5 Forward -32 -14 15.7513 0.237
NP_441982.1_6 Reverse -236 -245 11.053 0.288
NP_440338.1_4 Reverse -9 -28 6.09517 0.292
NP_442689.1_8 Reverse -314 -331 -7.72931 0.292
NP_441349.1_10 Forward -357 -338 -6.1954 0.223
NP_440432.1_9 Forward -346 -331 -5.03498 0.233
NP_441570.1_1 Reverse -46 -64 -9.22396 0.132
NP_441078.1_4 Forward -55 -46 -1.37691 0.254
NP_442729.1_7 Reverse -119 -137 12.3105 0.212
NP_442729.1_8 Reverse -275 -288 8.77074 0.125
NP_440707.1_6 Reverse -315 -334 10.815 0.274
NP_442443.1_1 Reverse -60 -79 -1.47551 0.236
NP_441432.1_8 Forward -56 -47 12.2911 0.0444
NP_441732.1_2 Forward -59 -43 -16.0677 0.164
NP_442540.1_5 Reverse -47 -66 12.6833 0.233
NP_440759.1_6 Forward -162 -143 -0.000545616 0.284
NP_442400.1_10 Reverse -324 -337 8.56056 0.278
NP_440713.1_4 Forward -65 -46 3.93269 0.234
NP_442489.1_7 Forward -55 -46 -1.37691 0.195
NP_442489.1_7 Reverse -46 -55 -1.6719 0.235
NP_440757.1_7 Forward -60 -42 -0.0791831 0.269
NP_441659.2_8 Forward -61 -51 3.51995 0.157
NP_441040.1_2 Reverse -72 -91 -13.3736 0.279
NP_440708.1_6 Forward -99 -80 -10.6203 0.282
NP_442346.1_1 Reverse -65 -84 10.2259 0.27
NP_442346.1_5 Reverse -51 -61 4.40493 0.29
NP_440545.1_3 Forward -59 -42 -5.46769 0.25
NP_440545.1_3 Reverse -43 -60 -7.13932 0.298
NP_440831.1_3 Forward -84 -65 5.02806 0.29
NP_440486.1_6 Reverse -280 -299 7.17762 0.278
NP_441888.1_7 Forward -66 -52 1.57289 0.245
NP_440449.1_6 Reverse -151 -169 8.15857 0.206
NP_441047.1_2 Reverse -47 -66 -1.57384 0.267
NP_441895.1_2 Reverse -262 -281 -17.8968 0.234
NP_441895.1_10 Reverse -364 -383 -27.8282 0.299
NP_442699.1_8 Reverse -56 -75 -12.7836 0.257
NP_440671.1_4 Reverse -46 -60 7.76774 0.208
NP_442943.1_1 Forward -329 -314 21.3851 0.0725
NP_442140.1_3 Reverse -53 -63 9.12481 0.111
NP_440875.1_9 Reverse -382 -392 11.7788 0.152
NP_440875.1_9 Reverse -49 -59 7.00932 0.287
NP_442497.1_1 Forward -55 -36 7.96345 0.275
NP_441239.1_9 Reverse -50 -62 10.6587 0.0742
NP_441239.1_9 Forward -63 -51 8.59377 0.128
NP_441239.1_9 Forward -46 -34 4.5622 0.251
NP_442270.1_9 Forward -66 -47 -5.40875 0.206
NP_442138.1_1 Forward -63 -44 3.24359 0.24
NP_440412.1_2 Reverse -145 -164 11.3075 0.281
NP_442809.1_6 Forward -167 -148 0.58944 0.288
NP_441230.1_5 Forward -66 -47 0.687771 0.263
NP_442340.1_3 Forward -131 -112 -6.1954 0.223
NP_442499.1_1 Forward -60 -41 6.58763 0.203
NP_442787.1_9 Forward -338 -319 15.7324 0.296
NP_442479.1_9 Forward -331 -312 -8.45701 0.266
NP_441084.1_6 Reverse -50 -64 11.1863 0.214
NP_440696.1_6 Reverse -35 -54 11.7008 0.207
NP_442023.1_2 Forward -163 -144 7.27595 0.272
NP_442039.1_7 Reverse -39 -49 8.4365 0.263
NP_441811.1_1 Forward -76 -57 6.78429 0.28
NP_440160.1_2 Reverse -34 -53 -9.34199 0.293
NP_440505.1_7 Forward -59 -40 6.78429 0.162
NP_441701.1_3 Reverse -37 -54 6.03703 0.294
NP_441959.1_7 Reverse -322 -336 18.9775 0.179
NP_441252.1_6 Forward -335 -328 14.3954 0.168
NP_441408.2_7 Reverse -44 -63 -1.08219 0.244
NP_440914.1_1 Reverse -47 -57 8.41992 0.191
NP_440914.1_1 Forward -161 -151 7.83437 0.219
NP_441011.1_8 Reverse -53 -62 5.01461 0.289
NP_442533.1_1 Reverse -80 -99 -6.39206 0.17
NP_442533.1_6 Reverse -52 -61 4.62128 0.179
NP_442322.1_4 Forward -69 -52 -9.69657 0.296
NP_441482.1_7 Forward -61 -47 -9.44018 0.202
NP_441482.1_7 Reverse -46 -60 -11.7018 0.281
NP_441028.1_6 Forward -70 -60 3.42118 0.296
NP_441680.1_4 Reverse -154 -173 0.294447 0.246
NP_441106.1_1 Forward -62 -53 4.32629 0.227
NP_441106.1_1 Reverse -379 -388 2.26134 0.293
NP_442704.1_7 Reverse -226 -245 13.1758 0.181
NP_441286.1_1 Forward -56 -44 -4.77924 0.175
NP_442401.1_2 Forward -84 -65 16.8132 0.0964
NP_440664.1_9 Reverse -372 -391 8.65258 0.259
NP_442264.1_2 Reverse -42 -59 14.6902 0.128
NP_441463.1_6 Forward -57 -43 10.088 0.242
NP_442794.1_1 Forward -59 -47 5.05386 0.236
NP_442794.1_1 Reverse -184 -196 4.5622 0.256
NP_441431.1_2 Forward -49 -35 5.99717 0.281
NP_442020.1_1 Reverse -313 -332 4.22689 0.251
NP_441836.1_2 Reverse -80 -99 2.75272 0.165
NP_441993.1_1 Forward -55 -36 4.48058 0.22
NP_441993.1_1 Reverse -46 -65 4.09075 0.225
NP_441993.1_4 Reverse -380 -399 8.16011 0.285
NP_440143.1_1 Reverse -83 -102 13.0775 0.284
NP_442323.1_7 Forward -282 -263 5.70185 0.202
NP_440492.1_4 Forward -328 -309 15.5354 0.19
NP_441500.1_6 Forward -338 -320 16.1454 0.168
NP_440293.1_3 Forward -63 -44 2.3594 0.199
NP_440293.1_3 Reverse -74 -93 -2.16383 0.239
NP_440293.1_3 Reverse -56 -75 -6.1954 0.287
NP_440766.1_4 Reverse -48 -62 0.196253 0.298
NP_440766.1_5 Reverse -3 -15 9.75661 0.275
NP_439988.1_3 Forward -60 -46 9.04604 0.249
NP_439988.1_10 Forward -38 -19 8.15482 0.226
NP_441237.1_9 Forward -55 -45 10.6981 0.22
NP_440801.1_8 Forward -84 -65 -2.26216 0.298
NP_441496.1_1 Reverse -319 -333 13.1895 0.294
NP_442514.1_5 Reverse -145 -164 -9.83437 0.298
NP_440554.1_4 Reverse -53 -63 5.87989 0.129
NP_440554.1_4 Forward -60 -50 4.69992 0.181
NP_442310.1_1 Forward -63 -44 15.7324 0.138
NP_442534.1_1 Reverse -7 -26 8.65258 0.241
NP_443000.1_3 Forward -169 -150 11.6195 0.255
NP_440507.2_3 Reverse -43 -62 9.93006 0.213
NP_440091.1_1 Forward -351 -339 4.26721 0.14
NP_442451.1_2 Forward -63 -44 -8.26035 0.244
NP_440175.1_7 Forward -65 -47 10.339 0.257
NP_440149.1_8 Reverse -46 -65 4.52268 0.0824
NP_440149.1_10 Forward -55 -36 -11.4069 0.285
NP_441105.1_3 Reverse -41 -60 -9.53865 0.29
NP_442373.1_2 Reverse -56 -75 -11.8986 0.297
NP_440216.1_9 Forward -159 -150 6.78456 0.289
NP_440216.1_9 Forward -195 -186 6.09625 0.289
NP_440172.1_1 Forward -332 -322 2.24165 0.279
NP_441766.1_2 Forward -368 -359 1.76968 0.276
NP_440416.1_9 Reverse -45 -64 -16.1268 0.208
NP_440416.1_9 Reverse -152 -171 -20.2567 0.283
NP_443052.1_9 Forward -78 -59 -1.47551 0.228
NP_443052.1_9 Forward -93 -74 -2.95047 0.244
NP_443052.1_9 Forward -66 -47 -4.6221 0.259
NP_442116.1_6 Reverse -232 -249 6.73658 0.271
NP_441940.1_5 Reverse -70 -89 21.7697 0.0328
NP_440591.1_9 Reverse -45 -63 6.80398 0.215
NP_440261.1_5 Forward -54 -41 3.26421 0.0649
NP_440261.1_5 Forward -91 -78 -11.3871 0.259
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGCTCGTAAGCTTCCATCGTCTCGATTTTACCCGCTGTCTCTAGGTTACAAATAACGCTCACCTTTTGGGCAAATTCTTGCAAATTTGCGTTGAAAACCAGCTTCTCCGGTTTGAAATCCCCATAATATTTGCTTTTGGGATACAGAAATGCGTCTTTTTCCGGATTATCAGTCATATCATCTCTTCGACGGACAAGAACAGTACCCATTGTAAAGGTATTGACCGTTTTCCGGGGTTGACCGAAGGCAAAGGTATGCTTAATTGAGACCAGATAATGCCAAGGGAACTCTAGACTCGTTTCCCTAACCTTGACCACCCCGAGCTGCAACTCTCCCTCCAGCCATGGCATTGGCCCCCAACTGGCACAATTGTAATTAATCTTCTAAGGTTTGTCCCATT

CDS

GTGTTCACTGGCATTATCCAATCCCTCGGTTATCTTTCTGCTCAGCGGGCCGATCGCCTGGAAATTTCCCTTAGCCCCAACGATGCCCAACGGGTTTTGGGGGATATGGCCCTAGGGGACAGCATTGCTGTAGATGGGGTTTGCCTCACCGTAGAGGCGATCGCCCACCAGGGATTTTTTGCCGACGTTTCCCCCGAAACCTTACAACGCACTACCTTAGGACGGGCTAAGGAAAGGCGCACAGCGGTCAACATTGAAACTTCCCTCCGGGTGGGGGGAAAAGTGGGGGGGCATTTTGTTTCCGGCCACGTGGACGGGGTAGGGCAATTATTGAGCAATGAACAAATCAATAACGCCTGGTTGCTCAGCTTCGGCTCAGTGGGCAGTTTACAGAAGCAATGGCAGGAATATTTAGCTCCCTATTTGGTGCCCAAGGGTAGTATTGCCGTCAATGGCATCAGTTTAACCGTGGCGGATTGCGGCGAAGACTGGTTTAACGTGGCCGTGATTCCCCATACCTACAGCGAAACTAATTTGCAGTTATTGCAGCCGGGGGATTGGGTCAATTTAGAGGGGGATATTTTGGGTAAATATGCGGCCCGATTTTTGTCCCGGGGTCGGGCCATGGGTCAAACAAAGGACATCGATCTAGCCTTTTTGGCGGAACATGGCTACGGCTAA

Protein

MFTGIIQSLGYLSAQRADRLEISLSPNDAQRVLGDMALGDSIAVDGVCLTVEAIAHQGFFADVSPETLQRTTLGRAKERRTAVNIETSLRVGGKVGGHFVSGHVDGVGQLLSNEQINNAWLLSFGSVGSLQKQWQEYLAPYLVPKGSIAVNGISLTVADCGEDWFNVAVIPHTYSETNLQLLQPGDWVNLEGDILGKYAARFLSRGRAMGQTKDIDLAFLAEHGYG