Your browser is old and dusty. Try Google Chrome!

Details for sll0288

ORF sll0288
Accession NP_442593.1
Symbol minC
Category Cell division
Definition septum site-determining protein MinC
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440897.1_6 Forward -72 -53 2.35861 0.165
NP_441453.1_7 Forward -79 -72 12.9205 0.23
NP_441818.1_9 Reverse -108 -127 -2.65548 0.208
NP_442752.1_4 Forward -33 -26 10.8555 0.0846
NP_442752.1_4 Forward -374 -367 5.54565 0.194
NP_442000.2_3 Forward -322 -303 14.2574 0.27
NP_441054.1_2 Reverse -90 -109 9.83255 0.284
NP_440878.1_9 Reverse -47 -66 2.85105 0.174
NP_442062.1_8 Forward -374 -364 3.61828 0.26
NP_440011.1_1 Reverse -107 -126 12.4875 0.264
NP_439918.1_2 Forward -306 -287 -0.885524 0.236
NP_440132.1_6 Forward -58 -39 18.9773 0.0526
NP_440856.1_7 Forward -323 -304 -8.35868 0.27
NP_441434.1_7 Forward -260 -246 12.8809 0.106
NP_441942.1_5 Forward -88 -69 15.1424 0.146
NP_440209.1_1 Forward -33 -25 5.0343 0.194
NP_442570.1_8 Reverse -99 -117 12.8022 0.179
NP_441716.1_1 Forward -33 -19 4.12949 0.258
NP_440343.1_3 Reverse -57 -75 4.14829 0.266
NP_440906.1_5 Reverse -25 -32 8.79057 0.149
NP_440747.1_10 Reverse -21 -33 -12.1541 0.227
NP_441854.1_10 Reverse -101 -120 0.58944 0.282
NP_440842.1_10 Forward -120 -106 12.6843 0.251
NP_441014.1_8 Forward -124 -105 -2.75381 0.238
NP_441012.1_4 Forward -357 -344 5.72248 0.291
NP_443065.1_9 Reverse -77 -96 10.5209 0.231
NP_442687.1_1 Forward -20 -7 15.1616 0.243
NP_441077.1_6 Reverse -2 -18 4.05516 0.261
NP_441077.1_6 Reverse -1 -17 3.09109 0.272
NP_441846.1_10 Forward -299 -280 -21.0434 0.256
NP_442658.1_9 Reverse -338 -357 12.5858 0.28
NP_440141.1_10 Forward -136 -117 -1.37794 0.19
NP_440656.1_2 Reverse -42 -61 3.34271 0.221
NP_442836.1_10 Forward -65 -55 11.2881 0.269
NP_440203.1_5 Reverse -368 -378 8.82935 0.283
NP_442911.1_2 Reverse -14 -33 -4.03212 0.124
NP_440369.1_5 Forward -58 -39 9.73422 0.272
NP_440993.1_3 Reverse -51 -70 -0.886293 0.273
NP_442002.1_9 Forward -34 -27 14.1004 0.074
NP_441646.1_1 Reverse -265 -284 0.491109 0.251
NP_442566.1_2 Forward -361 -342 1.17943 0.289
NP_442885.1_2 Reverse -347 -366 14.8474 0.154
NP_442884.1_3 Forward -257 -238 16.4207 0.251
NP_440569.1_5 Forward -81 -62 13.5691 0.158
NP_442996.1_7 Forward -25 -6 12.0296 0.296
NP_441547.1_2 Reverse -103 -121 3.55906 0.281
NP_441725.1_5 Reverse -25 -35 1.55333 0.133
NP_439966.1_9 Reverse -147 -156 6.39124 0.253
NP_442941.1_3 Reverse -25 -35 -0.609952 0.264
NP_440674.1_3 Reverse -114 -133 0.982764 0.284
NP_440289.1_2 Forward -36 -23 -3.4223 0.267
NP_441514.1_1 Reverse -134 -144 13.8676 0.284
NP_441079.1_1 Forward -307 -288 20.2556 0.0998
NP_441079.1_7 Reverse -1 -20 -2.8529 0.223
NP_441079.1_7 Forward -21 -2 -5.80282 0.268
NP_442847.1_3 Forward -260 -241 7.57013 0.235
NP_442575.1_8 Forward -65 -46 -5.99873 0.277
NP_440437.1_1 Forward -268 -249 8.55425 0.0559
NP_440437.1_1 Reverse -18 -37 -2.55715 0.219
NP_440437.1_1 Reverse -359 -378 -3.14714 0.232
NP_441310.1_10 Forward -62 -52 14.4292 0.279
NP_442671.1_2 Reverse -1 -20 3.34057 0.194
NP_441751.2_8 Reverse -25 -39 -6.19526 0.255
NP_441711.1_2 Reverse -57 -76 12.1917 0.27
NP_443009.1_5 Forward -34 -23 5.76138 0.189
NP_443009.1_5 Reverse -23 -34 3.49977 0.292
NP_440464.1_10 Reverse -366 -376 15.0135 0.169
NP_441876.1_9 Reverse -194 -204 10.5993 0.287
NP_441876.1_9 Reverse -367 -377 10.4026 0.293
NP_441393.1_2 Reverse -343 -362 13.5496 0.272
NP_441764.1_6 Forward -375 -364 16.2833 0.284
NP_441764.1_8 Forward -24 -14 11.3107 0.284
NP_442719.1_2 Forward -365 -347 -9.42131 0.264
NP_442677.1_3 Forward -90 -71 -1.7705 0.257
NP_441612.1_2 Reverse -128 -138 8.6461 0.21
NP_442227.1_2 Reverse -56 -75 5.211 0.202
NP_442227.1_2 Reverse -276 -295 -3.04881 0.289
NP_442113.1_10 Reverse -267 -286 -9.14533 0.294
NP_442050.1_1 Forward -318 -299 15.3391 0.187
NP_442050.1_1 Reverse -112 -131 7.27595 0.274
NP_442342.1_9 Forward -308 -292 4.68009 0.245
NP_440111.2_2 Reverse -234 -253 -0.787193 0.223
NP_442789.1_4 Forward -322 -303 3.73603 0.162
NP_442593.1_3 Forward -78 -59 21.3361 0.0759
NP_441878.1_10 Forward -360 -346 18.2892 0.268
NP_441036.1_3 Forward -59 -40 1.96607 0.168
NP_441445.1_8 Reverse -110 -129 -11.5053 0.277
NP_440084.1_8 Forward -18 -4 16.2452 0.18
NP_440084.1_8 Reverse -6 -20 9.17885 0.29
NP_442347.1_2 Reverse -366 -375 17.7976 0.056
NP_441037.1_4 Forward -35 -25 6.34312 0.267
NP_442594.1_7 Reverse -39 -58 19.1731 0.0492
NP_440151.1_2 Reverse -307 -325 13.9813 0.277
NP_441633.1_3 Reverse -228 -241 11.524 0.0286
NP_440136.1_2 Reverse -25 -32 3.97235 0.288
NP_442998.1_10 Reverse -26 -33 6.0373 0.205
NP_440640.1_6 Reverse -80 -99 3.14605 0.227
NP_442158.1_4 Reverse -106 -116 10.6981 0.283
NP_442993.1_1 Reverse -24 -40 -8.39793 0.166
NP_440327.1_6 Forward -300 -281 7.07928 0.228
NP_441912.1_3 Forward -306 -287 8.16093 0.27
NP_439937.1_9 Reverse -360 -377 -10.1882 0.224
NP_439937.1_9 Reverse -312 -329 -12.0565 0.269
NP_439937.1_9 Forward -357 -340 -12.7448 0.276
NP_439937.1_9 Forward -34 -17 -15.4981 0.287
NP_440171.1_3 Forward -242 -223 6.78429 0.259
NP_440316.1_10 Forward -67 -57 9.61647 0.235
NP_440316.1_10 Forward -289 -279 6.8632 0.251
NP_440139.1_1 Forward -72 -53 2.26028 0.235
NP_440267.1_2 Reverse -360 -374 7.86545 0.187
NP_442384.1_10 Reverse -365 -378 4.05085 0.17
NP_440344.1_10 Forward -234 -217 -12.8425 0.267
NP_441965.1_10 Reverse -362 -378 3.10679 0.274
NP_440297.1_9 Reverse -25 -35 -0.41329 0.283
NP_442067.1_4 Forward -128 -109 5.211 0.244
NP_440999.1_9 Reverse -226 -240 -2.16369 0.261
NP_440888.1_2 Reverse -61 -75 6.48882 0.232
NP_440491.1_1 Reverse -77 -96 7.20938 0.274
NP_440575.1_1 Forward -143 -124 -3.14789 0.294
NP_441178.1_6 Forward -127 -108 3.34192 0.269
NP_442710.1_7 Reverse -2 -21 -8.18384 0.299
NP_442337.1_8 Forward -267 -248 1.0811 0.241
NP_442578.1_5 Reverse -279 -298 1.37609 0.257
NP_440710.1_1 Reverse -56 -74 -6.86402 0.228
NP_441621.1_7 Forward -319 -305 3.63784 0.106
NP_440255.1_3 Forward -11 -1 14.0586 0.298
NP_440516.1_8 Forward -66 -57 0.0980582 0.143
NP_440783.1_5 Forward -300 -281 -5.31042 0.276
NP_442219.1_9 Reverse -366 -375 1.76968 0.298
NP_442366.1_5 Forward -377 -367 13.7459 0.0636
NP_440296.1_6 Forward -19 -1 14.8032 0.283
NP_440328.1_4 Reverse -70 -89 -1.08219 0.298
NP_442312.1_1 Reverse -335 -354 14.3558 0.211
NP_443054.1_2 Forward -42 -28 -0.0987402 0.284
NP_441851.1_10 Forward -34 -24 5.68323 0.203
NP_441851.1_10 Reverse -23 -33 4.89658 0.24
NP_442939.1_3 Forward -210 -196 14.9084 0.288
NP_441982.1_6 Forward -150 -141 11.244 0.288
NP_440463.1_8 Reverse -270 -289 4.88595 0.297
NP_441046.1_2 Reverse -135 -154 -2.26216 0.299
NP_441409.1_6 Reverse -18 -37 -14.5535 0.259
NP_442843.1_1 Reverse -330 -349 -10.227 0.277
NP_442450.1_5 Forward -35 -25 7.74818 0.13
NP_440040.1_4 Reverse -148 -167 3.34271 0.294
NP_442006.1_2 Forward -82 -65 -16.4808 0.254
NP_442006.1_2 Forward -289 -272 -18.3491 0.29
NP_443047.1_7 Reverse -44 -63 3.34271 0.3
NP_442348.1_2 Reverse -98 -107 7.27622 0.28
NP_440526.1_3 Forward -32 -21 5.17139 0.253
NP_440497.1_2 Reverse -300 -319 6.09597 0.277
NP_440760.1_9 Reverse -293 -312 8.45592 0.281
NP_442274.1_3 Forward -257 -238 12.3892 0.297
NP_440713.1_4 Reverse -66 -85 2.85105 0.256
NP_440713.1_4 Forward -80 -61 2.26107 0.266
NP_440559.1_1 Reverse -25 -34 4.32629 0.288
NP_441659.2_8 Forward -33 -23 2.83163 0.187
NP_441659.2_8 Reverse -57 -67 0.373358 0.268
NP_442008.1_2 Forward -284 -265 5.50599 0.226
NP_440708.1_6 Forward -270 -251 6.09597 0.131
NP_442776.1_1 Reverse -65 -84 4.52268 0.274
NP_442346.1_1 Reverse -81 -100 10.1275 0.27
NP_442346.1_5 Forward -34 -24 5.68323 0.234
NP_442346.1_10 Forward -376 -357 -3.44213 0.294
NP_441629.1_3 Reverse -57 -76 1.27698 0.231
NP_440486.1_6 Reverse -63 -82 5.99764 0.284
NP_440459.1_2 Forward -303 -286 10.1669 0.207
NP_440010.1_3 Reverse -112 -131 -0.983855 0.25
NP_441833.1_4 Reverse -25 -32 4.56234 0.248
NP_442045.1_5 Reverse -276 -295 1.67108 0.261
NP_442497.1_10 Reverse -25 -34 0.393051 0.175
NP_440821.1_4 Forward -35 -25 0.176696 0.198
NP_441239.1_9 Reverse -22 -34 3.08724 0.296
NP_441951.1_4 Reverse -111 -130 0.982764 0.29
NP_440624.1_5 Reverse -3 -21 13.4518 0.178
NP_441892.1_1 Reverse -244 -261 5.9387 0.0995
NP_440665.1_1 Forward -85 -66 -15.0452 0.264
NP_440740.1_7 Reverse -66 -84 16.7354 0.0646
NP_440949.1_7 Reverse -231 -250 8.75009 0.275
NP_442809.1_6 Forward -34 -15 6.78429 0.256
NP_440546.1_6 Reverse -340 -359 12.8808 0.219
NP_440546.1_6 Forward -153 -134 8.65258 0.255
NP_442041.1_2 Reverse -108 -126 17.9154 0.153
NP_442041.1_5 Reverse -286 -305 -0.197208 0.266
NP_440341.1_1 Forward -73 -54 3.93269 0.283
NP_441848.1_4 Reverse -128 -144 8.21911 0.288
NP_441848.1_7 Forward -108 -89 -4.1312 0.287
NP_442679.1_1 Forward -35 -16 -1.27885 0.228
NP_442837.1_3 Reverse -366 -373 6.52896 0.2
NP_440505.1_7 Reverse -268 -287 1.76941 0.244
NP_441203.1_2 Reverse -108 -127 -6.58872 0.267
NP_441576.1_10 Forward -22 -3 10.6192 0.291
NP_442533.1_1 Forward -75 -56 -16.4218 0.268
NP_442533.1_1 Forward -299 -280 -17.7001 0.293
NP_442322.1_3 Forward -202 -188 17.5025 0.282
NP_441697.1_5 Forward -21 -2 -1.57604 0.206
NP_441697.1_5 Forward -20 -1 -9.88384 0.278
NP_441697.1_5 Reverse -3 -22 -10.2658 0.278
NP_441028.1_6 Reverse -275 -285 7.94438 0.217
NP_441028.1_6 Forward -84 -74 4.01116 0.278
NP_441028.1_6 Reverse -366 -376 3.51951 0.292
NP_441527.1_5 Forward -35 -16 12.0176 0.297
NP_441680.1_4 Forward -126 -107 1.17943 0.246
NP_441170.1_2 Forward -269 -250 -0.295539 0.289
NP_440429.1_9 Reverse -79 -98 -0.295539 0.297
NP_442306.1_10 Forward -267 -248 -21.1417 0.247
NP_442306.1_10 Forward -351 -332 -21.83 0.291
NP_441286.1_1 Reverse -23 -35 -6.2542 0.254
NP_440670.1_8 Reverse -24 -33 3.53964 0.257
NP_440886.1_7 Reverse -56 -66 11.5826 0.0805
NP_442614.1_2 Forward -33 -19 7.17775 0.275
NP_442614.1_2 Forward -308 -294 5.99778 0.295
NP_441431.1_2 Forward -122 -108 6.98048 0.255
NP_441065.1_2 Forward -21 -2 12.4921 0.18
NP_440358.1_2 Forward -131 -114 13.9027 0.194
NP_440293.1_3 Forward -65 -46 -0.885524 0.238
NP_440293.1_3 Reverse -107 -126 -1.86883 0.239
NP_442743.1_4 Forward -238 -219 -8.16202 0.289
NP_442930.1_1 Reverse -136 -146 9.51767 0.286
NP_441133.1_1 Reverse -87 -106 12.2908 0.269
NP_442867.1_8 Reverse -299 -318 5.40766 0.276
NP_440457.1_1 Forward -70 -58 11.5437 0.092
NP_440457.1_1 Reverse -20 -32 4.8572 0.151
NP_442509.1_5 Reverse -56 -73 20.4909 0.0487
NP_442509.1_9 Reverse -24 -34 11.6809 0.119
NP_442784.1_3 Forward -322 -303 11.6025 0.293
NP_442514.1_5 Forward -126 -107 -0.787962 0.189
NP_442514.1_5 Forward -125 -106 -5.60616 0.26
NP_440423.1_6 Reverse -245 -264 -11.1119 0.164
NP_440423.1_6 Forward -74 -55 -21.0434 0.279
NP_443000.1_3 Reverse -115 -134 10.0681 0.289
NP_441842.1_10 Reverse -91 -105 7.76774 0.245
NP_440275.1_3 Reverse -22 -32 4.50326 0.188
NP_442354.1_8 Reverse -337 -356 10.4225 0.266
NP_439962.1_4 Forward -322 -303 -7.86702 0.291
NP_440216.1_1 Forward -33 -19 -12.5868 0.288
NP_440216.1_9 Forward -115 -106 8.25953 0.286
NP_441064.1_7 Reverse -141 -160 15.4978 0.193
NP_442015.1_10 Reverse -20 -33 2.77255 0.187
NP_440244.1_1 Forward -308 -289 -7.37537 0.287
NP_441766.1_9 Reverse -109 -128 -1.86883 0.275
NP_440416.1_9 Reverse -304 -323 -16.9135 0.226
NP_441974.1_3 Forward -29 -12 15.2893 0.257
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTCCGGAGCACTTACTACTAATTGTTGGGGATCAATGGTCTGTCCACAGTTGCCGCAAAAAGTAGCATCACTTTGCACGGAGCTGCCACAGTGGGGACAAGGCATCAGAGTGGGCAGGGGGGTAAAGCAGGCCTCACACTGGATGGCCCCTTCTGGATTGGTGTGATTACAGGTGGGACAGACAGCCATAAATAATGTAGGGATTAATGTTAAATACCACAGCGGAGTATGGCAGGATTCTCTTCAATCGTAGCGAAAAATTTGTCTTTCCTAACCCTCCCGGCCCCAGGGCAAAAAATCTCCACCCCAGCTCGAATTGACCCCCTGGGAGGAGGACGGTCGGGGAAAGTGAAGTGCTAAGGTAAAGGGCGATCCTACGGCAAAATTCTAAATTTTTTTG

CDS

ATGAGTGACGACACACCCCATCCTGAGTGGCAATTAGTCCCCCAGGGAAACTTTGTCCGATTATCCCTAACTCTCCCGACGGTAACGACGGCTCCCGACTCCCCTAGCCTGGTGTTTTCCCATCAACAACTGGAACAAAGCTTGGGTAATTATCTGCGTATTATGGCGGGGCGATGGCAAGACCAGACCCTAGTGCGGTTAGCGGTGAATAATCAACTGTTGGATGCTAGACAACTCCAGGCGATCGCCGCTGGCCTGAAGGAACAGAACCTGACCTTGCAGTGGGTGGAAACCAACCGTCGTCAAACCGCTGTGGCCGCCGCCAGTGCCGGCCTTTCCGTGGATCAAACCATGGCCGACAAGCCCCTGGTGGATCCTTCCGAGACCCCTTCTCTCCCCAAACCGTTAGTGGTACGCCATACCCTCCGTTCTGGGGGGGAAATTCGCCATGGAGGAGATGTAGTCATCATTGGCGATGTCAATCCGGGCAGTAGCATTGTGGCCGACGGTGACATCCTTATTTGGGGATGTTTGCGGGGTATGGCCCATGCCGGTGCCAAAGGCAATGACCAGGCTGTTATTATGATTCTGCGGTTGGCCGCCTGTCAGATCCGCATTGGCGATCGCCTAGCTAGGGTAGGGGCCGATGCCGTTGATCGCCGTGAGCCCGAAATCGCTTATATTACTTCAGAAGGTATCCGTCTGACCCCGGTGCGTCAGTTTCAGCGTTCTGCTCTGCTATAA

Protein

MSDDTPHPEWQLVPQGNFVRLSLTLPTVTTAPDSPSLVFSHQQLEQSLGNYLRIMAGRWQDQTLVRLAVNNQLLDARQLQAIAAGLKEQNLTLQWVETNRRQTAVAAASAGLSVDQTMADKPLVDPSETPSLPKPLVVRHTLRSGGEIRHGGDVVIIGDVNPGSSIVADGDILIWGCLRGMAHAGAKGNDQAVIMILRLAACQIRIGDRLARVGADAVDRREPEIAYITSEGIRLTPVRQFQRSALL