Your browser is old and dusty. Try Google Chrome!

Details for sll0286

ORF sll0286
Accession NP_442603.1
Symbol ycf52
Category hypothetical protein YCF52
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -146 -160 7.57108 0.101
NP_441061.1_2 Forward -153 -139 2.65453 0.173
NP_440795.1_7 Forward -153 -146 14.6904 0.0123
NP_440795.1_7 Reverse -146 -153 14.6904 0.0123
NP_440795.1_7 Forward -345 -338 6.92228 0.26
NP_441418.1_6 Forward -154 -135 -10.522 0.0362
NP_441418.1_6 Reverse -145 -164 -11.1119 0.0445
NP_441418.1_6 Forward -262 -243 -29.4998 0.228
NP_440897.1_6 Forward -346 -327 -1.8696 0.198
NP_440897.1_6 Forward -154 -135 -2.36125 0.21
NP_440897.1_6 Reverse -25 -44 -3.83621 0.257
NP_441453.1_1 Forward -161 -143 15.948 0.0915
NP_441453.1_4 Reverse -145 -153 16.539 0.00633
NP_441453.1_4 Forward -154 -146 16.539 0.00633
NP_442151.1_6 Forward -154 -140 11.0127 0.109
NP_442151.1_6 Reverse -145 -159 6.3911 0.236
NP_441818.1_1 Forward -153 -142 9.79292 0.232
NP_441818.1_9 Forward -259 -240 -7.67036 0.273
NP_440226.1_1 Reverse -145 -164 10.5209 0.0617
NP_440226.1_1 Forward -154 -135 8.06259 0.0944
NP_440226.1_1 Forward -107 -88 5.01433 0.17
NP_441630.1_3 Reverse -137 -156 -0.885524 0.29
NP_440150.1_6 Forward -157 -138 10.8159 0.149
NP_442655.1_2 Reverse -216 -235 0.0977854 0.295
NP_442173.1_1 Forward -153 -145 15.4574 0.00633
NP_442173.1_1 Reverse -146 -154 15.4574 0.00633
NP_442752.1_4 Forward -154 -147 13.8055 0.0199
NP_442752.1_4 Reverse -145 -152 13.8055 0.0199
NP_443027.1_4 Forward -156 -146 13.943 0.0452
NP_443027.1_4 Forward -109 -99 11.9764 0.0872
NP_443027.1_4 Reverse -143 -153 11.0914 0.107
NP_441812.1_3 Reverse -144 -158 14.9459 0.106
NP_442975.1_10 Forward -158 -144 21.3367 0.00107
NP_441225.1_2 Reverse -242 -261 0.58944 0.275
NP_440784.1_7 Forward -153 -146 15.9687 0.0123
NP_440784.1_7 Reverse -146 -153 15.9687 0.0123
NP_440784.1_7 Reverse -308 -315 6.43063 0.218
NP_440061.1_9 Forward -156 -142 11.012 0.117
NP_440061.1_9 Reverse -143 -157 5.1122 0.294
NP_440110.1_7 Forward -57 -38 10.4225 0.289
NP_441476.1_5 Forward -159 -140 -3.24547 0.235
NP_442062.1_8 Reverse -145 -155 19.4496 0.000558
NP_442062.1_8 Forward -154 -144 17.3846 0.00193
NP_442062.1_8 Forward -107 -97 4.10993 0.232
NP_441900.1_2 Reverse -234 -252 -1.6532 0.27
NP_441859.1_3 Reverse -144 -163 9.34008 0.129
NP_441859.1_3 Forward -155 -136 8.55343 0.138
NP_441859.1_3 Forward -108 -89 5.70185 0.192
NP_440304.1_4 Forward -156 -146 9.91146 0.051
NP_440304.1_4 Reverse -143 -153 1.84832 0.299
NP_442242.1_4 Forward -153 -146 14.3954 0.0124
NP_442242.1_4 Reverse -146 -153 14.3954 0.0124
NP_440044.1_8 Reverse -146 -165 6.39097 0.0916
NP_439923.1_7 Reverse -11 -30 16.5191 0.178
NP_441200.1_4 Reverse -312 -331 5.50599 0.294
NP_441935.1_9 Forward -63 -44 14.8486 0.191
NP_441208.1_9 Reverse -142 -156 7.76774 0.219
NP_441594.1_6 Forward -163 -144 11.4058 0.116
NP_442196.1_10 Forward -171 -152 11.5042 0.224
NP_442110.1_7 Forward -154 -140 1.76955 0.222
NP_442110.1_7 Reverse -145 -159 0.0979218 0.267
NP_441082.1_10 Reverse -220 -233 8.37742 0.275
NP_441925.1_4 Reverse -234 -253 24.2863 0.0015
NP_441925.1_4 Forward -244 -225 -6.49113 0.185
NP_441925.1_4 Forward -241 -222 -15.7342 0.273
NP_440856.1_4 Reverse -138 -157 -3.54046 0.234
NP_440856.1_7 Reverse -241 -260 -8.06369 0.264
NP_441083.1_5 Forward -154 -144 20.3345 0.00053
NP_441083.1_5 Reverse -145 -155 11.3864 0.0159
NP_441434.1_7 Reverse -147 -161 14.6509 0.0961
NP_441141.1_4 Reverse -22 -41 14.5524 0.292
NP_441738.1_2 Forward -152 -145 15.28 0.0102
NP_441738.1_2 Reverse -147 -154 15.28 0.0102
NP_441558.1_5 Reverse -143 -162 10.6192 0.0955
NP_440209.1_1 Reverse -145 -153 18.1123 0.00295
NP_440209.1_1 Forward -154 -146 18.1123 0.00295
NP_442889.1_1 Reverse -219 -238 -12.9802 0.242
NP_442889.1_8 Forward -157 -143 13.2736 0.0588
NP_440178.1_7 Reverse -144 -163 -12.0953 0.112
NP_441716.1_1 Forward -154 -140 19.9608 0.00829
NP_440644.1_3 Forward -174 -155 5.11266 0.17
NP_440644.1_3 Forward -375 -356 0.687771 0.278
NP_442111.1_3 Forward -334 -321 14.4811 0.23
NP_442111.1_4 Forward -155 -141 5.21113 0.172
NP_442111.1_4 Reverse -144 -158 3.14618 0.253
NP_440906.1_5 Forward -153 -146 15.8704 0.0124
NP_440906.1_5 Reverse -146 -153 15.8704 0.0124
NP_440747.1_10 Reverse -142 -154 26.5883 0.000317
NP_440747.1_10 Forward -157 -145 -2.02597 0.0196
NP_441130.1_7 Forward -40 -26 15.3386 0.287
NP_441130.1_10 Reverse -143 -157 15.2409 0.034
NP_441130.1_10 Forward -156 -142 11.0127 0.107
NP_441486.1_1 Forward -157 -143 5.01447 0.0398
NP_441486.1_1 Reverse -142 -156 -4.22864 0.192
NP_441880.2_10 Reverse -146 -164 8.47561 0.273
NP_442634.1_4 Forward -156 -142 -2.85201 0.156
NP_442634.1_4 Reverse -143 -157 -3.34366 0.161
NP_441265.1_3 Reverse -139 -153 4.32615 0.181
NP_440403.1_10 Reverse -145 -164 13.5691 0.129
NP_440403.1_10 Forward -163 -144 8.55425 0.199
NP_440403.1_10 Reverse -238 -257 7.47261 0.208
NP_440842.1_10 Forward -341 -327 2.06454 0.278
NP_441695.1_4 Reverse -146 -164 11.4255 0.238
NP_441014.1_8 Reverse -332 -351 2.75272 0.214
NP_441014.1_8 Forward -241 -222 -9.14533 0.291
NP_441014.1_10 Reverse -144 -163 12.3883 0.118
NP_442848.1_1 Forward -160 -146 -4.32697 0.287
NP_443018.1_3 Forward -153 -146 14.8871 0.0123
NP_443018.1_3 Reverse -146 -153 14.8871 0.0123
NP_441634.1_8 Reverse -143 -157 24.5823 0.00171
NP_440376.1_1 Forward -154 -145 19.4693 0.000692
NP_440376.1_1 Reverse -145 -154 19.4693 0.000692
NP_440376.1_1 Reverse -1 -10 0.786375 0.26
NP_441857.1_6 Forward -140 -130 18.0729 0.153
NP_441588.1_4 Reverse -147 -157 6.96153 0.178
NP_442687.1_7 Forward -155 -145 15.8113 0.0125
NP_442687.1_7 Reverse -144 -154 8.92815 0.0994
NP_442191.1_4 Forward -153 -139 11.6718 0.247
NP_442485.1_3 Forward -165 -146 11.5042 0.105
NP_442485.1_3 Forward -247 -228 -1.18052 0.256
NP_442485.1_3 Reverse -242 -261 -2.16383 0.262
NP_442485.1_3 Reverse -143 -162 -2.16383 0.262
NP_441846.1_10 Forward -351 -332 -22.5183 0.261
NP_440642.1_10 Forward -43 -29 8.55376 0.198
NP_441422.1_7 Reverse -143 -160 -2.71443 0.221
NP_440691.1_10 Reverse -326 -345 16.1257 0.185
NP_440360.1_10 Forward -60 -46 4.03116 0.227
NP_442720.1_8 Forward -71 -53 14.3755 0.297
NP_442658.1_1 Forward -156 -146 18.7607 0.00222
NP_442658.1_1 Reverse -143 -153 7.94438 0.199
NP_441855.2_4 Reverse -108 -127 11.162 0.227
NP_441855.2_4 Forward -162 -143 10.2943 0.257
NP_442782.1_2 Forward -256 -242 1.86788 0.281
NP_442205.1_9 Forward -113 -97 5.6634 0.128
NP_442205.1_9 Forward -160 -144 -1.90808 0.264
NP_440656.1_8 Forward -165 -146 -8.55534 0.273
NP_441487.1_9 Reverse -144 -163 2.3594 0.182
NP_441256.1_1 Reverse -244 -263 -4.03212 0.233
NP_442937.1_5 Forward -159 -140 12.9791 0.0966
NP_442937.1_5 Reverse -140 -159 9.14423 0.202
NP_441958.1_5 Forward -155 -145 12.2714 0.00183
NP_441958.1_5 Reverse -144 -154 12.2714 0.00183
NP_441127.1_1 Reverse -151 -165 9.2427 0.278
NP_442486.1_6 Reverse -241 -260 -4.13045 0.266
NP_442836.1_10 Forward -140 -130 19.1546 0.0821
NP_440203.1_5 Forward -59 -49 10.4026 0.225
NP_440984.1_7 Forward -159 -145 6.88276 0.195
NP_439990.1_5 Reverse -140 -153 23.3237 0.000299
NP_442376.1_2 Forward -159 -140 -10.3253 0.286
NP_442911.1_2 Reverse -135 -154 6.78429 0.0277
NP_441580.1_6 Forward -165 -146 -4.6221 0.235
NP_440153.1_8 Reverse -331 -344 -1.75067 0.225
NP_441591.1_10 Reverse -143 -162 5.01433 0.297
NP_442064.1_4 Forward -72 -53 8.35677 0.232
NP_443055.1_6 Forward -162 -144 20.4712 0.0412
NP_443055.1_6 Reverse -131 -149 7.49153 0.156
NP_440993.1_3 Reverse -135 -154 11.7 0.0882
NP_440993.1_4 Reverse -11 -28 3.28376 0.289
NP_441099.1_5 Reverse -135 -154 -2.65548 0.125
NP_442002.1_1 Forward -347 -329 -9.12563 0.272
NP_442002.1_9 Forward -155 -148 10.7572 0.185
NP_441294.1_7 Forward -158 -144 17.8896 0.00674
NP_441294.1_7 Reverse -28 -42 10.0185 0.213
NP_442438.1_10 Forward -159 -145 12.1926 0.0412
NP_442438.1_10 Reverse -140 -154 0.786239 0.213
NP_442431.1_10 Forward -259 -241 -0.374176 0.287
NP_442431.1_10 Forward -349 -331 -0.570838 0.29
NP_440811.1_1 Forward -363 -344 13.3725 0.153
NP_441000.1_6 Reverse -144 -158 5.01447 0.0933
NP_441000.1_6 Forward -155 -141 -3.93365 0.225
NP_440147.1_4 Reverse -143 -156 16.8339 0.00906
NP_440147.1_4 Forward -156 -143 11.0324 0.0341
NP_441550.1_8 Reverse -143 -153 15.1225 0.0132
NP_441550.1_8 Forward -156 -146 10.501 0.066
NP_441916.1_7 Reverse -145 -155 18.4663 0.00144
NP_441916.1_7 Forward -154 -144 10.3048 0.0261
NP_441916.1_10 Reverse -51 -70 2.45773 0.246
NP_441041.1_4 Reverse -145 -164 -2.36049 0.111
NP_441041.1_7 Forward -157 -145 19.5648 0.00277
NP_441041.1_7 Reverse -142 -154 7.51478 0.162
NP_441725.1_4 Reverse -140 -154 4.42388 0.278
NP_441725.1_5 Reverse -146 -156 9.02648 0.0553
NP_441725.1_5 Forward -153 -143 2.04498 0.115
NP_439966.1_7 Forward -156 -146 17.4824 0.00636
NP_439966.1_7 Reverse -143 -153 15.3192 0.0152
NP_439966.1_9 Forward -156 -147 10.7178 0.0863
NP_442941.1_3 Forward -153 -143 19.2529 0.00262
NP_442941.1_3 Reverse -146 -156 2.53664 0.14
NP_440674.1_4 Reverse -111 -130 13.0775 0.286
NP_440289.1_2 Forward -157 -144 19.6855 0.00426
NP_440289.1_2 Reverse -142 -155 -3.61896 0.267
NP_440983.1_5 Reverse -148 -167 -5.50708 0.266
NP_441678.1_9 Reverse -160 -179 -2.16383 0.257
NP_442281.1_1 Forward -159 -145 16.8135 0.00698
NP_442281.1_1 Reverse -140 -154 8.45543 0.0808
NP_441334.1_7 Reverse -96 -115 -14.2585 0.255
NP_441334.1_7 Forward -156 -137 -18.5851 0.275
NP_441334.1_7 Reverse -143 -162 -19.8634 0.275
NP_440437.1_1 Reverse -139 -158 9.0459 0.0525
NP_441457.1_7 Reverse -143 -162 1.27776 0.276
NP_441556.1_10 Reverse -140 -154 12.4606 0.195
NP_441644.1_6 Forward -154 -144 17.3841 0.00127
NP_441644.1_6 Reverse -145 -155 10.1076 0.0628
NP_443049.1_6 Reverse -7 -17 12.6169 0.24
NP_442215.1_2 Forward -156 -140 3.99177 0.0889
NP_442215.1_2 Forward -244 -228 -4.1697 0.228
NP_442215.1_2 Forward -127 -111 -4.26803 0.23
NP_442215.1_2 Forward -19 -3 -5.54633 0.251
NP_442215.1_2 Reverse -305 -321 -6.7263 0.278
NP_442029.1_6 Reverse -302 -321 6.98095 0.231
NP_442029.1_6 Forward -159 -140 2.85105 0.286
NP_440253.1_2 Reverse -145 -163 10.9339 0.0356
NP_440253.1_2 Forward -154 -136 2.47742 0.137
NP_440929.1_8 Forward -154 -145 19.2726 0.000701
NP_440929.1_8 Reverse -145 -154 19.2726 0.000701
NP_441346.1_5 Reverse -155 -174 18.6823 0.133
NP_442933.1_10 Forward -154 -145 17.601 0.00325
NP_442933.1_10 Reverse -145 -154 17.601 0.00325
NP_441751.2_8 Forward -153 -139 5.01447 0.0448
NP_441751.2_8 Reverse -146 -160 -5.31028 0.202
NP_442554.1_8 Forward -153 -143 16.2046 0.0065
NP_442554.1_8 Reverse -146 -156 16.008 0.0065
NP_441762.1_7 Reverse -144 -156 12.4287 0.0142
NP_441762.1_7 Forward -155 -143 2.39892 0.0676
NP_442142.1_4 Reverse -142 -155 16.0466 0.0264
NP_442142.1_4 Forward -157 -144 13.8833 0.0324
NP_442142.1_4 Reverse -241 -254 5.32859 0.194
NP_442292.1_1 Forward -153 -144 18.486 0.00229
NP_442292.1_1 Reverse -146 -155 9.63616 0.0183
NP_440919.1_1 Forward -145 -126 -6.49039 0.258
NP_440895.1_6 Reverse -139 -152 10.049 0.202
NP_440895.1_10 Reverse -144 -161 -5.36936 0.29
NP_442381.1_8 Forward -157 -138 5.01433 0.0708
NP_443009.1_5 Reverse -144 -155 18.3477 0.00265
NP_442301.1_2 Reverse -333 -352 3.63691 0.292
NP_441715.1_4 Forward -153 -143 17.3846 0.0106
NP_441715.1_4 Reverse -146 -156 9.32148 0.097
NP_440357.1_3 Forward -245 -226 1.37609 0.275
NP_440357.1_6 Reverse -241 -260 4.03102 0.296
NP_440881.1_4 Forward -124 -105 3.14605 0.226
NP_440881.1_7 Reverse -354 -373 10.8159 0.3
NP_441448.1_1 Forward -209 -190 4.42435 0.279
NP_440183.1_9 Reverse -147 -166 -13.0786 0.26
NP_441198.1_4 Forward -343 -324 10.2259 0.274
NP_440379.1_5 Forward -163 -144 -5.01543 0.219
NP_441468.1_1 Forward -153 -146 15.8704 0.0124
NP_441468.1_1 Reverse -146 -153 15.8704 0.0124
NP_439939.1_6 Reverse -47 -66 12.7825 0.277
NP_441020.2_6 Reverse -143 -160 8.7903 0.188
NP_441020.2_6 Forward -348 -331 6.92201 0.249
NP_441020.2_6 Forward -156 -139 6.03703 0.28
NP_441015.1_10 Forward -255 -236 3.44104 0.136
NP_441015.1_10 Forward -159 -140 -2.95047 0.184
NP_441015.1_10 Forward -345 -326 -9.63698 0.282
NP_441015.1_10 Reverse -220 -239 -11.1119 0.291
NP_441015.1_10 Forward -252 -233 -11.6036 0.298
NP_441673.1_1 Forward -154 -145 20.8459 0.000698
NP_441673.1_1 Reverse -145 -154 20.8459 0.000698
NP_441731.1_3 Reverse -137 -156 -5.11376 0.284
NP_440286.1_1 Reverse -85 -103 8.08229 0.276
NP_441826.1_2 Reverse -139 -153 -2.65535 0.273
NP_442063.1_2 Reverse -181 -200 -2.65548 0.292
NP_442490.1_10 Reverse -237 -255 8.86894 0.261
NP_442868.1_6 Reverse -143 -153 19.2529 0.00563
NP_442868.1_6 Forward -156 -146 8.53483 0.0555
NP_442719.1_2 Reverse -95 -113 6.1149 0.135
NP_441612.1_2 Forward -154 -144 8.54929 0.21
NP_442227.1_2 Reverse -328 -347 -2.0655 0.27
NP_442227.1_2 Reverse -240 -259 -3.14714 0.289
NP_442808.1_1 Forward -155 -145 18.4657 0.00201
NP_442808.1_1 Reverse -144 -154 8.63269 0.0481
NP_442808.1_1 Forward -11 -1 5.48612 0.151
NP_442808.1_1 Reverse -335 -345 0.962914 0.299
NP_441101.1_10 Reverse -141 -160 -5.9004 0.285
NP_440145.1_3 Forward -164 -145 1.27776 0.129
NP_442542.1_2 Forward -156 -143 19.0955 0.0177
NP_442542.1_9 Forward -161 -147 11.9953 0.11
NP_442050.1_1 Reverse -46 -65 8.06259 0.255
NP_442050.1_5 Reverse -143 -153 14.3359 0.0206
NP_442050.1_5 Forward -156 -146 8.23937 0.234
NP_442342.1_9 Forward -156 -140 2.12349 0.29
NP_442789.1_4 Reverse -143 -162 -7.37537 0.295
NP_441518.1_3 Forward -164 -145 11.7992 0.0317
NP_441878.1_6 Forward -155 -145 10.4031 0.0176
NP_441878.1_6 Reverse -144 -154 10.4031 0.0176
NP_441878.1_6 Reverse -232 -242 -7.88644 0.278
NP_441878.1_10 Forward -334 -320 10.7177 0.294
NP_441036.1_8 Forward -155 -145 17.7779 0.000554
NP_441036.1_8 Reverse -144 -154 8.33817 0.174
NP_441557.1_5 Forward -154 -145 19.9609 0.000699
NP_441557.1_5 Reverse -145 -154 19.9609 0.000699
NP_441445.1_1 Forward -163 -144 18.879 0.028
NP_441445.1_1 Reverse -136 -155 2.55606 0.233
NP_442066.2_9 Forward -158 -145 8.47575 0.185
NP_442579.1_6 Forward -375 -356 10.4225 0.154
NP_442962.1_5 Forward -363 -344 12.6841 0.137
NP_442419.1_2 Reverse -140 -159 8.75091 0.139
NP_442419.1_2 Reverse -332 -351 -1.27885 0.246
NP_441224.1_2 Forward -179 -161 11.4255 0.264
NP_440084.1_3 Forward -283 -264 12.2908 0.292
NP_441308.1_8 Forward -156 -146 9.22315 0.226
NP_440101.1_3 Forward -159 -140 2.3594 0.257
NP_441458.1_10 Reverse -136 -155 11.1109 0.118
NP_442183.1_1 Reverse -145 -159 16.6175 0.0139
NP_441407.1_5 Forward -164 -145 3.14605 0.282
NP_442166.1_7 Forward -153 -139 12.586 0.175
NP_441574.1_1 Forward -166 -147 4.71934 0.13
NP_442444.1_6 Reverse -211 -229 14.6617 0.21
NP_442347.1_2 Forward -153 -144 12.4878 0.056
NP_442347.1_2 Reverse -146 -155 11.1111 0.056
NP_442645.1_2 Forward -171 -152 -22.6167 0.292
NP_442645.1_2 Reverse -137 -156 -22.6167 0.292
NP_442965.1_1 Reverse -125 -144 17.0107 0.0407
NP_441037.1_4 Forward -156 -146 16.2838 0.0168
NP_442047.1_2 Reverse -111 -125 17.9942 0.161
NP_442317.1_6 Reverse -140 -159 9.3409 0.211
NP_441633.1_3 Reverse -143 -156 20.5705 0.00512
NP_441633.1_3 Forward -156 -143 -3.71729 0.177
NP_440136.1_2 Forward -153 -146 15.9687 0.0123
NP_440136.1_2 Reverse -146 -153 15.9687 0.0123
NP_442590.1_9 Reverse -181 -200 4.81767 0.273
NP_442998.1_5 Forward -334 -324 14.3364 0.149
NP_442998.1_5 Forward -333 -323 11.3864 0.187
NP_442998.1_5 Reverse -346 -356 7.84651 0.28
NP_442998.1_10 Forward -152 -145 15.5754 0.0102
NP_442998.1_10 Reverse -147 -154 15.5754 0.0102
NP_440731.1_2 Reverse -47 -66 4.62101 0.293
NP_440899.1_8 Forward -46 -27 -8.45701 0.254
NP_440299.1_1 Reverse -141 -154 20.2748 0.00128
NP_441799.1_1 Reverse -141 -155 9.14375 0.0988
NP_441799.1_1 Forward -158 -144 9.04542 0.1
NP_440640.1_6 Forward -262 -243 0.884433 0.266
NP_441007.1_10 Forward -159 -146 5.52582 0.18
NP_442334.1_1 Forward -166 -147 -3.3438 0.216
NP_442333.2_5 Forward -267 -248 -11.8986 0.249
NP_440256.1_1 Reverse -142 -161 16.9124 0.00573
NP_440256.1_1 Forward -260 -241 -8.16202 0.253
NP_442283.1_4 Forward -157 -138 16.6174 0.26
NP_441559.1_8 Reverse -140 -154 12.4876 0.0574
NP_441559.1_8 Forward -202 -188 -7.76856 0.299
NP_441270.1_5 Forward -353 -334 14.6533 0.211
NP_441270.1_5 Forward -350 -331 12.9943 0.236
NP_440915.1_6 Reverse -141 -155 10.6193 0.0301
NP_440915.1_6 Forward -158 -144 6.3911 0.0826
NP_442158.1_4 Forward -352 -342 13.353 0.234
NP_441704.1_8 Reverse -134 -153 9.04509 0.196
NP_442452.1_8 Reverse -139 -153 12.9786 0.273
NP_440748.1_5 Reverse -360 -379 -2.75381 0.281
NP_441464.1_8 Reverse -145 -159 10.521 0.178
NP_441464.1_8 Reverse -239 -253 4.12949 0.283
NP_441939.1_3 Forward -153 -134 11.3075 0.114
NP_441939.1_4 Reverse -318 -337 15.8035 0.198
NP_442993.1_1 Reverse -145 -161 0.0585348 0.0668
NP_442386.1_9 Forward -155 -146 15.7322 0.0144
NP_442386.1_9 Reverse -144 -153 13.8639 0.0289
NP_442386.1_9 Forward -263 -254 4.7192 0.289
NP_442386.1_9 Forward -347 -338 4.62087 0.294
NP_442386.1_10 Forward -343 -330 4.93583 0.262
NP_441404.1_2 Forward -73 -54 15.135 0.256
NP_441750.1_4 Reverse -141 -160 17.2074 0.0676
NP_441750.1_7 Forward -343 -333 13.943 0.254
NP_441340.1_5 Forward -153 -146 15.6737 0.0124
NP_441340.1_5 Reverse -146 -153 15.6737 0.0124
NP_442791.1_5 Reverse -252 -271 -9.53865 0.279
NP_442791.1_5 Forward -162 -143 -9.93197 0.279
NP_442791.1_9 Reverse -152 -171 14.8466 0.186
NP_440168.1_9 Reverse -143 -162 -2.95047 0.286
NP_442240.1_1 Reverse -137 -156 9.93006 0.211
NP_442240.1_2 Reverse -99 -118 -20.4534 0.295
NP_440161.1_3 Forward -200 -181 10.2259 0.23
NP_440586.1_8 Forward -153 -146 13.2151 0.026
NP_440586.1_8 Reverse -146 -153 13.2151 0.026
NP_440586.1_8 Forward -106 -99 12.6251 0.0546
NP_442251.1_6 Forward -153 -146 15.2804 0.0124
NP_442251.1_6 Reverse -146 -153 15.2804 0.0124
NP_440192.1_4 Forward -156 -137 8.4274 0.298
NP_441262.1_3 Reverse -145 -152 14.7888 0.0223
NP_441262.1_3 Forward -154 -147 14.7888 0.0223
NP_443051.1_1 Reverse -144 -153 10.4228 0.00754
NP_443051.1_1 Forward -155 -146 10.4228 0.00754
NP_441232.1_10 Forward -256 -237 1.96607 0.262
NP_442374.1_3 Forward -39 -22 15.3785 0.185
NP_440408.1_7 Reverse -247 -266 11.9958 0.212
NP_440439.1_1 Reverse -142 -155 9.16406 0.0465
NP_440439.1_1 Forward -157 -144 2.47756 0.133
NP_440372.1_2 Forward -153 -146 16.3621 0.0124
NP_440372.1_2 Reverse -146 -153 16.3621 0.0124
NP_442783.1_3 Forward -73 -54 14.7491 0.218
NP_440819.1_5 Reverse -345 -353 7.59091 0.272
NP_441803.1_2 Reverse -248 -267 0.884433 0.243
NP_441803.1_2 Reverse -140 -159 0.491109 0.251
NP_439977.1_5 Forward -160 -141 6.29264 0.134
NP_439977.1_5 Reverse -139 -158 -0.295539 0.222
NP_440139.1_1 Forward -160 -141 3.53858 0.202
NP_442384.1_10 Forward -154 -141 20.8655 0.00194
NP_442114.1_4 Reverse -145 -156 12.1534 0.107
NP_442713.1_3 Forward -258 -239 2.0644 0.284
NP_442790.1_4 Reverse -136 -155 -8.35868 0.168
NP_442262.1_10 Forward -153 -146 14.1988 0.0123
NP_442262.1_10 Reverse -146 -153 14.1988 0.0123
NP_441689.1_5 Reverse -143 -153 5.78111 0.197
NP_440344.1_10 Forward -161 -144 16.8534 0.0034
NP_440344.1_10 Reverse -138 -155 -2.02611 0.06
NP_440531.1_6 Reverse -137 -156 -1.37718 0.231
NP_440531.1_8 Forward -360 -341 4.52268 0.269
NP_440487.1_1 Forward -157 -138 -3.3438 0.214
NP_440826.1_5 Forward -163 -145 14.1245 0.261
NP_441965.1_10 Forward -157 -141 11.9566 0.107
NP_440297.1_8 Forward -340 -322 21.652 0.0498
NP_440297.1_9 Forward -153 -143 -0.118297 0.282
NP_440297.1_9 Reverse -146 -156 -0.216628 0.282
NP_440298.1_5 Reverse -180 -199 12.4875 0.297
NP_441896.1_3 Forward -163 -144 1.76941 0.209
NP_441896.1_3 Reverse -136 -155 -1.86883 0.268
NP_440894.1_10 Reverse -140 -159 2.65439 0.286
NP_440999.1_9 Forward -158 -144 14.1593 0.0277
NP_440999.1_9 Reverse -141 -155 1.08123 0.171
NP_440888.1_2 Reverse -145 -159 16.5185 0.00647
NP_440888.1_2 Forward -154 -140 16.1252 0.00789
NP_440792.1_9 Forward -225 -206 17.092 0.28
NP_440491.1_1 Forward -157 -138 10.2306 0.194
NP_440052.1_5 Reverse -149 -168 -2.45882 0.213
NP_440052.1_8 Reverse -54 -73 9.43923 0.256
NP_442225.1_10 Reverse -327 -346 5.89851 0.287
NP_439969.1_1 Forward -36 -17 -7.17871 0.291
NP_442277.1_2 Forward -63 -49 17.1092 0.158
NP_442033.1_10 Forward -156 -137 3.04771 0.0873
NP_440105.1_3 Reverse -242 -256 20.3534 0.228
NP_441543.1_2 Reverse -146 -155 18.486 0.00236
NP_441543.1_2 Forward -153 -144 16.9127 0.00359
NP_441543.1_2 Forward -106 -97 4.0313 0.293
NP_442845.1_2 Reverse -225 -239 6.19444 0.215
NP_441319.1_8 Reverse -139 -157 12.6055 0.127
NP_441469.1_8 Forward -155 -146 16.126 0.00797
NP_441469.1_8 Reverse -144 -153 6.48957 0.227
NP_443064.1_6 Forward -154 -144 12.5669 0.0796
NP_443064.1_6 Forward -124 -114 8.6886 0.276
NP_442578.1_7 Forward -153 -146 14.5921 0.026
NP_442578.1_7 Reverse -146 -153 14.5921 0.026
NP_442578.1_7 Forward -106 -99 12.6255 0.0418
NP_440148.1_6 Forward -81 -67 16.7406 0.255
NP_441462.1_2 Forward -154 -144 11.5831 0.00406
NP_441462.1_2 Reverse -145 -155 11.5831 0.00406
NP_441621.1_7 Forward -156 -142 6.58777 0.068
NP_441621.1_7 Reverse -143 -157 -3.44199 0.188
NP_443062.1_1 Reverse -145 -163 6.79079 0.192
NP_443062.1_6 Reverse -137 -156 12.1925 0.0996
NP_442204.1_1 Reverse -141 -152 11.5634 0.0565
NP_442204.1_2 Reverse -135 -154 12.0942 0.223
NP_440516.1_8 Forward -154 -145 16.9127 0.00442
NP_440516.1_8 Reverse -145 -154 16.9127 0.00442
NP_441785.1_1 Forward -74 -60 11.3809 0.3
NP_441033.1_2 Forward -164 -145 -8.45701 0.293
NP_442428.1_5 Forward -153 -146 15.8704 0.0124
NP_442428.1_5 Reverse -146 -153 15.8704 0.0124
NP_442428.1_8 Forward -350 -331 8.45592 0.224
NP_440783.1_5 Forward -351 -332 1.86774 0.19
NP_442859.1_2 Reverse -99 -118 14.8474 0.068
NP_442120.1_10 Forward -160 -141 -7.17871 0.217
NP_440673.1_2 Forward -164 -145 18.2913 0.0444
NP_440673.1_3 Forward -152 -145 12.4288 0.0426
NP_440673.1_3 Reverse -147 -154 12.4288 0.0426
NP_440673.1_3 Reverse -100 -107 11.7405 0.0653
NP_440673.1_3 Forward -60 -53 6.72562 0.277
NP_440865.1_9 Forward -160 -141 4.81767 0.0804
NP_441052.1_2 Forward -154 -144 19.9412 0.00106
NP_441052.1_2 Reverse -145 -155 10.5014 0.0285
NP_440992.1_2 Forward -174 -155 9.14423 0.273
NP_442219.1_8 Forward -164 -145 11.8392 0.169
NP_442219.1_8 Forward -72 -53 6.42771 0.298
NP_442219.1_9 Forward -153 -144 17.7976 0.00718
NP_442219.1_9 Reverse -146 -155 8.35786 0.0681
NP_440436.1_4 Reverse -146 -155 18.1905 0.00233
NP_440436.1_4 Forward -153 -144 17.2072 0.00233
NP_441884.1_9 Forward -157 -138 6.58763 0.0236
NP_442864.1_7 Reverse -241 -259 7.29564 0.274
NP_441719.1_4 Forward -153 -146 16.3621 0.0124
NP_441719.1_4 Reverse -146 -153 16.3621 0.0124
NP_441719.1_4 Forward -106 -99 3.77569 0.285
NP_441733.1_10 Forward -157 -144 10.639 0.106
NP_441733.1_10 Reverse -142 -155 7.39411 0.153
NP_441004.1_1 Reverse -47 -66 -8.26035 0.2
NP_441004.1_1 Forward -175 -156 -16.4218 0.284
NP_442366.1_3 Forward -155 -137 6.50899 0.0776
NP_440296.1_10 Forward -157 -138 -14.7502 0.273
NP_442206.1_10 Forward -154 -139 4.01147 0.179
NP_443054.1_2 Reverse -143 -157 19.7641 0.0121
NP_441851.1_10 Forward -155 -145 16.008 0.00552
NP_441851.1_10 Reverse -144 -154 15.8113 0.00552
NP_442208.1_5 Forward -345 -326 -8.06369 0.275
NP_442622.1_1 Reverse -144 -163 -11.3086 0.257
NP_442856.1_7 Forward -163 -144 5.211 0.131
NP_442856.1_7 Reverse -136 -155 -6.39206 0.297
NP_442515.1_1 Reverse -144 -158 5.30946 0.107
NP_441396.1_5 Reverse -45 -54 7.66954 0.241
NP_440593.1_3 Forward -174 -155 -3.44213 0.235
NP_440593.1_9 Reverse -142 -156 11.3077 0.24
NP_440165.1_5 Forward -155 -136 -7.67036 0.274
NP_441046.1_2 Forward -174 -155 9.43923 0.221
NP_441046.1_2 Forward -212 -193 0.491109 0.268
NP_441409.1_6 Reverse -139 -158 -0.590531 0.0705
NP_441409.1_6 Reverse -98 -117 -7.76869 0.156
NP_440389.1_2 Forward -252 -233 11.8975 0.281
NP_440389.1_5 Reverse -184 -203 14.9218 0.213
NP_440432.1_9 Reverse -146 -161 10.2063 0.0419
NP_439960.1_10 Reverse -138 -156 15.6538 0.0769
NP_440474.1_8 Reverse -146 -160 19.1735 0.0423
NP_442168.1_5 Reverse -237 -256 8.75091 0.154
NP_442168.1_5 Forward -337 -318 -2.0655 0.264
NP_440588.1_2 Reverse -136 -155 -3.14714 0.179
NP_440588.1_2 Reverse -328 -347 -5.21209 0.243
NP_440195.1_5 Forward -160 -141 18.1907 0.0409
NP_442006.1_2 Forward -163 -146 -5.36936 0.143
NP_442006.1_2 Forward -148 -131 -15.8908 0.23
NP_441003.1_9 Forward -325 -306 3.24438 0.295
NP_441570.1_1 Reverse -145 -163 -2.0458 0.0622
NP_441570.1_1 Forward -154 -136 -8.43732 0.112
NP_441078.1_4 Forward -154 -145 19.6659 0.0007
NP_441078.1_4 Reverse -145 -154 19.6659 0.0007
NP_441663.1_8 Forward -241 -222 -2.75381 0.272
NP_442348.1_2 Reverse -177 -186 8.25953 0.28
NP_442443.1_1 Forward -258 -239 -5.31042 0.282
NP_441094.1_6 Forward -161 -144 8.69123 0.261
NP_440526.1_3 Reverse -146 -157 11.7595 0.0646
NP_440526.1_3 Forward -153 -142 8.02298 0.126
NP_441432.1_8 Reverse -144 -153 16.8143 0.00595
NP_441432.1_8 Forward -155 -146 8.25953 0.0755
NP_442320.1_8 Forward -160 -146 16.4209 0.00839
NP_442344.1_7 Reverse -146 -165 12.5858 0.0207
NP_441732.1_2 Reverse -141 -157 -6.33298 0.0495
NP_442447.1_1 Forward -198 -179 5.60432 0.258
NP_442003.1_9 Reverse -146 -165 3.34271 0.281
NP_440760.1_1 Forward -154 -135 -7.37537 0.0698
NP_440760.1_1 Reverse -145 -164 -21.7317 0.243
NP_442797.1_7 Reverse -138 -156 2.67408 0.238
NP_442274.1_8 Forward -69 -51 20.5368 0.0583
NP_441945.1_10 Forward -170 -151 10.2259 0.258
NP_441945.1_10 Forward -263 -244 8.94757 0.273
NP_442510.1_5 Reverse -136 -155 14.0608 0.22
NP_440913.1_1 Reverse -143 -161 13.1955 0.139
NP_440281.1_4 Reverse -325 -344 15.7316 0.292
NP_442010.1_1 Forward -76 -58 13.0964 0.22
NP_440713.1_4 Reverse -135 -154 10.0292 0.133
NP_440713.1_4 Forward -350 -331 3.24438 0.248
NP_442489.1_7 Forward -154 -145 20.1576 0.000695
NP_442489.1_7 Reverse -145 -154 20.1576 0.000695
NP_440559.1_1 Forward -153 -144 17.4043 0.00658
NP_440559.1_1 Reverse -146 -155 8.75118 0.0586
NP_441659.2_8 Forward -154 -144 18.1713 0.00133
NP_441659.2_8 Reverse -145 -155 11.9764 0.0147
NP_442913.1_10 Forward -163 -144 0.884433 0.15
NP_441040.1_2 Forward -258 -239 -6.49039 0.182
NP_439956.1_7 Forward -150 -131 1.57275 0.287
NP_440779.1_5 Reverse -145 -162 -4.68105 0.116
NP_442346.1_2 Forward -118 -99 17.109 0.149
NP_442346.1_5 Reverse -144 -154 16.6963 0.00248
NP_442346.1_5 Forward -155 -145 9.02648 0.118
NP_442346.1_10 Reverse -143 -162 -1.67217 0.294
NP_440545.1_3 Forward -158 -141 -1.14113 0.163
NP_440545.1_3 Reverse -141 -158 -2.61609 0.189
NP_440831.1_3 Forward -256 -237 6.19299 0.275
NP_440831.1_3 Forward -163 -144 5.02806 0.29
NP_441923.1_6 Forward -348 -334 7.57108 0.3
NP_440459.1_2 Reverse -245 -262 11.9369 0.165
NP_441653.1_2 Reverse -338 -357 4.30269 0.258
NP_442311.1_5 Forward -203 -184 12.5858 0.201
NP_440847.1_3 Reverse -132 -146 12.0937 0.254
NP_442603.1_7 Forward -154 -140 18.7801 0.0119
NP_441888.1_7 Reverse -140 -154 3.73617 0.225
NP_441948.1_4 Reverse -138 -156 9.0656 0.0572
NP_441948.1_4 Forward -161 -143 -1.25915 0.145
NP_440170.1_6 Reverse -160 -179 12.5858 0.283
NP_441833.1_4 Forward -153 -146 15.9687 0.0124
NP_441833.1_4 Reverse -146 -153 15.9687 0.0124
NP_441895.1_10 Reverse -34 -53 -27.6315 0.282
NP_442162.1_9 Forward -153 -146 16.2637 0.0124
NP_442162.1_9 Reverse -146 -153 16.2637 0.0124
NP_440772.1_6 Reverse -146 -165 7.66927 0.292
NP_442045.1_5 Reverse -328 -347 0.392778 0.266
NP_441915.1_4 Forward -57 -38 7.07848 0.293
NP_442199.1_5 Forward -162 -143 -4.72043 0.229
NP_442140.1_3 Reverse -146 -156 17.4829 0.0159
NP_442140.1_3 Forward -153 -143 10.3048 0.0902
NP_442723.1_1 Reverse -324 -343 5.40686 0.276
NP_442723.1_1 Reverse -323 -342 4.12856 0.276
NP_441671.1_10 Forward -165 -146 13.4708 0.137
NP_440875.1_9 Reverse -147 -157 17.619 0.0104
NP_440875.1_9 Forward -152 -142 8.37203 0.233
NP_440875.1_9 Reverse -100 -110 6.81464 0.297
NP_441813.1_5 Reverse -143 -153 18.1713 0.00743
NP_441813.1_5 Forward -156 -146 10.0098 0.0208
NP_441259.1_8 Reverse -148 -167 21.7297 0.087
NP_442089.1_1 Reverse -142 -161 -2.16383 0.29
NP_440590.1_4 Forward -153 -140 14.7689 0.0106
NP_440590.1_4 Reverse -146 -159 11.9173 0.0173
NP_440567.1_1 Reverse -146 -160 11.8976 0.0265
NP_440567.1_1 Reverse -99 -113 7.86607 0.0642
NP_442497.1_10 Forward -153 -144 10.4228 0.0087
NP_442497.1_10 Reverse -146 -155 10.4228 0.0087
NP_440821.1_4 Forward -156 -146 18.7612 0.00422
NP_440821.1_4 Reverse -143 -153 9.41981 0.0286
NP_441239.1_9 Forward -156 -144 16.0669 0.0175
NP_441239.1_9 Reverse -143 -155 7.80712 0.148
NP_441239.1_9 Forward -244 -232 5.05386 0.231
NP_441727.1_3 Forward -161 -142 3.53937 0.286
NP_441892.1_1 Forward -163 -146 5.34871 0.104
NP_441892.1_1 Reverse -136 -153 -4.28772 0.258
NP_442105.1_9 Forward -121 -107 14.4488 0.294
NP_442629.1_5 Forward -342 -328 19.7641 0.0585
NP_442138.1_10 Forward -154 -135 -0.885524 0.166
NP_442138.1_10 Reverse -145 -164 -5.21209 0.268
NP_442052.1_7 Forward -255 -241 16.8142 0.153
NP_440546.1_4 Reverse -145 -155 11.8882 0.0679
NP_440546.1_4 Forward -154 -144 10.046 0.109
NP_440546.1_7 Forward -256 -246 14.533 0.279
NP_441230.1_5 Forward -159 -140 6.98095 0.166
NP_440462.1_6 Forward -156 -146 17.9746 0.00578
NP_440462.1_6 Reverse -143 -153 9.61647 0.0429
NP_440462.1_6 Forward -109 -99 5.78156 0.138
NP_442611.1_1 Reverse -145 -164 -2.75381 0.295
NP_440868.1_4 Forward -158 -146 9.77374 0.043
NP_440868.1_4 Reverse -141 -153 8.00379 0.0602
NP_440868.1_8 Forward -158 -139 -4.32711 0.263
NP_442499.1_3 Reverse -235 -253 3.3624 0.295
NP_442479.1_5 Forward -365 -346 6.52 0.26
NP_442479.1_9 Forward -209 -190 -8.94866 0.266
NP_441848.1_7 Reverse -321 -340 -4.62285 0.296
NP_441843.2_9 Reverse -147 -165 20.3155 0.071
NP_442039.1_4 Forward -153 -146 15.1821 0.0124
NP_442039.1_4 Reverse -146 -153 15.1821 0.0124
NP_441811.1_1 Reverse -322 -341 6.98095 0.28
NP_442679.1_1 Reverse -26 -45 0.884433 0.192
NP_442696.1_2 Reverse -144 -162 22.5369 0.0102
NP_442837.1_3 Forward -153 -146 15.7721 0.0124
NP_442837.1_3 Reverse -146 -153 15.7721 0.0124
NP_442837.1_3 Reverse -99 -106 9.87221 0.106
NP_440160.1_10 Forward -165 -146 18.584 0.244
NP_439994.1_3 Forward -155 -136 17.6084 0.0645
NP_442053.1_1 Forward -154 -145 18.3876 0.0007
NP_442053.1_1 Reverse -145 -154 18.3876 0.0007
NP_440505.1_3 Reverse -143 -153 18.3679 0.00213
NP_440505.1_3 Forward -156 -146 14.1397 0.0235
NP_440505.1_7 Reverse -141 -160 -0.885524 0.271
NP_440351.1_3 Forward -297 -278 14.4541 0.204
NP_441203.1_1 Forward -153 -134 -20.4534 0.297
NP_442532.1_7 Reverse -145 -159 6.19444 0.171
NP_441408.2_7 Forward -171 -152 -3.14714 0.272
NP_440914.1_1 Forward -154 -144 17.5935 0.000537
NP_440914.1_1 Reverse -145 -155 8.6151 0.186
NP_441699.1_2 Reverse -309 -328 9.24257 0.252
NP_441011.1_8 Reverse -146 -155 16.9127 0.00602
NP_441011.1_8 Forward -153 -144 8.25953 0.144
NP_441011.1_8 Reverse -99 -108 5.3096 0.271
NP_442533.1_1 Forward -355 -336 -16.6185 0.273
NP_442533.1_6 Forward -154 -145 17.2076 0.00137
NP_442533.1_6 Reverse -145 -154 17.2076 0.00137
NP_442533.1_6 Reverse -307 -316 2.94966 0.232
NP_442533.1_6 Reverse -233 -242 2.26134 0.266
NP_442232.1_3 Forward -115 -96 -0.983855 0.153
NP_442322.1_4 Reverse -127 -144 -10.0899 0.298
NP_441219.1_6 Forward -164 -146 14.6705 0.147
NP_441482.1_7 Reverse -139 -153 -0.688726 0.0612
NP_439944.1_9 Forward -153 -143 10.5014 0.0887
NP_439944.1_9 Reverse -146 -156 10.4031 0.0887
NP_441028.1_6 Reverse -106 -116 9.02601 0.216
NP_441028.1_6 Reverse -328 -338 4.30615 0.278
NP_440115.1_6 Reverse -142 -152 16.008 0.0325
NP_440115.1_6 Forward -110 -100 11.8781 0.109
NP_440007.1_9 Forward -116 -102 3.53951 0.269
NP_440007.1_9 Forward -184 -170 1.67122 0.285
NP_439965.1_1 Reverse -136 -155 -6.39206 0.213
NP_441680.1_4 Reverse -332 -351 4.32602 0.209
NP_441602.1_3 Reverse -140 -159 -2.65548 0.235
NP_441972.1_5 Reverse -103 -122 -6.49039 0.231
NP_441106.1_1 Forward -155 -146 18.191 0.0028
NP_441106.1_1 Reverse -144 -153 9.63616 0.0311
NP_440429.1_2 Reverse -146 -165 14.2574 0.176
NP_441815.1_6 Reverse -326 -345 -0.0996487 0.291
NP_442588.1_6 Forward -151 -132 4.22769 0.199
NP_442306.1_10 Reverse -140 -159 -0.000545616 0.0484
NP_441286.1_1 Reverse -144 -156 14.7886 0.00418
NP_441286.1_1 Forward -155 -143 3.38223 0.0467
NP_440670.1_8 Forward -154 -145 18.3876 0.000699
NP_440670.1_8 Reverse -145 -154 18.3876 0.000699
NP_440886.1_7 Forward -155 -145 17.7774 0.0011
NP_440886.1_7 Reverse -336 -346 12.5659 0.0805
NP_440886.1_7 Reverse -144 -154 7.94438 0.0805
NP_440886.1_7 Reverse -333 -343 5.19112 0.194
NP_440828.1_4 Reverse -144 -163 0.981987 0.181
NP_441001.1_10 Forward -257 -238 4.03102 0.295
NP_442614.1_2 Forward -113 -99 12.8809 0.142
NP_442614.1_2 Forward -154 -140 9.14437 0.242
NP_442072.1_9 Reverse -144 -162 -21.712 0.212
NP_440907.2_8 Reverse -146 -156 17.4824 0.00685
NP_441463.1_3 Forward -164 -145 7.66927 0.0515
NP_441463.1_3 Forward -72 -53 -6.09707 0.239
NP_441626.1_2 Forward -153 -146 15.7721 0.0124
NP_441626.1_2 Reverse -146 -153 15.7721 0.0124
NP_442211.1_3 Reverse -242 -261 7.37474 0.283
NP_442365.1_7 Reverse -141 -160 4.81767 0.144
NP_440107.1_5 Forward -155 -136 -1.08219 0.178
NP_440107.1_5 Reverse -144 -163 -2.0655 0.178
NP_442794.1_1 Reverse -141 -153 20.0002 0.00523
NP_442615.1_1 Forward -163 -145 6.70565 0.034
NP_441962.1_4 Reverse -140 -159 -7.86702 0.195
NP_441962.1_4 Forward -267 -248 -12.8819 0.265
NP_441962.1_4 Forward -159 -140 -12.8819 0.265
NP_440387.1_1 Reverse -145 -161 -1.21977 0.142
NP_440387.1_1 Forward -154 -138 -3.28472 0.157
NP_441431.1_2 Forward -157 -143 8.84875 0.204
NP_441431.1_2 Reverse -142 -156 7.57046 0.238
NP_441488.1_8 Reverse -140 -154 9.73373 0.146
NP_441836.1_2 Forward -160 -141 9.53756 0.0989
NP_441836.1_2 Reverse -142 -161 -4.32711 0.255
NP_441836.1_2 Reverse -186 -205 -5.11376 0.272
NP_441993.1_1 Forward -160 -141 3.99329 0.227
NP_441993.1_1 Forward -349 -330 1.16703 0.284
NP_441174.1_2 Reverse -142 -156 17.6008 0.0437
NP_440114.1_10 Reverse -145 -159 17.2075 0.0116
NP_440766.1_4 Reverse -141 -155 8.75105 0.0871
NP_439988.1_3 Reverse -149 -163 13.8643 0.185
NP_439988.1_7 Forward -155 -141 11.7987 0.292
NP_439910.1_2 Forward -162 -145 -21.2006 0.183
NP_440457.1_1 Reverse -141 -153 7.61046 0.101
NP_440798.1_6 Reverse -146 -159 2.47756 0.17
NP_441801.1_2 Forward -242 -223 -7.57203 0.0981
NP_442680.1_5 Reverse -26 -45 0.072229 0.269
NP_441332.1_6 Reverse -333 -343 13.3894 0.189
NP_440473.1_9 Forward -165 -146 -9.34199 0.26
NP_442509.1_9 Reverse -145 -155 16.2041 0.00739
NP_442509.1_9 Forward -154 -144 8.14104 0.192
NP_440734.1_9 Forward -164 -145 17.8957 0.0967
NP_440554.1_4 Reverse -146 -156 13.943 0.0218
NP_440554.1_4 Forward -153 -143 8.92815 0.0646
NP_442737.1_5 Forward -263 -244 12.0064 0.268
NP_441885.1_5 Forward -154 -144 20.9245 0.000538
NP_441885.1_5 Reverse -145 -155 11.4848 0.00668
NP_440478.1_10 Forward -156 -142 17.3058 0.107
NP_442310.1_5 Reverse -34 -53 8.16093 0.271
NP_442341.1_7 Reverse -144 -158 12.291 0.0455
NP_442341.1_7 Forward -155 -141 9.2427 0.0751
NP_441756.1_5 Forward -158 -139 0.786102 0.224
NP_441756.1_5 Reverse -331 -350 -0.39387 0.244
NP_441756.1_5 Forward -238 -219 -4.91709 0.297
NP_440423.1_6 Forward -162 -143 5.30933 0.059
NP_443000.1_3 Forward -346 -327 9.77726 0.297
NP_443000.1_7 Reverse -143 -153 19.9412 0.00223
NP_443000.1_7 Forward -156 -146 2.04498 0.226
NP_442513.1_5 Forward -162 -143 13.175 0.265
NP_441842.1_10 Forward -161 -147 15.6342 0.0393
NP_440275.1_3 Forward -156 -146 17.9746 0.0082
NP_440275.1_3 Reverse -143 -153 15.123 0.0182
NP_440091.1_1 Forward -158 -146 20.1968 0.00953
NP_440091.1_1 Reverse -94 -106 0.628964 0.241
NP_440091.1_1 Forward -111 -99 -0.256015 0.273
NP_441307.1_6 Forward -154 -135 10.3242 0.217
NP_440679.1_10 Forward -260 -241 -11.2103 0.182
NP_440679.1_10 Forward -254 -235 -18.7818 0.279
NP_443010.1_10 Forward -157 -140 6.05634 0.193
NP_442451.1_2 Reverse -137 -156 -8.26035 0.244
NP_442451.1_2 Forward -162 -143 -9.047 0.258
NP_439962.1_4 Reverse -137 -156 1.96607 0.197
NP_439962.1_4 Reverse -240 -259 1.37609 0.197
NP_439962.1_4 Reverse -329 -348 -0.0988766 0.197
NP_439962.1_4 Forward -162 -143 -5.31042 0.278
NP_439962.1_4 Reverse -237 -256 -9.047 0.298
NP_440175.1_7 Reverse -221 -239 9.36312 0.28
NP_440149.1_8 Forward -154 -135 -2.36049 0.168
NP_441105.1_3 Reverse -134 -153 -1.18052 0.147
NP_440216.1_1 Reverse -145 -159 6.29277 0.0156
NP_440216.1_1 Forward -154 -140 -0.492064 0.0284
NP_440216.1_9 Reverse -54 -63 10.7178 0.286
NP_440172.1_1 Forward -154 -144 15.0247 0.00945
NP_440172.1_1 Reverse -145 -155 8.73149 0.0586
NP_442290.1_8 Reverse -144 -158 14.6509 0.288
NP_440167.1_3 Forward -164 -145 11.7992 0.21
NP_442015.1_10 Reverse -141 -154 21.1604 0.00329
NP_441226.1_7 Forward -153 -146 14.4934 0.0123
NP_441226.1_7 Reverse -146 -153 14.4934 0.0123
NP_441226.1_7 Forward -9 -2 6.52862 0.253
NP_441226.1_7 Forward -244 -237 5.93863 0.266
NP_442446.1_5 Reverse -100 -119 9.53756 0.135
NP_441111.1_7 Forward -153 -145 18.7023 0.00294
NP_441111.1_7 Reverse -146 -154 18.7023 0.00294
NP_441766.1_2 Forward -154 -145 17.5026 0.00297
NP_441766.1_2 Reverse -145 -154 17.5026 0.00297
NP_442252.1_3 Forward -161 -143 8.27895 0.263
NP_440416.1_1 Reverse -145 -164 -5.01543 0.138
NP_440416.1_9 Reverse -138 -157 -7.17871 0.0972
NP_440416.1_9 Forward -161 -142 -12.7836 0.16
NP_440416.1_9 Forward -69 -50 -15.6352 0.196
NP_440416.1_9 Reverse -137 -156 -18.3884 0.256
NP_440416.1_9 Reverse -240 -259 -18.9784 0.267
NP_443052.1_8 Forward -164 -145 22.2223 0.00167
NP_443052.1_9 Reverse -237 -256 4.52268 0.154
NP_443052.1_9 Reverse -332 -351 -2.75381 0.242
NP_443052.1_9 Forward -238 -219 -4.22878 0.255
NP_440072.1_5 Reverse -225 -243 4.54237 0.236
NP_441940.1_4 Forward -270 -251 7.47261 0.286
NP_442403.1_8 Forward -72 -53 3.04771 0.226
NP_442154.1_1 Forward -357 -339 -11.7806 0.216
NP_442154.1_1 Forward -348 -330 -13.6489 0.217
NP_442154.1_1 Forward -261 -243 -17.6804 0.262
NP_440261.1_5 Forward -153 -140 4.93583 0.0478
NP_440261.1_5 Reverse -146 -159 -10.6005 0.201
NP_440988.1_10 Forward -252 -238 8.09365 0.205
NP_440988.1_10 Forward -156 -142 5.67333 0.24
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CACCCGTATTACCTGTCTACTCAACGACGAAAAGGACATTGAAGCCATTTTTACCGGGGTGGCGGGGGGGCAAAATTTACGCTCTGTGCTGGCCAAACTAGATTCCAAACAACAGGCTTTAGTGTTAGGCCATGCAGTACCCATGCCGGTGGTGGTGCGGACCCGGCCCTACGACCAGCAGTTTTACAGTGAAATTGGTTGCCAAGATTGGCCAAACAAGACCGATGCTGAAGTATTGGCCGAAGCGGCGATCGCCAGGGAGGATTTGGGCTTTTAGAGATTCACCAGGGGGAAGCGATCAAAGCTTATACTTAAGGTTTGAAGGTAATTATCACCATTTTCATTGCCCCCACCGTTTTTCCGTTTGTCCACCCCAGCTTGTTCTTGAACGCCCAACGGC

CDS

ATGGTTTTTTGGAAACGCTTTTTTAATCCCGATTCAACTAGTTCACCATCCCTGGGCCCAACGGGGGCAGAAGAATTTCCCACCGATAACGGCGATAAAGCCCGGATATTTTTCACCACTGAGCGGGACATTGACCTTTACGAGCTGGAGGAATTATGTGATGCGGTGGGCTGGGCCCGGCGGCCAATTCGCAAAGTCAAAAAGGCCGTAGAGTGTAGTTTTTTGGTGGTTACCATGTGGGAAATGCAGGGCAATCGGCGTCGATTGGTGGGGTTTGCCAGGGCTACTTCCGACCATGCTTTCAATGCCACCGTGTGGGACGTGGTGATCCATCCTAGTCTTCAGAGCAAGGGCTTGGGTAAGGCCCTGATGCAATACATCATCCGTAAATTACGCCATTACGACATTAGCAATATCACCCTGTTCGCCGATCCCCAGGTGGTGGATTTTTACCGGCGTTTGGGCTTTGTGCTCGACCCAGAAGGCATTAAGGGCATGTTTTGGTACCCGGACTAA

Protein

MVFWKRFFNPDSTSSPSLGPTGAEEFPTDNGDKARIFFTTERDIDLYELEELCDAVGWARRPIRKVKKAVECSFLVVTMWEMQGNRRRLVGFARATSDHAFNATVWDVVIHPSLQSKGLGKALMQYIIRKLRHYDISNITLFADPQVVDFYRRLGFVLDPEGIKGMFWYPD