Your browser is old and dusty. Try Google Chrome!

Details for sll0269

ORF sll0269
Accession NP_441817.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -220 -206 12.0943 0.222
NP_441061.1_2 Forward -219 -205 7.86607 0.0956
NP_441061.1_2 Forward -55 -41 1.08123 0.195
NP_441061.1_2 Reverse -212 -226 -0.393733 0.228
NP_441061.1_2 Forward -40 -26 -0.492064 0.231
NP_440557.1_1 Forward -219 -200 -1.08219 0.27
NP_440795.1_7 Forward -219 -212 14.6904 0.0123
NP_440795.1_7 Reverse -212 -219 14.6904 0.0123
NP_440795.1_7 Forward -49 -42 11.1505 0.108
NP_440795.1_7 Reverse -48 -55 10.2655 0.154
NP_440694.1_6 Forward -32 -13 4.62101 0.279
NP_441418.1_6 Forward -220 -201 8.94757 0.00332
NP_441418.1_6 Forward -35 -16 -15.5368 0.0822
NP_441418.1_6 Reverse -211 -230 -20.5517 0.117
NP_442291.1_5 Reverse -210 -226 -3.08806 0.234
NP_441453.1_1 Reverse -204 -222 5.42659 0.246
NP_441453.1_4 Reverse -211 -219 16.539 0.00633
NP_441453.1_4 Forward -220 -212 16.539 0.00633
NP_441453.1_4 Reverse -41 -49 4.93597 0.224
NP_441453.1_4 Forward -56 -48 4.05099 0.268
NP_441623.1_1 Reverse -204 -222 3.06741 0.202
NP_442151.1_6 Forward -220 -206 12.4876 0.0722
NP_442151.1_6 Reverse -211 -225 7.57108 0.194
NP_442151.1_6 Reverse -47 -61 7.17775 0.206
NP_442838.1_7 Reverse -206 -225 -10.227 0.232
NP_441818.1_9 Reverse -53 -72 -8.55534 0.277
NP_441818.1_9 Reverse -158 -177 -9.34199 0.29
NP_441818.1_9 Reverse -351 -370 -10.0303 0.292
NP_441818.1_9 Reverse -152 -171 -10.227 0.292
NP_440226.1_1 Reverse -211 -230 9.14423 0.0768
NP_440226.1_1 Forward -220 -201 6.88262 0.118
NP_442169.1_1 Reverse -23 -42 -0.590531 0.261
NP_441630.1_3 Forward -228 -209 8.45592 0.112
NP_441630.1_3 Reverse -203 -222 -0.787193 0.29
NP_442623.1_3 Forward -219 -200 -8.16202 0.127
NP_442287.1_3 Forward -228 -211 18.2293 0.1
NP_442173.1_1 Forward -219 -211 15.4574 0.00633
NP_442173.1_1 Reverse -212 -220 15.4574 0.00633
NP_442752.1_4 Forward -220 -213 13.8055 0.0199
NP_442752.1_4 Reverse -211 -218 13.8055 0.0199
NP_442752.1_4 Reverse -322 -329 9.47889 0.109
NP_442752.1_4 Reverse -34 -41 7.90559 0.144
NP_443027.1_4 Forward -222 -212 15.3197 0.0437
NP_443027.1_4 Reverse -209 -219 13.943 0.0452
NP_441812.1_3 Reverse -210 -224 14.9459 0.106
NP_442975.1_10 Reverse -207 -221 21.6317 0.000774
NP_442975.1_10 Forward -224 -210 11.897 0.0482
NP_442975.1_10 Reverse -43 -57 8.84875 0.0847
NP_442975.1_10 Forward -54 -40 2.75226 0.269
NP_440784.1_7 Forward -219 -212 15.9687 0.0123
NP_440784.1_7 Reverse -212 -219 15.9687 0.0123
NP_440061.1_9 Forward -45 -31 9.24208 0.149
NP_440061.1_9 Forward -383 -369 6.98048 0.223
NP_440061.1_9 Forward -338 -324 5.30886 0.29
NP_440061.1_9 Forward -37 -23 5.1122 0.294
NP_440110.1_4 Forward -46 -27 1.76941 0.269
NP_440110.1_8 Reverse -361 -380 6.09597 0.149
NP_440110.1_8 Forward -222 -203 3.24438 0.211
NP_441476.1_5 Forward -213 -194 0.294447 0.19
NP_440878.1_9 Reverse -201 -220 -2.16383 0.258
NP_442062.1_8 Forward -220 -210 19.4496 0.000558
NP_442062.1_8 Reverse -211 -221 10.3048 0.0493
NP_442062.1_8 Forward -56 -46 6.27322 0.132
NP_440761.1_4 Forward -225 -206 -12.2919 0.241
NP_441900.1_2 Reverse -192 -210 -6.27474 0.293
NP_441859.1_3 Forward -221 -202 7.57013 0.157
NP_441859.1_3 Reverse -210 -229 7.07848 0.165
NP_441859.1_3 Forward -36 -17 3.9319 0.23
NP_441859.1_3 Forward -325 -306 1.37531 0.287
NP_440304.1_4 Forward -222 -212 18.9579 0.00406
NP_440304.1_4 Reverse -209 -219 9.91146 0.051
NP_440304.1_4 Reverse -39 -49 5.97822 0.185
NP_440304.1_4 Reverse -326 -336 4.89658 0.244
NP_440304.1_4 Reverse -24 -34 4.3066 0.271
NP_442242.1_4 Forward -219 -212 14.3954 0.0124
NP_442242.1_4 Reverse -212 -219 14.3954 0.0124
NP_440044.1_8 Reverse -212 -231 26.5488 0.00272
NP_441660.1_8 Forward -282 -263 14.9458 0.216
NP_439918.1_2 Reverse -158 -177 -2.36049 0.242
NP_441208.1_9 Forward -223 -209 13.9626 0.103
NP_441208.1_9 Reverse -208 -222 7.76774 0.219
NP_441208.1_9 Forward -313 -299 5.70279 0.262
NP_441594.1_6 Reverse -41 -60 2.75272 0.244
NP_441594.1_6 Forward -229 -210 1.27776 0.269
NP_441594.1_6 Reverse -202 -221 -0.0988766 0.297
NP_442196.1_10 Forward -222 -203 14.1591 0.172
NP_440132.1_1 Reverse -320 -338 8.96727 0.255
NP_442110.1_7 Forward -220 -206 10.226 0.0684
NP_442110.1_7 Reverse -211 -225 0.491246 0.259
NP_442110.1_7 Reverse -41 -55 0.491246 0.259
NP_441925.1_4 Forward -42 -23 2.16195 0.155
NP_440330.1_2 Forward -107 -88 8.75091 0.297
NP_440856.1_4 Forward -227 -208 5.89931 0.0802
NP_440856.1_7 Forward -220 -201 -6.68705 0.246
NP_440856.1_7 Reverse -118 -137 -9.14533 0.283
NP_441083.1_5 Forward -220 -210 11.3864 0.0159
NP_441083.1_5 Reverse -211 -221 11.2881 0.0159
NP_442827.1_8 Reverse -203 -222 17.6982 0.0295
NP_442115.2_8 Reverse -150 -169 17.6007 0.123
NP_441434.1_7 Forward -218 -204 5.40779 0.225
NP_441738.1_2 Forward -218 -211 15.28 0.0102
NP_441738.1_2 Reverse -213 -220 15.28 0.0102
NP_441558.1_5 Forward -222 -203 23.2056 0.00172
NP_440209.1_1 Reverse -211 -219 18.1123 0.00295
NP_440209.1_1 Forward -220 -212 18.1123 0.00295
NP_442889.1_8 Reverse -208 -222 3.63724 0.273
NP_440447.1_6 Forward -138 -120 2.18243 0.243
NP_440447.1_6 Reverse -203 -221 1.19912 0.267
NP_442398.1_3 Forward -119 -100 18.3146 0.253
NP_441770.1_1 Forward -382 -363 17.0099 0.169
NP_441770.1_5 Forward -228 -209 -1.27885 0.268
NP_441770.1_10 Forward -222 -203 9.93088 0.248
NP_440178.1_7 Reverse -210 -229 -13.4719 0.136
NP_440178.1_7 Forward -221 -202 -21.83 0.241
NP_442111.1_4 Forward -221 -207 9.83269 0.0575
NP_441387.1_7 Forward -58 -39 7.86593 0.209
NP_441533.1_7 Forward -39 -21 13.7847 0.293
NP_440906.1_5 Forward -219 -212 15.8704 0.0124
NP_440906.1_5 Reverse -212 -219 15.8704 0.0124
NP_440747.1_10 Forward -223 -211 -1.92764 0.0192
NP_440747.1_10 Reverse -208 -220 -2.02597 0.0196
NP_441130.1_10 Reverse -209 -223 17.9942 0.0144
NP_441130.1_10 Forward -222 -208 10.521 0.112
NP_441486.1_1 Forward -340 -326 -3.04867 0.175
NP_441486.1_1 Reverse -208 -222 -3.44199 0.178
NP_441486.1_1 Forward -223 -209 -4.32697 0.194
NP_442634.1_4 Reverse -209 -223 4.52282 0.0764
NP_442634.1_4 Forward -222 -208 4.22782 0.0819
NP_441265.1_3 Reverse -205 -219 2.94952 0.181
NP_442848.1_1 Reverse -205 -219 -3.24533 0.263
NP_442848.1_1 Forward -226 -212 -3.54032 0.268
NP_442848.1_9 Forward -160 -141 2.94938 0.245
NP_441012.1_4 Forward -54 -41 9.16406 0.272
NP_443018.1_3 Forward -219 -212 14.8871 0.0123
NP_443018.1_3 Reverse -212 -219 14.8871 0.0123
NP_443018.1_3 Forward -34 -27 7.6106 0.156
NP_443018.1_3 Reverse -48 -55 4.36568 0.254
NP_443018.1_3 Forward -55 -48 4.07068 0.299
NP_441316.1_7 Reverse -209 -224 3.81481 0.137
NP_441634.1_8 Forward -222 -208 5.60446 0.114
NP_441634.1_8 Forward -251 -237 -1.5737 0.294
NP_441634.1_8 Reverse -209 -223 -4.32697 0.295
NP_441634.1_9 Reverse -308 -327 8.16011 0.294
NP_440376.1_1 Forward -220 -211 19.4693 0.000692
NP_440376.1_1 Reverse -211 -220 19.4693 0.000692
NP_440376.1_1 Reverse -41 -50 5.60459 0.125
NP_440376.1_1 Reverse -328 -337 2.35967 0.224
NP_441857.1_6 Forward -311 -301 15.9097 0.199
NP_441588.1_4 Forward -218 -208 6.96153 0.178
NP_441588.1_4 Reverse -213 -223 6.66654 0.185
NP_442687.1_7 Reverse -210 -220 15.8113 0.0125
NP_442687.1_7 Forward -221 -211 9.02648 0.0994
NP_442687.1_7 Reverse -40 -50 4.20827 0.262
NP_442687.1_7 Forward -57 -47 4.10993 0.266
NP_442191.1_4 Forward -219 -205 15.3562 0.0603
NP_442485.1_3 Forward -61 -42 3.93269 0.192
NP_442485.1_3 Forward -147 -128 0.491109 0.24
NP_442485.1_3 Reverse -36 -55 -5.11376 0.287
NP_441846.1_10 Reverse -24 -43 -11.2103 0.19
NP_441846.1_10 Reverse -174 -193 -19.0768 0.256
NP_441846.1_10 Reverse -33 -52 -20.7484 0.256
NP_441846.1_10 Reverse -25 -44 -20.7484 0.256
NP_441846.1_10 Reverse -26 -45 -22.5183 0.261
NP_440741.1_1 Forward -90 -71 12.9783 0.11
NP_441950.1_7 Reverse -351 -370 -7.96535 0.283
NP_441950.1_8 Forward -60 -46 15.2409 0.0987
NP_441950.1_8 Reverse -49 -63 4.22782 0.298
NP_441763.1_10 Reverse -200 -219 8.16011 0.22
NP_440360.1_4 Forward -374 -355 7.57094 0.229
NP_442658.1_1 Reverse -209 -219 18.7607 0.00222
NP_442658.1_1 Forward -222 -212 15.9091 0.00966
NP_442658.1_1 Reverse -24 -34 5.48612 0.265
NP_442658.1_1 Reverse -45 -55 4.89613 0.292
NP_440141.1_8 Reverse -307 -326 16.6174 0.121
NP_440141.1_8 Reverse -319 -338 9.53756 0.217
NP_440141.1_8 Reverse -17 -36 4.32602 0.291
NP_441855.2_4 Forward -58 -39 13.2829 0.172
NP_442782.1_2 Reverse -41 -55 15.9292 0.173
NP_442782.1_2 Forward -315 -301 8.65272 0.198
NP_442782.1_2 Reverse -322 -336 5.80112 0.236
NP_442782.1_2 Forward -56 -42 1.67122 0.281
NP_440656.1_8 Forward -231 -212 4.71934 0.0974
NP_441487.1_9 Reverse -210 -229 4.62101 0.142
NP_442937.1_5 Forward -225 -206 6.58763 0.275
NP_441958.1_5 Forward -221 -211 21.2195 0.000805
NP_441958.1_5 Reverse -210 -220 12.2714 0.00183
NP_441127.1_1 Reverse -44 -58 9.14437 0.278
NP_442836.1_10 Forward -311 -301 9.32148 0.277
NP_440203.1_5 Forward -32 -22 12.7626 0.138
NP_439905.1_1 Reverse -48 -61 6.31247 0.293
NP_440984.1_7 Forward -61 -47 16.8142 0.0362
NP_440984.1_7 Forward -338 -324 12.8809 0.121
NP_440984.1_7 Reverse -206 -220 10.6193 0.122
NP_440984.1_7 Forward -48 -34 7.27608 0.178
NP_440984.1_7 Forward -225 -211 6.98109 0.192
NP_442690.1_1 Forward -122 -103 -11.6036 0.232
NP_442911.1_2 Reverse -201 -220 0.294447 0.0682
NP_442911.1_2 Reverse -314 -333 -9.73531 0.262
NP_441580.1_6 Reverse -200 -219 13.6675 0.0472
NP_440153.1_5 Forward -219 -205 3.93283 0.199
NP_440153.1_5 Reverse -212 -226 1.67122 0.245
NP_441591.1_10 Forward -222 -203 5.89931 0.295
NP_440993.1_2 Forward -225 -209 20.708 0.0195
NP_440993.1_2 Reverse -206 -222 13.6282 0.0656
NP_440993.1_3 Reverse -201 -220 -2.16459 0.297
NP_442210.1_7 Forward -106 -87 14.1591 0.225
NP_441099.1_5 Reverse -201 -220 5.80098 0.0469
NP_442002.1_9 Reverse -210 -217 10.7572 0.185
NP_440809.1_9 Forward -229 -211 -7.45401 0.225
NP_441294.1_7 Reverse -207 -221 13.0902 0.0747
NP_442438.1_10 Reverse -206 -220 17.7975 0.0179
NP_442438.1_10 Reverse -42 -56 12.8809 0.0377
NP_442438.1_10 Forward -55 -41 -0.688726 0.274
NP_442566.1_7 Reverse -352 -371 15.4374 0.226
NP_442885.1_1 Reverse -197 -216 15.4374 0.268
NP_441000.1_6 Reverse -210 -224 3.44117 0.111
NP_441000.1_6 Forward -221 -207 -3.34366 0.221
NP_442771.1_1 Forward -222 -204 -6.56903 0.168
NP_442771.1_1 Reverse -39 -57 -8.14232 0.182
NP_441674.1_2 Forward -212 -193 9.73422 0.197
NP_440147.1_4 Reverse -209 -222 12.2123 0.0326
NP_440147.1_4 Forward -222 -209 11.819 0.0326
NP_441550.1_8 Forward -222 -212 17.4824 0.00754
NP_441550.1_8 Reverse -209 -219 10.501 0.066
NP_441916.1_7 Reverse -211 -221 18.9579 0.00144
NP_441916.1_7 Forward -220 -210 18.4663 0.00144
NP_441916.1_7 Forward -56 -46 5.09324 0.146
NP_441916.1_7 Reverse -41 -51 4.60159 0.169
NP_441916.1_10 Forward -243 -224 0.0977854 0.292
NP_440465.1_10 Reverse -31 -50 -0.590531 0.29
NP_441041.1_4 Forward -220 -201 0.392778 0.0881
NP_441041.1_7 Reverse -208 -220 19.5648 0.00277
NP_441041.1_7 Forward -223 -211 18.3015 0.00558
NP_442642.1_9 Forward -227 -210 6.33202 0.192
NP_440569.1_6 Reverse -319 -338 7.07928 0.228
NP_441725.1_5 Forward -219 -209 9.02648 0.0553
NP_441725.1_5 Reverse -212 -222 8.92815 0.0553
NP_441725.1_5 Forward -34 -24 4.79825 0.115
NP_441725.1_5 Forward -49 -39 -0.314959 0.246
NP_441725.1_5 Forward -336 -326 -0.41329 0.251
NP_439966.1_7 Reverse -209 -219 17.4824 0.00636
NP_439966.1_7 Forward -222 -212 13.8442 0.0234
NP_439966.1_7 Forward -333 -323 4.89613 0.254
NP_439966.1_9 Reverse -209 -218 10.7178 0.0863
NP_439966.1_9 Forward -222 -213 0.983037 0.253
NP_442941.1_3 Reverse -212 -222 10.9931 0.0116
NP_442941.1_3 Forward -219 -209 2.53664 0.14
NP_440289.1_2 Reverse -208 -221 12.9006 0.0132
NP_440289.1_2 Forward -223 -210 5.03416 0.0636
NP_440289.1_2 Reverse -38 -51 0.60927 0.156
NP_440289.1_2 Forward -53 -40 -4.79893 0.294
NP_440983.1_5 Forward -381 -362 -7.67036 0.291
NP_442281.1_1 Reverse -206 -220 17.6985 0.00542
NP_442281.1_1 Forward -225 -211 15.9285 0.00992
NP_442281.1_5 Forward -217 -198 16.4199 0.201
NP_441334.1_7 Forward -222 -203 -0.4922 0.0581
NP_441334.1_7 Reverse -209 -228 -17.9951 0.275
NP_442901.1_4 Reverse -58 -77 1.17943 0.278
NP_440177.1_5 Reverse -199 -218 11.1109 0.281
NP_442256.1_2 Reverse -209 -227 -9.0273 0.247
NP_440437.1_1 Reverse -205 -224 7.57094 0.0646
NP_441457.1_7 Forward -222 -203 16.6174 0.0464
NP_440723.1_8 Reverse -40 -54 13.0776 0.178
NP_441644.1_6 Reverse -211 -221 19.0557 0.000803
NP_441644.1_6 Reverse -47 -57 10.6976 0.0628
NP_441644.1_6 Forward -220 -210 10.1076 0.0628
NP_441644.1_6 Forward -35 -25 7.0594 0.137
NP_440867.1_10 Forward -44 -25 9.3409 0.25
NP_442215.1_2 Forward -222 -206 -1.3181 0.183
NP_442215.1_2 Forward -144 -128 -4.46469 0.233
NP_442029.1_6 Reverse -241 -260 2.55606 0.294
NP_442029.1_10 Forward -60 -41 6.19431 0.284
NP_440253.1_2 Forward -220 -202 6.60732 0.0778
NP_440253.1_2 Reverse -211 -229 2.77242 0.131
NP_440929.1_8 Forward -220 -211 19.2726 0.000701
NP_440929.1_8 Reverse -211 -220 19.2726 0.000701
NP_442933.1_10 Forward -220 -211 17.601 0.00325
NP_442933.1_10 Reverse -211 -220 17.601 0.00325
NP_442933.1_10 Reverse -47 -56 5.11294 0.204
NP_441751.2_8 Reverse -212 -226 4.22782 0.0521
NP_441751.2_8 Forward -49 -35 1.86788 0.0935
NP_442554.1_8 Reverse -212 -222 19.1546 0.00369
NP_442554.1_8 Forward -219 -209 16.008 0.0065
NP_442554.1_8 Reverse -48 -58 7.55152 0.0893
NP_441762.1_7 Forward -221 -209 12.527 0.0142
NP_441762.1_7 Reverse -210 -222 11.7404 0.0142
NP_441762.1_7 Reverse -46 -58 -5.56589 0.217
NP_441762.1_7 Reverse -40 -52 -5.76255 0.238
NP_442142.1_4 Reverse -208 -221 14.4733 0.0311
NP_442142.1_4 Forward -223 -210 14.1783 0.0311
NP_442292.1_1 Reverse -212 -221 17.5026 0.00435
NP_442292.1_1 Forward -219 -210 9.63616 0.0183
NP_442292.1_1 Reverse -48 -57 -0.68859 0.268
NP_442292.1_5 Forward -224 -205 0.196116 0.257
NP_442143.1_8 Reverse -203 -222 10.4217 0.235
NP_442476.1_5 Reverse -70 -89 17.994 0.166
NP_442476.1_6 Reverse -48 -62 0.88457 0.238
NP_442381.1_8 Reverse -208 -227 -3.3438 0.126
NP_441711.1_4 Reverse -202 -221 9.14423 0.144
NP_441711.1_4 Forward -229 -210 6.78429 0.144
NP_443009.1_5 Forward -221 -210 19.626 0.00102
NP_443009.1_5 Reverse -210 -221 7.82632 0.118
NP_443009.1_5 Forward -57 -46 5.76138 0.189
NP_442406.1_9 Forward -143 -124 1.57275 0.274
NP_442301.1_2 Forward -341 -322 7.4718 0.254
NP_442741.1_7 Forward -220 -201 15.0441 0.196
NP_441715.1_4 Forward -219 -209 9.32148 0.097
NP_441715.1_4 Reverse -212 -222 7.25653 0.108
NP_440357.1_3 Reverse -209 -228 4.916 0.242
NP_440357.1_3 Reverse -259 -278 2.45773 0.258
NP_440881.1_7 Reverse -357 -376 13.4708 0.237
NP_441198.1_5 Reverse -213 -226 12.9984 0.216
NP_441198.1_8 Forward -222 -212 15.4199 0.0427
NP_440379.1_5 Forward -145 -126 -6.98204 0.24
NP_440379.1_5 Forward -340 -321 -8.16202 0.25
NP_440379.1_5 Forward -319 -300 -10.522 0.28
NP_441468.1_1 Forward -219 -212 15.8704 0.0124
NP_441468.1_1 Reverse -212 -219 15.8704 0.0124
NP_441468.1_1 Reverse -48 -55 4.46401 0.224
NP_441020.2_6 Forward -222 -205 18.6234 0.0112
NP_441020.2_6 Reverse -209 -226 18.4267 0.0118
NP_441015.1_10 Forward -225 -206 -4.22878 0.201
NP_441015.1_10 Reverse -21 -40 -6.49039 0.249
NP_441015.1_10 Reverse -361 -380 -8.85033 0.277
NP_441673.1_1 Forward -220 -211 20.8459 0.000698
NP_441673.1_1 Reverse -211 -220 20.8459 0.000698
NP_441673.1_1 Reverse -47 -56 -8.06341 0.254
NP_441731.1_9 Reverse -183 -200 12.3302 0.234
NP_441826.1_2 Reverse -205 -219 13.9626 0.0213
NP_441826.1_2 Forward -160 -146 0.0979218 0.198
NP_441826.1_2 Forward -62 -48 -4.03198 0.291
NP_442868.1_6 Forward -222 -212 8.63316 0.0555
NP_442868.1_6 Reverse -209 -219 8.53483 0.0555
NP_442868.1_6 Forward -58 -48 8.4365 0.057
NP_442868.1_6 Reverse -39 -49 7.64985 0.0726
NP_442719.1_2 Reverse -295 -313 -11.5846 0.292
NP_442227.1_2 Forward -41 -22 5.80098 0.202
NP_442361.1_3 Reverse -205 -218 10.5407 0.272
NP_442808.1_1 Reverse -210 -220 18.4657 0.00201
NP_442808.1_1 Forward -221 -211 8.73102 0.0481
NP_442808.1_1 Forward -238 -228 4.01116 0.212
NP_440145.1_3 Forward -230 -211 -0.787193 0.143
NP_442542.1_2 Reverse -24 -37 6.21414 0.232
NP_442542.1_9 Reverse -204 -218 21.6317 0.00646
NP_442113.1_3 Forward -381 -362 3.93269 0.254
NP_442050.1_1 Reverse -22 -41 8.75091 0.25
NP_442050.1_1 Reverse -40 -59 6.39097 0.291
NP_442050.1_5 Forward -222 -212 17.1874 0.00812
NP_442050.1_5 Reverse -209 -219 8.23937 0.234
NP_441114.1_3 Forward -33 -24 7.57121 0.231
NP_440558.1_2 Reverse -298 -317 -6.78538 0.28
NP_442789.1_4 Reverse -194 -213 -0.688862 0.209
NP_442789.1_4 Reverse -296 -315 -4.03212 0.258
NP_442789.1_4 Forward -222 -203 -7.96535 0.299
NP_441518.1_3 Forward -230 -211 -5.9004 0.129
NP_441518.1_3 Reverse -201 -220 -6.1954 0.132
NP_441878.1_6 Forward -221 -211 10.5014 0.0176
NP_441878.1_6 Reverse -210 -220 10.4031 0.0176
NP_441878.1_6 Reverse -327 -337 -7.00147 0.201
NP_441878.1_6 Reverse -46 -56 -7.19813 0.21
NP_441878.1_6 Reverse -40 -50 -7.19813 0.21
NP_441878.1_6 Reverse -25 -35 -7.39479 0.222
NP_441878.1_6 Reverse -33 -43 -7.78811 0.266
NP_441036.1_8 Reverse -210 -220 17.7779 0.000554
NP_441036.1_8 Forward -221 -211 15.713 0.00724
NP_441036.1_8 Reverse -46 -56 6.27322 0.239
NP_441557.1_5 Forward -220 -211 19.9609 0.000699
NP_441557.1_5 Reverse -211 -220 19.9609 0.000699
NP_441557.1_5 Forward -56 -47 -0.68859 0.229
NP_441557.1_8 Forward -378 -368 12.5659 0.236
NP_441445.1_1 Forward -229 -210 7.86593 0.124
NP_441590.1_3 Reverse -195 -214 8.55425 0.254
NP_441590.1_4 Forward -39 -20 2.45694 0.295
NP_442066.2_4 Forward -220 -201 -2.0655 0.211
NP_442066.2_9 Forward -224 -211 9.95071 0.158
NP_442066.2_9 Reverse -207 -220 8.37742 0.185
NP_442066.2_9 Forward -60 -47 6.80412 0.267
NP_442419.1_3 Forward -215 -196 13.4708 0.289
NP_442241.1_2 Forward -198 -179 5.89931 0.17
NP_441308.1_8 Forward -222 -212 12.4681 0.218
NP_441308.1_8 Reverse -209 -219 9.22315 0.226
NP_440101.1_10 Forward -310 -291 7.47261 0.193
NP_442183.1_1 Reverse -211 -225 17.9942 0.00913
NP_442183.1_1 Forward -220 -206 11.406 0.0702
NP_442135.1_8 Forward -231 -213 13.9821 0.207
NP_441574.1_1 Forward -316 -297 -6.1954 0.276
NP_442170.1_5 Forward -400 -381 -2.0655 0.254
NP_442347.1_2 Forward -219 -210 11.1111 0.056
NP_442347.1_2 Reverse -212 -221 3.34298 0.284
NP_441037.1_4 Forward -222 -212 16.5761 0.0168
NP_441037.1_4 Reverse -209 -219 16.2838 0.0168
NP_441037.1_4 Reverse -39 -49 7.61007 0.237
NP_442594.1_8 Reverse -25 -44 11.5042 0.167
NP_442594.1_8 Reverse -23 -42 7.07928 0.215
NP_442317.1_6 Reverse -206 -225 12.0942 0.174
NP_441633.1_3 Reverse -209 -222 5.91914 0.0481
NP_441633.1_3 Forward -222 -209 3.95252 0.0699
NP_441633.1_3 Forward -61 -48 -1.16069 0.153
NP_441633.1_3 Forward -371 -358 -7.15888 0.294
NP_440136.1_2 Forward -219 -212 15.9687 0.0123
NP_440136.1_2 Reverse -212 -219 15.9687 0.0123
NP_442998.1_5 Reverse -300 -310 13.1564 0.158
NP_442998.1_10 Forward -218 -211 15.5754 0.0102
NP_442998.1_10 Reverse -213 -220 15.5754 0.0102
NP_442998.1_10 Forward -48 -41 4.07068 0.276
NP_440899.1_8 Reverse -136 -155 -3.44213 0.231
NP_440299.1_1 Reverse -207 -220 11.4251 0.0489
NP_440299.1_1 Forward -60 -47 7.88518 0.103
NP_441799.1_1 Forward -224 -210 14.0603 0.0274
NP_441799.1_1 Forward -60 -46 5.01387 0.227
NP_441799.1_1 Reverse -207 -221 3.44058 0.298
NP_440640.1_6 Reverse -35 -54 4.22769 0.213
NP_442802.1_6 Forward -221 -202 0.982764 0.204
NP_441007.1_10 Forward -225 -212 12.2123 0.0521
NP_441007.1_10 Reverse -206 -219 3.46087 0.182
NP_441007.1_10 Forward -61 -48 -0.964025 0.296
NP_442201.1_10 Forward -231 -212 -13.7669 0.277
NP_440256.1_1 Forward -223 -204 11.3075 0.0152
NP_440256.1_1 Reverse -208 -227 -5.60541 0.187
NP_441512.1_4 Forward -224 -205 7.7676 0.271
NP_441559.1_8 Reverse -206 -220 -6.29359 0.276
NP_440915.1_6 Reverse -207 -221 24.9757 0.000297
NP_440915.1_6 Forward -224 -210 4.52282 0.0953
NP_440915.1_6 Reverse -22 -36 4.52282 0.0953
NP_440915.1_6 Reverse -368 -382 2.85119 0.111
NP_441179.1_9 Reverse -84 -94 8.73102 0.284
NP_440717.1_3 Forward -40 -26 9.04542 0.25
NP_441704.1_5 Reverse -8 -27 15.7324 0.181
NP_442452.1_8 Forward -271 -257 14.4536 0.273
NP_441464.1_8 Reverse -211 -225 7.86607 0.205
NP_441939.1_3 Forward -219 -200 13.3725 0.0913
NP_441199.1_6 Forward -54 -35 13.8641 0.0437
NP_441199.1_6 Reverse -207 -226 8.06259 0.112
NP_442993.1_1 Forward -56 -40 0.648521 0.0625
NP_442993.1_1 Reverse -211 -227 -9.67623 0.19
NP_440677.1_3 Reverse -368 -386 12.6055 0.207
NP_442386.1_9 Reverse -210 -219 15.7322 0.0144
NP_442386.1_9 Forward -221 -212 6.39082 0.219
NP_442386.1_9 Reverse -46 -55 5.21086 0.262
NP_441340.1_5 Forward -219 -212 15.6737 0.0124
NP_441340.1_5 Reverse -212 -219 15.6737 0.0124
NP_441340.1_5 Forward -55 -48 3.97235 0.274
NP_442186.1_9 Forward -169 -150 7.57094 0.228
NP_442484.1_2 Reverse -200 -219 6.19431 0.156
NP_441132.1_5 Forward -222 -203 13.0775 0.287
NP_440161.1_3 Reverse -209 -228 10.8159 0.225
NP_441160.1_5 Reverse -336 -355 -6.58872 0.288
NP_440586.1_8 Forward -219 -212 13.2151 0.026
NP_440586.1_8 Reverse -212 -219 13.2151 0.026
NP_442251.1_6 Forward -219 -212 15.2804 0.0124
NP_442251.1_6 Reverse -212 -219 15.2804 0.0124
NP_442959.1_5 Forward -122 -103 5.89931 0.266
NP_442959.1_5 Reverse -133 -152 4.81767 0.299
NP_440684.1_9 Reverse -44 -58 6.78443 0.29
NP_441262.1_3 Reverse -211 -218 14.7888 0.0223
NP_441262.1_3 Forward -220 -213 14.7888 0.0223
NP_440027.1_3 Forward -53 -35 3.45998 0.272
NP_440027.1_3 Reverse -37 -55 2.28001 0.292
NP_443051.1_1 Forward -221 -212 19.5676 0.00335
NP_443051.1_1 Reverse -210 -219 10.4228 0.00754
NP_443051.1_1 Reverse -40 -49 -1.18024 0.297
NP_439984.1_10 Forward -75 -61 15.0436 0.162
NP_439937.1_8 Forward -210 -191 4.62101 0.2
NP_439937.1_8 Reverse -39 -58 -2.65548 0.261
NP_439937.1_8 Reverse -197 -216 -4.72043 0.286
NP_439937.1_9 Forward -36 -19 -2.91177 0.154
NP_439937.1_9 Forward -155 -138 -11.7615 0.264
NP_439937.1_9 Forward -313 -296 -13.9248 0.287
NP_439937.1_9 Reverse -210 -227 -16.2847 0.287
NP_440439.1_1 Forward -223 -210 10.344 0.0369
NP_440439.1_1 Reverse -208 -221 9.36073 0.0465
NP_440372.1_2 Forward -219 -212 16.3621 0.0124
NP_440372.1_2 Reverse -212 -219 16.3621 0.0124
NP_440171.1_3 Reverse -22 -41 6.58763 0.259
NP_440316.1_10 Reverse -25 -35 16.9913 0.153
NP_440316.1_10 Forward -214 -204 5.38824 0.299
NP_442488.1_4 Reverse -32 -51 6.98095 0.298
NP_441803.1_2 Forward -225 -206 11.9958 0.0651
NP_441803.1_2 Forward -55 -36 5.60432 0.166
NP_441803.1_2 Forward -61 -42 0.687771 0.247
NP_439977.1_5 Reverse -205 -224 4.12936 0.155
NP_440267.1_2 Forward -225 -211 12.0937 0.125
NP_442887.1_5 Forward -338 -319 -12.3902 0.281
NP_442384.1_10 Forward -220 -207 2.2809 0.23
NP_442114.1_4 Forward -220 -209 12.1534 0.107
NP_441018.1_7 Forward -105 -86 10.1275 0.217
NP_441018.1_7 Forward -60 -41 9.63589 0.22
NP_442790.1_4 Reverse -202 -221 -15.4385 0.294
NP_442790.1_4 Reverse -17 -36 -15.8318 0.297
NP_442262.1_10 Forward -219 -212 14.1988 0.0123
NP_442262.1_10 Reverse -212 -219 14.1988 0.0123
NP_442262.1_10 Forward -34 -27 8.8889 0.219
NP_441689.1_5 Forward -222 -212 8.43603 0.132
NP_440344.1_10 Reverse -204 -221 8.7903 0.00973
NP_440344.1_10 Forward -227 -210 6.13536 0.0188
NP_440344.1_10 Forward -338 -321 -13.2358 0.278
NP_440531.1_6 Forward -51 -32 -1.86883 0.241
NP_442123.1_3 Reverse -211 -230 11.9958 0.217
NP_440562.1_5 Reverse -329 -348 7.66927 0.261
NP_442529.1_4 Reverse -202 -221 10.2259 0.227
NP_440297.1_9 Forward -336 -326 6.76487 0.17
NP_440297.1_9 Forward -219 -209 -0.216628 0.282
NP_440297.1_9 Reverse -212 -222 -0.314959 0.282
NP_441896.1_3 Reverse -202 -221 8.75091 0.0879
NP_441896.1_5 Reverse -186 -193 15.3787 0.268
NP_440894.1_10 Reverse -206 -225 9.24257 0.163
NP_443036.1_1 Reverse -364 -383 11.6017 0.244
NP_440999.1_9 Reverse -207 -221 21.1407 0.0083
NP_440999.1_9 Reverse -141 -155 6.09611 0.102
NP_440999.1_9 Reverse -46 -60 -3.44199 0.293
NP_440888.1_2 Forward -220 -206 20.9434 0.000502
NP_440888.1_2 Reverse -211 -225 14.6503 0.0162
NP_440888.1_2 Forward -56 -42 10.1271 0.104
NP_440888.1_2 Reverse -121 -135 5.01387 0.298
NP_442892.1_9 Reverse -150 -164 14.4536 0.293
NP_440600.1_4 Forward -228 -210 -6.56903 0.285
NP_442147.1_7 Reverse -32 -51 15.7324 0.175
NP_440491.1_1 Forward -223 -204 15.4933 0.0838
NP_440491.1_1 Reverse -23 -42 7.4043 0.268
NP_439969.1_3 Reverse -206 -225 2.65439 0.24
NP_442277.1_4 Reverse -202 -221 15.0432 0.0404
NP_442033.1_10 Forward -52 -33 -7.37537 0.186
NP_441917.1_2 Reverse -23 -41 6.90232 0.288
NP_441543.1_2 Forward -219 -210 18.486 0.00236
NP_441543.1_2 Reverse -212 -221 15.9293 0.00518
NP_442845.1_2 Forward -337 -323 5.40779 0.233
NP_440982.1_1 Forward -41 -22 9.43841 0.26
NP_441469.1_8 Reverse -210 -219 16.126 0.00797
NP_441469.1_8 Forward -221 -212 6.5879 0.227
NP_441469.1_8 Reverse -46 -55 5.11294 0.289
NP_443064.1_6 Reverse -211 -221 10.8217 0.13
NP_442337.1_8 Reverse -251 -270 0.687771 0.245
NP_442578.1_7 Forward -219 -212 14.5921 0.026
NP_442578.1_7 Reverse -212 -219 14.5921 0.026
NP_440710.1_1 Forward -43 -25 -8.04399 0.254
NP_440071.1_4 Forward -35 -16 18.879 0.234
NP_441462.1_2 Reverse -211 -221 20.2362 0.000805
NP_441462.1_2 Forward -220 -210 11.5831 0.00406
NP_441462.1_2 Forward -56 -46 -0.708283 0.245
NP_441621.1_7 Reverse -209 -223 13.9626 0.0266
NP_441621.1_7 Reverse -39 -53 12.6843 0.0393
NP_441621.1_7 Forward -222 -208 6.48943 0.068
NP_441621.1_7 Reverse -197 -211 -3.93365 0.198
NP_441621.1_7 Reverse -200 -214 -6.58858 0.298
NP_443062.1_1 Reverse -211 -229 18.3942 0.0224
NP_443062.1_1 Forward -220 -202 6.79079 0.192
NP_440519.1_8 Reverse -38 -54 16.1848 0.0806
NP_442204.1_5 Reverse -37 -56 -0.4922 0.289
NP_441351.1_8 Reverse -125 -144 3.24438 0.232
NP_441351.1_8 Forward -213 -194 2.0644 0.263
NP_440516.1_6 Forward -35 -21 16.9119 0.186
NP_440516.1_8 Forward -220 -211 16.9127 0.00442
NP_440516.1_8 Reverse -211 -220 16.9127 0.00442
NP_440516.1_8 Reverse -41 -50 -0.295266 0.232
NP_440516.1_8 Reverse -26 -35 -0.491928 0.262
NP_441033.1_2 Forward -230 -211 -6.98204 0.293
NP_442428.1_5 Forward -219 -212 15.8704 0.0124
NP_442428.1_5 Reverse -212 -219 15.8704 0.0124
NP_442428.1_5 Reverse -48 -55 4.759 0.223
NP_441443.1_7 Reverse -22 -41 -2.36049 0.268
NP_441790.1_3 Forward -219 -200 4.81767 0.113
NP_442120.1_10 Forward -148 -129 -12.4886 0.273
NP_440673.1_3 Forward -218 -211 12.4288 0.0426
NP_440673.1_3 Reverse -213 -220 12.4288 0.0426
NP_440673.1_3 Forward -33 -26 8.98723 0.203
NP_440673.1_4 Forward -224 -205 16.8141 0.143
NP_440673.1_7 Reverse -200 -219 14.2574 0.0925
NP_441714.1_5 Reverse -73 -92 18.7978 0.276
NP_440865.1_9 Forward -226 -207 0.58944 0.136
NP_441052.1_2 Forward -220 -210 10.5014 0.0285
NP_441052.1_2 Reverse -211 -221 10.4031 0.0285
NP_442219.1_9 Forward -219 -210 8.35786 0.0681
NP_442219.1_9 Reverse -212 -221 8.25953 0.0681
NP_440436.1_4 Forward -219 -210 18.1905 0.00233
NP_440436.1_4 Forward -330 -321 9.63573 0.0871
NP_440436.1_4 Reverse -212 -221 9.24241 0.0871
NP_440436.1_4 Forward -55 -46 4.42421 0.265
NP_441884.1_8 Reverse -210 -229 -10.9153 0.268
NP_441884.1_9 Forward -223 -204 6.78429 0.0236
NP_441884.1_9 Reverse -208 -227 -4.42544 0.0594
NP_441884.1_9 Forward -199 -180 -21.4367 0.245
NP_441321.1_5 Reverse -313 -332 8.16093 0.242
NP_441336.1_3 Reverse -366 -380 19.6658 0.136
NP_441336.1_10 Reverse -37 -56 15.8307 0.113
NP_440314.1_9 Reverse -212 -231 -8.752 0.253
NP_440648.1_1 Reverse -26 -45 4.81767 0.219
NP_441719.1_4 Forward -219 -212 16.3621 0.0124
NP_441719.1_4 Reverse -212 -219 16.3621 0.0124
NP_441733.1_10 Forward -223 -210 18.1122 0.0292
NP_441733.1_10 Reverse -208 -221 10.5407 0.106
NP_441004.1_1 Reverse -35 -54 -5.31042 0.175
NP_441004.1_1 Reverse -358 -377 -15.2418 0.273
NP_441004.1_4 Reverse -23 -33 10.3048 0.254
NP_442813.1_4 Reverse -352 -371 -6.68705 0.299
NP_442366.1_3 Reverse -210 -228 4.05072 0.101
NP_442873.1_3 Reverse -201 -220 11.11 0.169
NP_440296.1_10 Reverse -23 -42 10.6192 0.161
NP_440296.1_10 Reverse -267 -286 -5.99873 0.225
NP_440296.1_10 Reverse -31 -50 -11.8986 0.269
NP_441115.1_4 Forward -221 -203 15.653 0.0361
NP_440328.1_4 Reverse -205 -224 7.27595 0.124
NP_443054.1_2 Forward -222 -208 12.586 0.0722
NP_443054.1_2 Reverse -209 -223 3.34284 0.24
NP_443054.1_2 Reverse -131 -145 1.96621 0.245
NP_443054.1_2 Forward -52 -38 -0.295402 0.293
NP_442430.1_10 Reverse -201 -220 10.3234 0.262
NP_442308.1_8 Reverse -31 -50 8.16093 0.273
NP_441851.1_10 Reverse -210 -220 16.008 0.00552
NP_441851.1_10 Forward -221 -211 8.53483 0.114
NP_441851.1_10 Reverse -69 -79 7.74818 0.132
NP_442622.1_1 Forward -221 -202 -11.1119 0.257
NP_442011.1_1 Reverse -210 -229 -3.24547 0.29
NP_442856.1_7 Reverse -38 -57 -5.40875 0.279
NP_442856.1_7 Reverse -202 -221 -5.70374 0.286
NP_441668.1_4 Reverse -314 -333 0.786102 0.231
NP_442515.1_1 Reverse -376 -390 -2.26202 0.271
NP_442515.1_1 Reverse -210 -224 -3.54032 0.292
NP_440593.1_3 Forward -61 -42 -4.32711 0.246
NP_440165.1_5 Reverse -210 -229 18.7807 0.0312
NP_441046.1_2 Forward -67 -48 5.211 0.227
NP_440940.1_7 Reverse -201 -219 2.67334 0.295
NP_441349.1_10 Forward -230 -211 9.24257 0.0248
NP_440432.1_9 Reverse -212 -227 17.8761 0.00961
NP_440432.1_9 Forward -219 -204 9.02635 0.0427
NP_442843.1_1 Reverse -35 -54 -11.0136 0.285
NP_442843.1_1 Reverse -27 -46 -11.4069 0.291
NP_440474.1_8 Reverse -212 -226 15.4369 0.0566
NP_440474.1_8 Forward -219 -205 9.73373 0.156
NP_440431.1_3 Forward -357 -338 -1.96717 0.164
NP_440588.1_2 Forward -59 -40 -3.73712 0.195
NP_440195.1_4 Forward -68 -49 9.24257 0.189
NP_442006.1_2 Reverse -202 -219 -16.4808 0.254
NP_442006.1_2 Reverse -25 -42 -17.0707 0.269
NP_442006.1_2 Reverse -17 -34 -18.3491 0.29
NP_441003.1_9 Forward -319 -300 7.17762 0.237
NP_443047.1_7 Reverse -212 -231 13.7658 0.0943
NP_440483.1_1 Reverse -206 -225 -8.35868 0.282
NP_440483.1_1 Forward -218 -199 -8.85033 0.297
NP_441570.1_1 Reverse -211 -229 7.19731 0.0175
NP_441570.1_1 Forward -220 -202 -0.177514 0.0437
NP_441570.1_1 Reverse -246 -264 -10.5023 0.171
NP_441078.1_4 Forward -220 -211 19.6659 0.0007
NP_441078.1_4 Reverse -211 -220 19.6659 0.0007
NP_441078.1_4 Forward -50 -41 -1.18024 0.237
NP_441078.1_4 Reverse -47 -56 -1.77023 0.266
NP_442729.1_8 Reverse -207 -220 8.47575 0.125
NP_440539.1_9 Forward -377 -358 -5.99873 0.286
NP_440707.1_7 Reverse -36 -55 5.11266 0.281
NP_440526.1_3 Forward -219 -208 11.7595 0.0646
NP_440526.1_3 Reverse -212 -223 11.6612 0.0646
NP_440526.1_3 Forward -49 -38 2.6148 0.267
NP_441432.1_8 Forward -221 -212 16.8143 0.00595
NP_441432.1_8 Reverse -210 -219 8.25953 0.0755
NP_441432.1_8 Reverse -25 -34 3.83464 0.243
NP_442320.1_8 Reverse -205 -219 14.7492 0.0132
NP_442320.1_8 Forward -226 -212 5.01447 0.0442
NP_442344.1_7 Forward -219 -200 -8.94866 0.232
NP_441732.1_2 Reverse -207 -223 -15.0844 0.145
NP_441732.1_2 Forward -224 -208 -15.1828 0.145
NP_441732.1_2 Forward -314 -298 -15.5761 0.151
NP_441732.1_2 Reverse -43 -59 -16.1661 0.165
NP_440629.1_4 Reverse -302 -321 10.7175 0.238
NP_440760.1_1 Forward -220 -201 -22.6167 0.263
NP_442797.1_6 Reverse -192 -211 8.32199 0.265
NP_442797.1_7 Reverse -203 -221 -0.275845 0.282
NP_441057.1_3 Forward -319 -300 -10.6203 0.214
NP_440913.1_1 Forward -222 -204 11.7205 0.168
NP_441023.1_1 Forward -213 -195 12.7038 0.233
NP_442489.1_7 Forward -220 -211 20.1576 0.000695
NP_442489.1_7 Reverse -211 -220 20.1576 0.000695
NP_442489.1_7 Reverse -47 -56 -1.27858 0.185
NP_440757.1_6 Forward -47 -28 10.7175 0.28
NP_440565.1_7 Reverse -362 -381 14.7491 0.138
NP_442079.1_7 Reverse -212 -231 6.19431 0.162
NP_440559.1_1 Forward -219 -210 8.75118 0.0586
NP_440559.1_1 Reverse -212 -221 8.65285 0.0586
NP_441659.2_8 Reverse -211 -221 20.9245 0.000805
NP_441659.2_8 Forward -220 -210 11.9764 0.0147
NP_442913.1_10 Reverse -202 -221 2.55606 0.124
NP_442913.1_10 Forward -229 -210 -3.04881 0.198
NP_441800.1_10 Reverse -34 -53 1.76941 0.255
NP_440779.1_5 Reverse -211 -228 3.57876 0.0665
NP_440779.1_5 Forward -220 -203 -5.27103 0.14
NP_442346.1_1 Forward -219 -200 11.7992 0.27
NP_442346.1_5 Forward -221 -211 16.303 0.00248
NP_442346.1_5 Forward -57 -47 11.1898 0.0735
NP_442346.1_5 Reverse -210 -220 9.02648 0.118
NP_442346.1_5 Forward -96 -86 5.87989 0.225
NP_440545.1_3 Forward -224 -207 7.80699 0.0482
NP_440545.1_3 Reverse -37 -54 2.69378 0.0961
NP_440545.1_3 Reverse -207 -224 -7.04099 0.295
NP_440025.1_1 Reverse -207 -226 5.40766 0.296
NP_440025.1_3 Reverse -298 -312 10.2235 0.29
NP_440459.1_2 Reverse -202 -219 8.7903 0.249
NP_441653.1_2 Reverse -200 -219 20.9237 0.0259
NP_440010.1_3 Reverse -58 -77 -7.86702 0.29
NP_441943.1_8 Forward -138 -119 -12.6852 0.261
NP_442900.1_1 Reverse -358 -377 -3.93378 0.21
NP_440847.1_3 Forward -42 -28 13.2736 0.217
NP_440847.1_3 Forward -33 -19 10.717 0.283
NP_441888.1_7 Reverse -206 -220 2.5562 0.225
NP_443022.1_3 Forward -215 -196 17.2074 0.126
NP_441050.1_5 Reverse -67 -85 4.05072 0.194
NP_441050.1_5 Reverse -22 -40 -1.84914 0.271
NP_440449.1_6 Reverse -203 -221 13.8971 0.102
NP_441948.1_4 Forward -227 -209 -0.570838 0.139
NP_441948.1_4 Reverse -204 -222 -1.45582 0.146
NP_441502.1_3 Forward -222 -203 12.1925 0.21
NP_441833.1_4 Forward -219 -212 15.9687 0.0124
NP_441833.1_4 Reverse -212 -219 15.9687 0.0124
NP_442799.1_2 Forward -272 -253 3.34271 0.202
NP_441112.1_6 Forward -75 -56 -3.63879 0.296
NP_442162.1_9 Forward -219 -212 16.2637 0.0124
NP_442162.1_9 Reverse -212 -219 16.2637 0.0124
NP_440671.1_4 Forward -56 -42 9.63603 0.176
NP_440671.1_4 Reverse -41 -55 9.04604 0.187
NP_440671.1_5 Forward -40 -26 13.8636 0.293
NP_442199.1_5 Forward -228 -209 7.47261 0.0719
NP_442199.1_5 Reverse -203 -222 -5.50708 0.247
NP_442140.1_3 Forward -219 -209 17.4829 0.0159
NP_442140.1_3 Reverse -212 -222 7.94484 0.124
NP_442723.1_1 Forward -389 -370 5.11187 0.276
NP_442723.1_1 Forward -50 -31 4.12856 0.276
NP_442723.1_1 Forward -341 -322 1.6703 0.292
NP_440875.1_9 Forward -218 -208 17.619 0.0104
NP_440875.1_9 Reverse -213 -223 16.8403 0.0145
NP_441813.1_5 Reverse -209 -219 10.0098 0.0208
NP_441813.1_5 Forward -222 -212 8.73149 0.0367
NP_441259.1_7 Reverse -42 -60 13.7855 0.233
NP_440590.1_4 Forward -219 -206 21.7504 0.00377
NP_440590.1_4 Reverse -212 -225 -4.20895 0.258
NP_440567.1_1 Forward -219 -205 17.3058 0.0153
NP_440567.1_1 Reverse -212 -226 7.76774 0.0654
NP_442497.1_10 Reverse -212 -221 17.601 0.00813
NP_442497.1_10 Forward -219 -210 10.4228 0.0087
NP_442497.1_10 Forward -49 -40 0.589713 0.153
NP_440821.1_4 Reverse -209 -219 18.7612 0.00422
NP_440821.1_4 Forward -222 -212 10.7964 0.0146
NP_440821.1_4 Reverse -39 -49 0.275027 0.19
NP_441239.1_9 Forward -222 -210 17.4436 0.0146
NP_441239.1_9 Reverse -209 -221 16.0669 0.0175
NP_441239.1_9 Forward -333 -321 6.92215 0.173
NP_441239.1_9 Forward -37 -25 6.52882 0.185
NP_441239.1_9 Forward -45 -33 4.46387 0.253
NP_441951.1_4 Forward -220 -201 1.17943 0.287
NP_441951.1_9 Forward -51 -32 6.19431 0.254
NP_440156.1_4 Forward -323 -313 8.53436 0.298
NP_442568.1_5 Forward -370 -351 9.53756 0.284
NP_441727.1_3 Forward -227 -208 3.04771 0.293
NP_441892.1_1 Forward -229 -212 15.0835 0.0315
NP_441892.1_1 Reverse -202 -219 3.67709 0.121
NP_440604.1_6 Reverse -211 -230 -1.27885 0.199
NP_441017.1_6 Forward -164 -150 15.2402 0.114
NP_442772.1_4 Reverse -302 -321 -3.73712 0.244
NP_441769.1_1 Reverse -203 -222 11.5042 0.188
NP_441617.1_6 Reverse -294 -313 -0.885524 0.256
NP_442138.1_1 Forward -58 -39 6.1935 0.24
NP_442138.1_10 Reverse -211 -230 3.04771 0.115
NP_442138.1_10 Forward -220 -201 -8.06369 0.296
NP_440546.1_4 Reverse -211 -221 13.5365 0.0459
NP_440546.1_4 Forward -220 -210 11.8882 0.0679
NP_440546.1_4 Forward -213 -203 8.39772 0.192
NP_440546.1_6 Reverse -37 -56 17.0107 0.121
NP_440546.1_6 Forward -60 -41 8.55425 0.256
NP_440546.1_6 Forward -320 -301 7.27595 0.277
NP_441230.1_5 Forward -40 -21 2.65439 0.212
NP_440462.1_4 Reverse -24 -38 10.7177 0.224
NP_440462.1_6 Forward -222 -212 19.4496 0.00371
NP_440462.1_6 Reverse -209 -219 17.9746 0.00578
NP_441607.1_1 Reverse -68 -87 13.2162 0.289
NP_440868.1_4 Forward -224 -212 7.21714 0.0749
NP_440868.1_4 Reverse -207 -219 2.98891 0.142
NP_442499.1_3 Forward -182 -164 4.83737 0.289
NP_442787.1_1 Reverse -240 -259 11.0125 0.179
NP_441474.1_1 Reverse -201 -220 1.27698 0.247
NP_442402.1_4 Forward -318 -299 -7.57277 0.276
NP_441848.1_4 Reverse -103 -119 10.4154 0.253
NP_441084.1_6 Forward -222 -208 11.2833 0.208
NP_440653.1_10 Forward -219 -200 4.03102 0.258
NP_440696.1_3 Reverse -37 -55 -3.52077 0.287
NP_442039.1_4 Forward -219 -212 15.1821 0.0124
NP_442039.1_4 Reverse -212 -219 15.1821 0.0124
NP_442039.1_7 Forward -134 -124 14.533 0.211
NP_441811.1_8 Reverse -188 -202 6.58777 0.267
NP_442679.1_1 Forward -371 -352 -4.6221 0.283
NP_441926.1_3 Forward -23 -7 2.71347 0.257
NP_440825.1_6 Reverse -24 -43 9.14423 0.285
NP_442696.1_6 Forward -199 -180 -3.14714 0.147
NP_442837.1_3 Forward -219 -212 15.7721 0.0124
NP_442837.1_3 Reverse -212 -219 15.7721 0.0124
NP_442053.1_1 Forward -220 -211 18.3876 0.0007
NP_442053.1_1 Reverse -211 -220 18.3876 0.0007
NP_440505.1_3 Forward -222 -212 15.418 0.0114
NP_440505.1_3 Reverse -209 -219 14.1397 0.0235
NP_442532.1_7 Reverse -211 -225 3.04785 0.21
NP_440914.1_1 Reverse -211 -221 16.3248 0.00196
NP_440914.1_1 Forward -220 -210 8.6151 0.186
NP_440914.1_1 Reverse -26 -36 7.73678 0.224
NP_441011.1_8 Forward -219 -210 16.9127 0.00602
NP_441011.1_8 Reverse -212 -221 16.6177 0.00602
NP_442533.1_6 Forward -220 -211 17.2076 0.00137
NP_442533.1_6 Reverse -211 -220 17.2076 0.00137
NP_442533.1_6 Forward -56 -47 6.09625 0.118
NP_442533.1_6 Reverse -47 -56 3.83464 0.202
NP_442533.1_6 Forward -336 -327 3.24465 0.219
NP_442533.1_6 Forward -43 -34 2.65466 0.246
NP_440263.1_3 Reverse -179 -198 1.27776 0.295
NP_442232.1_3 Forward -228 -209 -14.8485 0.288
NP_442322.1_4 Forward -339 -322 9.28121 0.141
NP_442322.1_4 Forward -43 -26 -0.453507 0.219
NP_442229.1_1 Forward -222 -208 8.94708 0.184
NP_441219.1_6 Forward -230 -212 8.86894 0.293
NP_441482.1_7 Forward -226 -212 -12.3901 0.295
NP_439944.1_9 Reverse -212 -222 17.7779 0.00341
NP_439944.1_9 Forward -219 -209 10.4031 0.0887
NP_439944.1_9 Reverse -48 -58 7.45319 0.141
NP_439944.1_9 Forward -49 -39 5.48657 0.247
NP_441028.1_6 Reverse -122 -132 3.8145 0.281
NP_442202.1_6 Reverse -304 -323 -0.39387 0.265
NP_440116.1_8 Forward -219 -200 -1.08219 0.116
NP_440116.1_8 Reverse -212 -231 -3.83545 0.158
NP_440115.1_6 Forward -202 -192 8.4365 0.13
NP_440115.1_6 Forward -223 -213 7.84651 0.146
NP_440115.1_6 Reverse -23 -33 6.46988 0.181
NP_441961.1_4 Reverse -39 -58 5.99764 0.27
NP_441602.1_3 Reverse -194 -213 1.57275 0.213
NP_441602.1_3 Forward -61 -42 -3.24547 0.243
NP_441602.1_3 Reverse -296 -315 -3.93378 0.256
NP_441602.1_3 Reverse -206 -225 -4.81876 0.274
NP_441602.1_4 Reverse -200 -219 11.7992 0.278
NP_441972.1_5 Forward -219 -200 10.9142 0.0538
NP_441106.1_1 Forward -221 -212 18.486 0.0028
NP_441106.1_1 Reverse -210 -219 18.191 0.0028
NP_441106.1_1 Reverse -46 -55 4.71961 0.21
NP_441106.1_1 Reverse -321 -330 2.55633 0.28
NP_440429.1_2 Reverse -240 -259 8.06259 0.274
NP_441286.1_1 Forward -221 -209 5.34885 0.0259
NP_441286.1_1 Reverse -210 -222 5.15219 0.0259
NP_440670.1_8 Forward -220 -211 18.3876 0.000699
NP_440670.1_8 Reverse -211 -220 18.3876 0.000699
NP_441479.1_1 Forward -216 -197 9.53756 0.216
NP_441930.1_2 Reverse -25 -35 14.828 0.19
NP_439955.1_10 Forward -377 -358 11.2084 0.283
NP_440886.1_7 Reverse -210 -220 17.7774 0.0011
NP_440886.1_7 Forward -221 -211 8.04271 0.0805
NP_440886.1_7 Forward -51 -41 7.74772 0.0843
NP_440886.1_7 Forward -44 -34 6.0761 0.147
NP_442614.1_2 Forward -304 -290 6.98109 0.276
NP_442382.1_9 Reverse -153 -172 10.0284 0.281
NP_440460.1_9 Reverse -71 -84 16.7355 0.268
NP_442072.1_9 Forward -221 -203 6.01734 0.0146
NP_442072.1_9 Reverse -210 -228 -20.9253 0.204
NP_441753.1_10 Reverse -17 -36 4.32602 0.198
NP_441753.1_10 Reverse -38 -57 1.37609 0.269
NP_440028.1_6 Reverse -15 -33 12.9988 0.24
NP_442963.1_7 Forward -222 -203 14.8474 0.204
NP_441808.1_8 Reverse -41 -60 11.4058 0.222
NP_440907.2_8 Reverse -212 -222 19.1541 0.00362
NP_440907.2_8 Forward -219 -209 17.4824 0.00685
NP_440907.2_8 Forward -49 -39 6.76441 0.15
NP_441021.1_1 Forward -219 -200 -7.08038 0.181
NP_441021.1_1 Forward -34 -15 -11.2103 0.258
NP_441021.1_8 Reverse -206 -224 2.28076 0.25
NP_441021.1_10 Forward -336 -317 17.9932 0.254
NP_441463.1_3 Forward -230 -211 14.2574 0.0291
NP_441463.1_3 Reverse -201 -220 -0.197208 0.132
NP_440501.1_2 Reverse -33 -52 9.93088 0.217
NP_442842.1_4 Reverse -146 -165 7.57094 0.223
NP_441626.1_2 Forward -219 -212 15.7721 0.0124
NP_441626.1_2 Reverse -212 -219 15.7721 0.0124
NP_441626.1_2 Reverse -42 -49 11.1505 0.0716
NP_441626.1_4 Reverse -320 -339 13.6675 0.184
NP_442365.1_5 Reverse -212 -231 16.8141 0.0642
NP_442615.1_1 Forward -229 -211 7.98396 0.0301
NP_442615.1_1 Reverse -32 -50 -1.65248 0.131
NP_442615.1_1 Reverse -202 -220 -3.32411 0.159
NP_441962.1_4 Reverse -206 -225 -6.78538 0.181
NP_441962.1_4 Forward -225 -206 -9.047 0.211
NP_441962.1_4 Reverse -42 -61 -9.93197 0.222
NP_441962.1_4 Reverse -323 -342 -11.5053 0.241
NP_440387.1_1 Reverse -211 -227 0.451859 0.126
NP_440387.1_1 Forward -220 -204 -0.531451 0.139
NP_440387.1_1 Forward -56 -40 -4.66135 0.194
NP_440387.1_1 Reverse -41 -57 -6.23465 0.273
NP_441431.1_2 Reverse -208 -222 15.0436 0.0537
NP_441431.1_2 Forward -223 -209 11.5037 0.136
NP_441431.1_3 Reverse -178 -197 3.73603 0.263
NP_441488.1_7 Reverse -222 -241 14.9458 0.0544
NP_441488.1_7 Forward -226 -207 11.7008 0.113
NP_441836.1_2 Reverse -41 -60 5.40766 0.124
NP_441836.1_2 Reverse -321 -340 2.94938 0.163
NP_441993.1_1 Forward -220 -201 3.01872 0.244
NP_441993.1_1 Reverse -205 -224 1.16703 0.284
NP_440143.1_1 Forward -169 -150 12.7825 0.284
NP_441174.1_2 Forward -223 -209 12.586 0.248
NP_440114.1_10 Reverse -211 -225 18.3875 0.00642
NP_440114.1_10 Forward -220 -206 6.88276 0.253
NP_441817.1_1 Forward -326 -308 20.767 0.0714
NP_441817.1_2 Forward -381 -362 26.7455 0.00415
NP_441817.1_3 Forward -231 -212 31.7604 0.00000755
NP_441817.1_4 Forward -297 -278 25.5646 0.00908
NP_441817.1_5 Forward -348 -329 24.7789 0.0177
NP_441817.1_6 Forward -210 -191 27.4338 0.00177
NP_441817.1_9 Forward -255 -236 22.0256 0.0452
NP_441500.1_8 Reverse -73 -87 16.3692 0.261
NP_440287.1_6 Forward -222 -203 7.86593 0.151
NP_440293.1_10 Reverse -23 -42 8.06259 0.175
NP_440766.1_4 Reverse -207 -221 8.35772 0.0871
NP_440766.1_4 Forward -224 -210 6.98109 0.097
NP_439988.1_7 Forward -334 -320 13.372 0.292
NP_441979.1_9 Reverse -127 -146 3.34271 0.297
NP_442743.1_4 Forward -219 -200 -7.86702 0.281
NP_440324.1_9 Forward -222 -203 20.5506 0.158
NP_439910.1_2 Reverse -78 -95 -13.5308 0.162
NP_439910.1_2 Reverse -203 -220 -21.3973 0.183
NP_442867.1_8 Forward -329 -310 4.03102 0.293
NP_440457.1_1 Reverse -22 -34 7.02048 0.105
NP_440457.1_1 Reverse -207 -219 5.34885 0.141
NP_440457.1_1 Reverse -324 -336 -0.157684 0.254
NP_440798.1_6 Forward -219 -206 3.85419 0.147
NP_440798.1_6 Reverse -212 -225 0.60927 0.254
NP_441801.1_4 Forward -139 -129 3.12662 0.231
NP_441984.1_3 Forward -224 -206 18.2104 0.0928
NP_440054.1_4 Forward -228 -209 19.174 0.135
NP_441436.1_2 Reverse -37 -56 0.58944 0.275
NP_440473.1_9 Forward -231 -212 12.3892 0.0392
NP_442509.1_9 Forward -220 -210 16.2041 0.00739
NP_442509.1_9 Reverse -211 -221 8.04271 0.192
NP_440554.1_4 Reverse -212 -222 15.418 0.0199
NP_440554.1_4 Forward -219 -209 13.943 0.0218
NP_440554.1_4 Forward -55 -45 4.20827 0.198
NP_442862.1_3 Forward -309 -292 7.02034 0.258
NP_441845.1_6 Reverse -199 -217 -0.7675 0.274
NP_441885.1_5 Forward -220 -210 11.4848 0.00668
NP_441885.1_5 Reverse -211 -221 11.3864 0.00668
NP_441428.1_8 Reverse -203 -222 10.4225 0.178
NP_442341.1_7 Forward -221 -207 13.5693 0.0338
NP_442341.1_7 Reverse -210 -224 3.04785 0.237
NP_442341.1_9 Forward -339 -325 8.25877 0.174
NP_442369.1_6 Reverse -106 -116 16.0639 0.186
NP_441756.1_5 Reverse -207 -226 -2.26216 0.272
NP_442395.2_4 Forward -370 -351 0.883656 0.258
NP_440423.1_6 Forward -228 -209 -13.6686 0.224
NP_443000.1_7 Forward -222 -212 10.7964 0.0345
NP_443000.1_7 Reverse -209 -219 2.04498 0.226
NP_440507.2_3 Forward -59 -40 12.7816 0.145
NP_441842.1_10 Reverse -204 -218 18.1908 0.0173
NP_441842.1_10 Forward -227 -213 17.0108 0.0273
NP_440275.1_3 Forward -222 -212 18.6629 0.0082
NP_440275.1_3 Reverse -209 -219 17.9746 0.0082
NP_440275.1_3 Reverse -39 -49 8.82982 0.0602
NP_440275.1_3 Forward -58 -48 6.8632 0.0962
NP_442932.1_10 Reverse -349 -368 7.27595 0.24
NP_440091.1_1 Reverse -207 -219 12.6253 0.0353
NP_440091.1_1 Forward -224 -212 10.8554 0.0429
NP_443010.1_10 Reverse -208 -225 9.05199 0.149
NP_441359.1_5 Reverse -37 -56 0.687771 0.29
NP_442451.1_2 Reverse -203 -222 -0.0988766 0.155
NP_442451.1_2 Reverse -39 -58 -10.227 0.265
NP_442753.1_2 Forward -148 -129 8.84924 0.257
NP_439962.1_4 Reverse -39 -58 4.62101 0.179
NP_439962.1_4 Forward -43 -24 2.16274 0.197
NP_439962.1_4 Reverse -200 -219 -3.83545 0.259
NP_439962.1_4 Reverse -203 -222 -4.91709 0.272
NP_439962.1_6 Reverse -363 -381 6.90232 0.288
NP_440175.1_4 Reverse -358 -377 -11.1119 0.185
NP_440175.1_7 Reverse -242 -260 10.4366 0.253
NP_440175.1_10 Reverse -224 -243 11.7992 0.219
NP_440149.1_2 Forward -27 -8 11.7992 0.196
NP_440149.1_8 Forward -220 -201 4.03102 0.0873
NP_439929.1_4 Forward -318 -304 21.8435 0.0474
NP_441105.1_3 Forward -231 -212 -1.27885 0.147
NP_442373.1_2 Reverse -35 -54 -6.88371 0.233
NP_440216.1_1 Forward -220 -206 8.25939 0.0061
NP_440216.1_1 Reverse -211 -225 5.99778 0.0166
NP_440216.1_6 Reverse -204 -220 4.87675 0.189
NP_440172.1_1 Reverse -211 -221 17.5813 0.00421
NP_440172.1_1 Forward -220 -210 8.73149 0.0586
NP_440172.1_1 Reverse -246 -256 6.46988 0.103
NP_440172.1_1 Reverse -26 -36 2.83163 0.264
NP_441008.1_4 Forward -176 -157 16.4193 0.295
NP_440167.1_3 Reverse -24 -43 8.25926 0.281
NP_442015.1_10 Reverse -207 -220 3.95252 0.178
NP_442015.1_10 Reverse -43 -56 0.60927 0.221
NP_441226.1_7 Forward -219 -212 14.4934 0.0123
NP_441226.1_7 Reverse -212 -219 14.4934 0.0123
NP_441226.1_7 Forward -336 -329 8.59356 0.197
NP_441111.1_7 Forward -219 -211 18.7023 0.00294
NP_441111.1_7 Reverse -212 -220 18.7023 0.00294
NP_441111.1_7 Reverse -48 -56 -0.472234 0.131
NP_441111.1_7 Forward -49 -41 -0.570565 0.233
NP_442379.1_10 Reverse -204 -221 -3.10775 0.248
NP_442379.1_10 Forward -227 -210 -3.79607 0.268
NP_441766.1_2 Forward -220 -211 17.5026 0.00297
NP_441766.1_2 Reverse -211 -220 17.5026 0.00297
NP_441766.1_2 Forward -50 -41 5.21127 0.134
NP_442252.1_3 Forward -227 -209 14.1788 0.0921
NP_440416.1_1 Reverse -211 -230 -8.35868 0.243
NP_440416.1_9 Reverse -216 -235 -17.8968 0.248
NP_440416.1_9 Reverse -245 -264 -20.4534 0.285
NP_440416.1_9 Forward -57 -38 -20.5517 0.286
NP_443052.1_8 Forward -230 -211 8.35759 0.0255
NP_443052.1_8 Reverse -201 -220 -6.39206 0.143
NP_440072.1_5 Reverse -26 -44 1.19912 0.236
NP_440591.1_9 Reverse -40 -58 8.96727 0.169
NP_442154.1_1 Forward -219 -201 -8.14232 0.157
NP_442154.1_1 Reverse -182 -200 -16.7954 0.245
NP_442154.1_1 Reverse -358 -376 -17.0904 0.249
NP_440261.1_5 Forward -219 -206 -1.06236 0.0655
NP_440261.1_5 Reverse -48 -61 -2.53732 0.0924
NP_440261.1_5 Reverse -212 -225 -10.6988 0.203
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGTGACTGGGTTATTGTTAGCCCCCCGCTCCGGCAAACAAACCAGGCAACTGTTAAAAAAATCTGCCGACGCCCTCCCCGATTTAGCCGAGGATTTGGCCACAACTCTGCAACTCCAGGCAGACTATCTTTCCGAAGCCACCCAACGTAATTGGCAGGGCACCCTGGAACGGCTCAAAGAGGCGATCGCCGCTGGGGTGGAAGCAACCCAAACCACCGTGGTGTCAGAACCGGAACCAAAACCAAGGGACATTACAGCGGAAACTACCCTGGCGGACAGTTAGTTTTTTCATTAATCTTTGGGCTGGTTATGGTTGTTTAAATCCTTCCCCACCAGAAACTTGTGGCCACCGCTGTCGCCCCTCACCCCATTGCCCCCGTAGTTGACTTTTTCTGTACCT

CDS

ATGACCGAACCCCTTTTCTGGCTGGGTCTTTCCCTCACCCTGGTGTCCATTAGCCTGACCGCTGTGTTGGTGGTGGCCCTACCGGCGTTACAGGAACTGGCCCGGGCGGCACGCAGTGCAGAAAAATTATTTGACAGCCTTAATCGGGAATTTCCCCCCACGTTGGAAGCCATTCGTTTAACGGGTTTGGAAATTAGCGAATTGACAGATGATTTAAACCAAGGGGTCAGAACAGTGGAAGACGTAGTTCAAACCGTGGACCGGGGCGTAACCATCACCAAAGAGGGAGCCAAAAAGGTGCAAGGGGGTTCCAAACGCTTTGTGGCGGGAGTCAAGGCAGCCTGGCATTCCTGGCAAGTCTATCCCACAGAGCATTTAACCGTGGAGAGCAAGGGAAAAAATGGTAAAAAGTAA

Protein

MTEPLFWLGLSLTLVSISLTAVLVVALPALQELARAARSAEKLFDSLNREFPPTLEAIRLTGLEISELTDDLNQGVRTVEDVVQTVDRGVTITKEGAKKVQGGSKRFVAGVKAAWHSWQVYPTEHLTVESKGKNGKK