Your browser is old and dusty. Try Google Chrome!

Details for sll0268

ORF sll0268
Accession NP_441818.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -384 -370 16.0275 0.0319
NP_440557.1_1 Reverse -377 -396 7.57094 0.148
NP_440795.1_7 Forward -384 -377 14.6904 0.0123
NP_440795.1_7 Reverse -377 -384 14.6904 0.0123
NP_441418.1_6 Forward -385 -366 5.80098 0.00794
NP_441418.1_6 Forward -175 -156 -9.83364 0.0294
NP_441418.1_6 Reverse -376 -395 -18.8801 0.0839
NP_442291.1_5 Reverse -165 -181 -2.49807 0.217
NP_442291.1_5 Reverse -375 -391 -3.08806 0.234
NP_442272.1_1 Forward -51 -33 16.1401 0.195
NP_442272.1_1 Reverse -37 -55 15.0897 0.237
NP_440897.1_6 Reverse -78 -97 -3.83621 0.257
NP_440897.1_6 Reverse -166 -185 -4.42619 0.276
NP_441453.1_1 Reverse -159 -177 17.0296 0.0711
NP_441453.1_1 Forward -392 -374 3.8533 0.263
NP_441453.1_4 Reverse -376 -384 16.539 0.00633
NP_441453.1_4 Forward -385 -377 16.539 0.00633
NP_441453.1_4 Forward -175 -167 6.70593 0.121
NP_442151.1_6 Forward -385 -371 8.45605 0.172
NP_442151.1_6 Reverse -376 -390 7.57108 0.194
NP_442151.1_6 Forward -90 -76 6.58777 0.228
NP_441818.1_1 Forward -384 -373 15.6928 0.0257
NP_441818.1_4 Forward -164 -145 21.0423 0.153
NP_441818.1_7 Forward -97 -78 25.4663 0.00521
NP_441818.1_9 Forward -336 -317 21.1406 0.0247
NP_441818.1_9 Forward -175 -156 1.0811 0.191
NP_441818.1_9 Reverse -223 -242 -8.752 0.281
NP_440226.1_1 Forward -385 -366 16.7157 0.0213
NP_440226.1_1 Reverse -376 -395 11.3075 0.0547
NP_440226.1_1 Forward -175 -156 3.24438 0.233
NP_442169.1_1 Forward -167 -148 8.84924 0.26
NP_442169.1_1 Forward -176 -157 -1.08219 0.262
NP_441630.1_3 Forward -183 -164 4.03102 0.176
NP_442655.1_10 Forward -178 -159 -2.26216 0.19
NP_442173.1_1 Forward -384 -376 15.4574 0.00633
NP_442173.1_1 Reverse -377 -385 15.4574 0.00633
NP_442173.1_1 Reverse -167 -175 5.82095 0.2
NP_442752.1_4 Forward -385 -378 13.8055 0.0199
NP_442752.1_4 Reverse -376 -383 13.8055 0.0199
NP_442752.1_4 Forward -175 -168 13.8055 0.0199
NP_442752.1_4 Reverse -81 -88 4.46401 0.269
NP_443027.1_4 Forward -387 -377 13.2547 0.0521
NP_443027.1_4 Reverse -374 -384 13.1564 0.0521
NP_443027.1_4 Forward -210 -200 8.23984 0.215
NP_443027.1_4 Forward -177 -167 7.25653 0.24
NP_441812.1_3 Reverse -375 -389 10.4227 0.222
NP_442975.1_10 Reverse -162 -176 11.2087 0.0508
NP_442975.1_10 Forward -389 -375 3.93223 0.249
NP_442975.1_10 Reverse -372 -386 2.94893 0.266
NP_440784.1_7 Forward -384 -377 15.9687 0.0123
NP_440784.1_7 Reverse -377 -384 15.9687 0.0123
NP_440784.1_7 Reverse -167 -174 6.23397 0.241
NP_440784.1_7 Forward -174 -167 6.13563 0.241
NP_442909.1_7 Forward -384 -370 10.717 0.131
NP_440061.1_9 Forward -387 -373 21.4351 0.00189
NP_440110.1_4 Forward -87 -68 5.30933 0.172
NP_440110.1_8 Reverse -374 -393 0.786102 0.211
NP_441054.1_2 Reverse -220 -239 9.63589 0.288
NP_441054.1_4 Reverse -366 -384 12.8022 0.0619
NP_440878.1_9 Reverse -156 -175 3.53937 0.174
NP_440878.1_9 Reverse -138 -157 3.14605 0.174
NP_442062.1_8 Forward -385 -375 17.3846 0.00193
NP_442062.1_8 Reverse -376 -386 10.3048 0.0493
NP_440761.1_4 Reverse -371 -390 -13.5702 0.257
NP_441859.1_3 Forward -386 -367 10.52 0.12
NP_440304.1_4 Forward -387 -377 10.8948 0.051
NP_440304.1_4 Reverse -374 -384 9.91146 0.051
NP_440304.1_4 Reverse -79 -89 5.19158 0.223
NP_442242.1_4 Forward -384 -377 14.3954 0.0124
NP_442242.1_4 Reverse -377 -384 14.3954 0.0124
NP_442242.1_4 Forward -174 -167 12.4288 0.0393
NP_441781.1_7 Forward -352 -333 0.58944 0.242
NP_442602.1_3 Reverse -241 -260 -0.688862 0.226
NP_441208.1_9 Reverse -373 -387 15.9292 0.0731
NP_441208.1_9 Forward -261 -247 5.1128 0.278
NP_442276.1_1 Reverse -81 -100 11.11 0.238
NP_442110.1_7 Reverse -376 -390 2.5562 0.222
NP_441925.1_4 Reverse -156 -175 -15.3409 0.263
NP_441925.1_4 Forward -239 -220 -16.8158 0.285
NP_441925.1_4 Forward -250 -231 -17.4058 0.294
NP_440856.1_4 Forward -392 -373 1.76941 0.157
NP_440856.1_7 Forward -229 -210 2.26107 0.157
NP_441083.1_3 Forward -200 -190 12.6642 0.248
NP_441083.1_5 Forward -385 -375 20.3345 0.00053
NP_441083.1_5 Reverse -376 -386 11.2881 0.0159
NP_441083.1_5 Reverse -166 -176 9.81313 0.0224
NP_442827.1_8 Reverse -368 -387 4.62021 0.133
NP_441571.1_10 Forward -302 -283 18.1907 0.196
NP_441738.1_2 Forward -383 -376 15.28 0.0102
NP_441738.1_2 Reverse -378 -385 15.28 0.0102
NP_441738.1_2 Reverse -168 -175 15.28 0.0102
NP_441558.1_5 Reverse -374 -393 17.8957 0.0179
NP_441558.1_5 Forward -387 -368 14.3558 0.0495
NP_440209.1_1 Reverse -376 -384 18.1123 0.00295
NP_440209.1_1 Forward -385 -377 18.1123 0.00295
NP_440209.1_1 Forward -175 -167 14.8674 0.012
NP_440209.1_1 Reverse -166 -174 5.62429 0.0821
NP_440209.1_1 Reverse -81 -89 5.32929 0.139
NP_442765.1_1 Forward -307 -288 6.58763 0.299
NP_440447.1_1 Forward -390 -372 4.54237 0.223
NP_440056.1_9 Reverse -233 -252 18.557 0.141
NP_441713.1_1 Reverse -370 -389 -14.8485 0.259
NP_441713.1_1 Reverse -160 -179 -16.8151 0.286
NP_440178.1_7 Forward -386 -367 -21.3384 0.218
NP_442570.1_3 Reverse -65 -84 -8.94866 0.294
NP_441716.1_1 Forward -385 -371 11.6026 0.0936
NP_441716.1_1 Forward -175 -161 7.27608 0.173
NP_442111.1_4 Reverse -375 -389 13.1759 0.0394
NP_442111.1_4 Forward -176 -162 2.94952 0.259
NP_440906.1_5 Forward -384 -377 15.8704 0.0124
NP_440906.1_5 Reverse -377 -384 15.8704 0.0124
NP_440906.1_5 Forward -174 -167 12.0355 0.0724
NP_440906.1_5 Reverse -167 -174 12.0355 0.0724
NP_440747.1_10 Forward -388 -376 17.1486 0.000663
NP_440747.1_10 Reverse -373 -385 7.51213 0.00286
NP_440747.1_10 Forward -178 -166 -2.81262 0.0713
NP_440747.1_10 Forward -217 -205 -11.8591 0.161
NP_440747.1_10 Reverse -163 -175 -11.8591 0.161
NP_441130.1_10 Forward -387 -373 8.65272 0.133
NP_441130.1_10 Reverse -374 -388 6.98109 0.173
NP_441486.1_1 Reverse -373 -387 -2.45868 0.175
NP_442330.1_4 Reverse -279 -298 12.5063 0.286
NP_442634.1_4 Reverse -374 -388 6.58777 0.0489
NP_442634.1_4 Forward -387 -373 5.80112 0.051
NP_441265.1_3 Reverse -160 -174 4.71948 0.181
NP_441265.1_3 Forward -391 -377 1.67122 0.2
NP_442848.1_1 Reverse -370 -384 7.07942 0.0791
NP_441012.1_4 Forward -91 -78 5.72248 0.291
NP_443018.1_3 Forward -384 -377 14.8871 0.0123
NP_443018.1_3 Reverse -377 -384 14.8871 0.0123
NP_443018.1_3 Forward -174 -167 5.34899 0.212
NP_443018.1_3 Reverse -167 -174 5.34899 0.212
NP_441634.1_8 Forward -177 -163 6.6861 0.114
NP_441634.1_8 Forward -387 -373 6.09611 0.114
NP_440376.1_1 Forward -385 -376 19.4693 0.000692
NP_440376.1_1 Reverse -376 -385 19.4693 0.000692
NP_440376.1_1 Forward -175 -166 -0.000272808 0.285
NP_440376.1_1 Reverse -166 -175 -0.0986038 0.285
NP_441588.1_4 Reverse -168 -178 6.46988 0.193
NP_442687.1_7 Reverse -283 -293 12.8614 0.0636
NP_442687.1_7 Forward -386 -376 9.02648 0.0994
NP_442687.1_7 Reverse -375 -385 8.92815 0.0994
NP_442687.1_7 Reverse -80 -90 5.68323 0.189
NP_441846.1_10 Forward -175 -156 -21.9284 0.257
NP_442958.1_3 Reverse -365 -384 -1.08219 0.27
NP_442530.1_2 Reverse -101 -111 11.6814 0.282
NP_440642.1_8 Forward -383 -364 14.1932 0.217
NP_440042.1_2 Reverse -156 -175 -5.40875 0.296
NP_441422.1_7 Forward -387 -370 -3.5994 0.235
NP_441763.1_5 Reverse -153 -172 -6.98204 0.298
NP_440360.1_5 Reverse -202 -221 -0.39387 0.297
NP_440360.1_10 Reverse -201 -215 3.93283 0.227
NP_442658.1_1 Forward -387 -377 14.2375 0.0237
NP_442658.1_1 Reverse -164 -174 13.2542 0.04
NP_442658.1_1 Reverse -374 -384 9.616 0.147
NP_442658.1_1 Reverse -248 -258 5.87944 0.246
NP_442658.1_1 Forward -230 -220 4.99446 0.288
NP_442198.1_3 Forward -99 -80 6.4893 0.251
NP_440446.1_8 Reverse -67 -86 7.57094 0.283
NP_442782.1_2 Reverse -376 -390 8.84938 0.198
NP_442782.1_2 Reverse -250 -264 1.08123 0.282
NP_442496.1_5 Forward -152 -134 10.1472 0.217
NP_442205.1_9 Forward -214 -198 4.28677 0.156
NP_442205.1_9 Reverse -370 -386 -1.51476 0.264
NP_441414.1_9 Forward -385 -366 -3.14714 0.13
NP_441414.1_9 Reverse -81 -100 -8.26035 0.232
NP_441478.1_10 Forward -322 -304 13.883 0.132
NP_442937.1_5 Forward -180 -161 15.0441 0.0638
NP_441958.1_5 Forward -386 -376 21.2195 0.000805
NP_441958.1_5 Reverse -375 -385 12.2714 0.00183
NP_441958.1_5 Forward -176 -166 -6.41148 0.28
NP_442836.1_5 Reverse -370 -389 6.39097 0.179
NP_440203.1_5 Forward -382 -372 10.3043 0.229
NP_442025.1_4 Forward -179 -160 13.0775 0.272
NP_442816.1_7 Forward -109 -90 5.77684 0.244
NP_439905.1_1 Forward -384 -371 11.229 0.204
NP_442876.1_6 Forward -67 -49 23.3975 0.0518
NP_440984.1_7 Forward -390 -376 16.0275 0.0466
NP_440984.1_7 Reverse -371 -385 12.586 0.122
NP_442690.1_1 Reverse -47 -66 4.03102 0.0764
NP_442690.1_1 Forward -68 -49 -16.5201 0.289
NP_442911.1_2 Reverse -366 -385 14.8474 0.0112
NP_442911.1_2 Forward -100 -81 -11.0136 0.296
NP_440153.1_5 Reverse -377 -391 5.01447 0.193
NP_440153.1_5 Forward -384 -370 1.08123 0.276
NP_443055.1_6 Forward -228 -210 7.3932 0.16
NP_443055.1_6 Forward -90 -72 4.73828 0.181
NP_440993.1_2 Forward -390 -374 12.1532 0.0735
NP_440993.1_3 Forward -395 -376 4.42355 0.163
NP_440993.1_3 Reverse -156 -175 -0.886293 0.273
NP_440602.1_2 Reverse -371 -390 2.65439 0.263
NP_439975.1_3 Forward -165 -152 16.1456 0.231
NP_441913.1_1 Reverse -98 -114 16.0465 0.246
NP_441913.1_3 Forward -64 -51 16.2954 0.218
NP_441099.1_5 Reverse -156 -175 10.4225 0.0295
NP_441099.1_5 Reverse -366 -385 -1.27885 0.106
NP_442438.1_10 Reverse -371 -385 2.75286 0.168
NP_441000.1_6 Reverse -165 -179 -3.34366 0.221
NP_441000.1_6 Reverse -375 -389 -3.83532 0.225
NP_440605.1_4 Forward -395 -376 12.9884 0.25
NP_441674.1_2 Forward -221 -202 8.25926 0.236
NP_440147.1_4 Forward -387 -374 19.6855 0.00258
NP_440147.1_4 Reverse -374 -387 9.16406 0.0428
NP_441550.1_8 Reverse -374 -384 16.7941 0.00906
NP_441550.1_8 Forward -387 -377 15.8108 0.0132
NP_441550.1_8 Forward -33 -23 5.97777 0.22
NP_441550.1_8 Forward -177 -167 5.78111 0.23
NP_441916.1_7 Reverse -376 -386 18.9579 0.00144
NP_441916.1_7 Forward -385 -375 10.3048 0.0261
NP_441916.1_10 Forward -393 -374 1.17943 0.27
NP_441041.1_4 Forward -175 -156 -2.95047 0.118
NP_441041.1_4 Forward -166 -147 -12.9802 0.278
NP_441041.1_7 Forward -388 -376 13.3454 0.0485
NP_441041.1_7 Reverse -163 -175 9.74986 0.108
NP_442004.1_6 Forward -385 -371 7.66941 0.157
NP_441725.1_4 Forward -390 -376 4.03056 0.278
NP_441725.1_5 Forward -384 -374 9.02648 0.0553
NP_441725.1_5 Reverse -377 -387 1.94665 0.115
NP_441725.1_5 Forward -89 -79 -0.41329 0.251
NP_439966.1_7 Reverse -374 -384 14.8275 0.0177
NP_439966.1_7 Forward -387 -377 14.3359 0.0203
NP_439966.1_7 Reverse -164 -174 9.22267 0.119
NP_439966.1_7 Forward -177 -167 5.48612 0.22
NP_439966.1_9 Reverse -164 -173 9.93116 0.186
NP_439966.1_9 Reverse -374 -383 0.884706 0.253
NP_442941.1_3 Reverse -377 -387 19.2529 0.00262
NP_442941.1_3 Forward -384 -374 10.9931 0.0116
NP_442941.1_3 Reverse -167 -177 9.51814 0.0306
NP_440289.1_2 Forward -388 -375 3.16588 0.0811
NP_440289.1_2 Reverse -163 -176 0.0192843 0.178
NP_440289.1_2 Reverse -373 -386 -4.60227 0.29
NP_440983.1_5 Reverse -316 -335 -8.752 0.295
NP_440260.1_8 Reverse -216 -234 -7.55234 0.295
NP_442281.1_1 Forward -390 -376 16.9119 0.00698
NP_442281.1_1 Reverse -371 -385 6.39049 0.127
NP_441334.1_7 Reverse -374 -393 -10.3253 0.12
NP_442256.1_2 Forward -387 -369 2.87075 0.107
NP_442256.1_2 Reverse -374 -392 -0.275845 0.139
NP_442256.1_2 Reverse -164 -182 -1.65248 0.178
NP_440437.1_1 Forward -391 -372 16.6174 0.0198
NP_440437.1_1 Forward -273 -254 -2.95047 0.23
NP_442012.1_1 Reverse -370 -389 1.37609 0.217
NP_441556.1_4 Reverse -154 -173 10.7764 0.264
NP_440498.1_1 Forward -394 -376 -0.570838 0.218
NP_442982.1_5 Forward -395 -376 5.01433 0.166
NP_441644.1_6 Reverse -376 -386 19.0557 0.000803
NP_441644.1_6 Forward -385 -375 17.3841 0.00127
NP_441644.1_6 Reverse -166 -176 5.87944 0.174
NP_442215.1_2 Forward -85 -69 9.69497 0.0546
NP_442215.1_2 Reverse -374 -390 -3.38305 0.214
NP_442029.1_1 Forward -177 -158 -8.16202 0.192
NP_440253.1_2 Reverse -166 -184 5.42735 0.0933
NP_440253.1_2 Forward -385 -367 4.6407 0.1
NP_440253.1_2 Reverse -376 -394 -1.25915 0.236
NP_440929.1_8 Forward -385 -376 19.2726 0.000701
NP_440929.1_8 Reverse -376 -385 19.2726 0.000701
NP_440929.1_8 Forward -31 -22 2.16301 0.262
NP_442933.1_10 Forward -385 -376 17.601 0.00325
NP_442933.1_10 Reverse -376 -385 17.601 0.00325
NP_442933.1_10 Forward -175 -166 5.40793 0.19
NP_441751.2_8 Forward -384 -370 4.22782 0.0521
NP_441751.2_8 Reverse -377 -391 -2.26202 0.132
NP_442554.1_8 Forward -384 -374 18.0729 0.00543
NP_442554.1_8 Reverse -377 -387 17.2863 0.00543
NP_442554.1_8 Reverse -167 -177 6.46988 0.117
NP_442970.1_1 Forward -64 -50 20.8289 0.0621
NP_441762.1_7 Forward -176 -164 4.66053 0.0458
NP_441762.1_7 Forward -386 -374 2.79224 0.0676
NP_441762.1_7 Reverse -375 -387 -6.84419 0.284
NP_442142.1_4 Reverse -163 -176 18.1116 0.0255
NP_442142.1_4 Forward -388 -375 12.9 0.0406
NP_442142.1_4 Reverse -373 -386 4.93527 0.206
NP_442142.1_4 Reverse -208 -221 4.24695 0.227
NP_442292.1_1 Forward -384 -375 18.486 0.00229
NP_442292.1_1 Reverse -377 -386 17.5026 0.00435
NP_442292.1_1 Reverse -167 -176 8.75118 0.0306
NP_440032.1_8 Forward -239 -221 14.8671 0.239
NP_442476.1_6 Forward -384 -370 12.586 0.0469
NP_442381.1_8 Reverse -163 -182 -5.50708 0.148
NP_442381.1_8 Reverse -373 -392 -12.3902 0.267
NP_441711.1_4 Reverse -367 -386 6.98095 0.144
NP_441523.1_6 Forward -250 -231 2.26107 0.297
NP_443009.1_5 Reverse -375 -386 14.5128 0.02
NP_443009.1_5 Forward -386 -375 10.1862 0.0792
NP_442741.1_8 Reverse -366 -384 14.9655 0.276
NP_441371.1_3 Reverse -197 -215 11.3272 0.258
NP_441715.1_4 Reverse -377 -387 16.7946 0.0106
NP_441715.1_4 Forward -384 -374 7.84651 0.107
NP_441715.1_4 Reverse -167 -177 7.64985 0.108
NP_441448.1_3 Reverse -371 -390 6.39097 0.132
NP_441507.1_1 Forward -165 -146 22.5172 0.031
NP_441198.1_1 Reverse -205 -224 5.70265 0.217
NP_441198.1_8 Reverse -307 -317 12.2947 0.144
NP_440379.1_5 Reverse -372 -391 -7.17871 0.24
NP_440379.1_6 Reverse -376 -395 12.4875 0.191
NP_441468.1_1 Forward -384 -377 15.8704 0.0124
NP_441468.1_1 Reverse -377 -384 15.8704 0.0124
NP_441468.1_1 Reverse -167 -174 6.13563 0.209
NP_441468.1_1 Forward -174 -167 6.0373 0.223
NP_441020.2_6 Reverse -374 -391 13.4119 0.0736
NP_441015.1_10 Forward -177 -158 -0.4922 0.169
NP_441015.1_10 Reverse -371 -390 -1.47551 0.173
NP_441673.1_1 Forward -385 -376 20.8459 0.000698
NP_441673.1_1 Reverse -376 -385 20.8459 0.000698
NP_441673.1_1 Forward -175 -166 1.27803 0.155
NP_441673.1_1 Reverse -166 -175 1.27803 0.155
NP_441731.1_3 Forward -183 -164 -6.1954 0.29
NP_441876.1_9 Forward -244 -234 11.5826 0.275
NP_441826.1_2 Reverse -370 -384 1.76955 0.142
NP_441330.1_1 Forward -390 -371 -12.5869 0.183
NP_441330.1_1 Forward -180 -161 -14.6519 0.236
NP_442063.1_5 Forward -147 -128 7.07928 0.273
NP_442490.1_9 Forward -397 -378 -6.09707 0.273
NP_442868.1_6 Reverse -374 -384 17.4829 0.012
NP_442868.1_6 Forward -387 -377 10.4031 0.038
NP_442868.1_6 Forward -177 -167 9.41981 0.0485
NP_442868.1_6 Reverse -79 -89 7.55152 0.0746
NP_441612.1_2 Forward -385 -375 8.54929 0.21
NP_442808.1_1 Reverse -165 -175 17.5808 0.00507
NP_442808.1_1 Forward -386 -376 8.73102 0.0481
NP_442808.1_1 Reverse -375 -385 8.63269 0.0481
NP_441101.1_1 Forward -387 -369 12.9005 0.231
NP_441101.1_10 Reverse -233 -252 1.57275 0.173
NP_440918.1_2 Reverse -374 -393 16.3224 0.233
NP_440145.1_3 Forward -395 -376 -5.80207 0.279
NP_442718.1_2 Reverse -211 -230 -0.197208 0.212
NP_442542.1_2 Reverse -164 -177 12.114 0.114
NP_442542.1_9 Forward -392 -378 13.2736 0.108
NP_442050.1_1 Forward -158 -139 9.0459 0.25
NP_442050.1_1 Forward -166 -147 7.7676 0.261
NP_442050.1_5 Forward -387 -377 15.9091 0.0091
NP_442050.1_5 Reverse -374 -384 15.6142 0.01
NP_442342.1_9 Forward -84 -68 7.43336 0.207
NP_441114.1_3 Forward -81 -72 7.86621 0.231
NP_440558.1_2 Reverse -306 -325 -4.72043 0.248
NP_442789.1_4 Reverse -374 -393 -6.98204 0.289
NP_442789.1_4 Reverse -203 -222 -8.16202 0.299
NP_441518.1_3 Forward -395 -376 -11.9969 0.261
NP_441878.1_6 Forward -386 -376 10.5014 0.0176
NP_441878.1_6 Reverse -375 -385 10.4031 0.0176
NP_441036.1_8 Forward -386 -376 15.713 0.00724
NP_441036.1_8 Reverse -165 -175 13.8447 0.0353
NP_441036.1_8 Forward -91 -81 13.7464 0.0375
NP_441036.1_8 Reverse -375 -385 8.33817 0.174
NP_441557.1_5 Forward -385 -376 19.9609 0.000699
NP_441557.1_5 Reverse -376 -385 19.9609 0.000699
NP_441557.1_5 Forward -175 -166 0.983037 0.0911
NP_441557.1_5 Reverse -166 -175 0.688044 0.128
NP_441557.1_5 Forward -90 -81 -1.77023 0.299
NP_441445.1_1 Reverse -367 -386 -0.0988766 0.286
NP_442066.2_9 Reverse -372 -385 10.639 0.154
NP_442962.1_5 Forward -213 -194 5.211 0.242
NP_442830.1_2 Forward -95 -76 17.3048 0.0727
NP_442183.1_1 Forward -385 -371 17.2075 0.0118
NP_440356.1_10 Reverse -159 -177 10.5406 0.253
NP_440979.1_3 Forward -384 -366 14.1788 0.234
NP_441819.1_5 Reverse -47 -66 8.35512 0.295
NP_441574.1_1 Reverse -199 -218 -1.96717 0.222
NP_442494.1_6 Reverse -203 -222 18.0924 0.181
NP_441549.1_9 Reverse -372 -390 12.9988 0.0304
NP_442347.1_2 Forward -384 -375 12.4878 0.056
NP_442347.1_2 Reverse -167 -176 3.93297 0.284
NP_442347.1_2 Reverse -377 -386 3.34298 0.284
NP_441037.1_4 Reverse -79 -89 15.7965 0.02
NP_441037.1_4 Reverse -374 -384 9.55921 0.21
NP_441037.1_4 Forward -387 -377 7.22024 0.237
NP_442594.1_8 Reverse -72 -91 3.34271 0.286
NP_440932.1_9 Reverse -231 -250 12.1925 0.156
NP_441633.1_3 Forward -387 -374 6.01747 0.0481
NP_441633.1_3 Forward -92 -79 5.23083 0.0573
NP_441633.1_3 Forward -177 -164 1.00259 0.11
NP_441633.1_3 Reverse -374 -387 -6.07724 0.236
NP_440136.1_2 Forward -384 -377 15.9687 0.0123
NP_440136.1_2 Reverse -377 -384 15.9687 0.0123
NP_440136.1_2 Reverse -167 -174 6.23397 0.171
NP_440136.1_2 Forward -174 -167 6.13563 0.193
NP_442998.1_5 Reverse -102 -112 9.91146 0.232
NP_442998.1_10 Forward -383 -376 15.5754 0.0102
NP_442998.1_10 Reverse -378 -385 15.5754 0.0102
NP_442998.1_10 Reverse -168 -175 15.5754 0.0102
NP_442998.1_10 Forward -88 -81 6.13563 0.181
NP_440899.1_2 Forward -396 -377 11.995 0.119
NP_440299.1_1 Reverse -372 -385 9.75346 0.0661
NP_440299.1_1 Reverse -162 -175 7.59019 0.109
NP_440299.1_1 Forward -80 -67 4.83694 0.197
NP_441799.1_1 Reverse -372 -386 17.3052 0.011
NP_441799.1_1 Forward -389 -375 14.3553 0.0242
NP_441007.1_10 Reverse -371 -384 18.4072 0.0299
NP_441007.1_10 Forward -390 -377 1.39592 0.203
NP_441435.1_4 Forward -238 -219 6.78429 0.261
NP_442201.1_10 Forward -396 -377 -8.55534 0.221
NP_440256.1_1 Reverse -373 -392 0.294447 0.085
NP_440256.1_1 Forward -388 -369 -7.67036 0.243
NP_441559.1_8 Forward -390 -376 1.47456 0.155
NP_441559.1_8 Forward -253 -239 -7.47356 0.294
NP_441559.1_8 Reverse -161 -175 -7.57189 0.295
NP_440915.1_6 Reverse -372 -386 5.01447 0.0943
NP_440915.1_6 Forward -389 -375 1.08123 0.147
NP_440915.1_6 Reverse -69 -83 -3.54032 0.298
NP_440997.1_6 Forward -31 -12 11.4058 0.26
NP_442158.1_4 Forward -343 -333 14.828 0.176
NP_442785.1_7 Forward -387 -373 11.996 0.228
NP_442069.1_7 Reverse -161 -180 9.7334 0.291
NP_442866.1_1 Reverse -371 -390 -6.88371 0.261
NP_441464.1_8 Forward -385 -371 8.25939 0.2
NP_440702.1_2 Reverse -223 -242 2.0644 0.254
NP_440702.1_8 Reverse -358 -377 11.5042 0.233
NP_440026.1_7 Forward -390 -375 15.7129 0.188
NP_440695.1_6 Forward -136 -122 10.9931 0.265
NP_441939.1_3 Reverse -377 -396 20.944 0.00674
NP_441939.1_3 Reverse -310 -329 5.50599 0.273
NP_441199.1_6 Reverse -162 -181 3.24438 0.183
NP_442993.1_1 Forward -31 -15 -12.0362 0.265
NP_442386.1_9 Reverse -375 -384 13.8639 0.0289
NP_442386.1_9 Reverse -165 -174 8.06244 0.209
NP_442386.1_9 Forward -386 -377 6.39082 0.219
NP_440570.1_5 Forward -191 -172 4.52268 0.221
NP_440570.1_7 Reverse -210 -229 19.3707 0.123
NP_441340.1_5 Forward -384 -377 15.6737 0.0124
NP_441340.1_5 Reverse -377 -384 15.6737 0.0124
NP_441340.1_5 Forward -174 -167 6.13563 0.175
NP_441340.1_5 Reverse -167 -174 5.93897 0.198
NP_442474.1_9 Forward -171 -152 16.0274 0.0966
NP_442240.1_2 Reverse -377 -396 -1.08219 0.0609
NP_440161.1_3 Reverse -164 -183 15.0441 0.118
NP_441160.1_9 Forward -317 -298 14.4541 0.177
NP_440586.1_8 Forward -384 -377 13.2151 0.026
NP_440586.1_8 Reverse -377 -384 13.2151 0.026
NP_440586.1_8 Forward -174 -167 11.4451 0.0645
NP_440586.1_8 Forward -207 -200 7.51192 0.239
NP_442251.1_6 Forward -384 -377 15.2804 0.0124
NP_442251.1_6 Reverse -377 -384 15.2804 0.0124
NP_442251.1_6 Reverse -167 -174 12.0355 0.0627
NP_440192.1_4 Forward -139 -120 9.88271 0.26
NP_442959.1_5 Reverse -47 -66 5.30933 0.287
NP_441262.1_3 Reverse -376 -383 14.7888 0.0223
NP_441262.1_3 Forward -385 -378 14.7888 0.0223
NP_441262.1_3 Forward -175 -168 14.7888 0.0223
NP_441262.1_3 Reverse -81 -88 5.25066 0.215
NP_440027.1_3 Reverse -156 -174 3.95163 0.263
NP_443051.1_1 Forward -386 -377 19.5676 0.00335
NP_443051.1_1 Reverse -375 -384 10.4228 0.00754
NP_443051.1_1 Forward -176 -167 0.786375 0.125
NP_443051.1_1 Reverse -80 -89 -1.08191 0.281
NP_439937.1_8 Forward -219 -200 4.22769 0.2
NP_442294.1_3 Forward -116 -102 12.2903 0.29
NP_441595.1_5 Reverse -302 -320 5.13236 0.262
NP_440836.1_3 Reverse -224 -243 13.7658 0.227
NP_442374.1_7 Forward -369 -350 15.0441 0.261
NP_440439.1_1 Forward -388 -375 10.934 0.0339
NP_440439.1_1 Reverse -373 -386 10.5407 0.0365
NP_440372.1_2 Forward -384 -377 16.3621 0.0124
NP_440372.1_2 Reverse -377 -384 16.3621 0.0124
NP_440372.1_2 Forward -174 -167 6.72562 0.0929
NP_440372.1_2 Reverse -167 -174 6.62729 0.151
NP_440316.1_10 Reverse -230 -240 7.15819 0.251
NP_439977.1_5 Reverse -160 -179 -2.75381 0.289
NP_440139.1_1 Forward -181 -162 2.26028 0.235
NP_440267.1_2 Forward -390 -376 20.5501 0.00946
NP_442384.1_10 Forward -385 -372 11.0324 0.039
NP_442384.1_10 Reverse -376 -389 9.95071 0.047
NP_442035.1_8 Reverse -163 -177 13.4709 0.237
NP_442790.1_4 Reverse -367 -386 -9.24366 0.182
NP_442790.1_4 Forward -184 -165 -15.6352 0.295
NP_442262.1_10 Forward -384 -377 14.1988 0.0123
NP_442262.1_10 Reverse -377 -384 14.1988 0.0123
NP_441689.1_5 Forward -387 -377 8.3377 0.132
NP_441689.1_5 Reverse -374 -384 5.87944 0.197
NP_440163.1_10 Reverse -70 -80 9.02648 0.25
NP_440344.1_10 Reverse -159 -176 9.38028 0.00838
NP_440075.1_2 Forward -158 -139 2.0644 0.292
NP_440531.1_6 Forward -393 -374 -3.44213 0.266
NP_441060.1_9 Reverse -376 -395 10.5209 0.27
NP_441965.1_10 Reverse -373 -389 9.7933 0.116
NP_441898.1_2 Reverse -231 -250 14.8466 0.236
NP_440297.1_9 Forward -384 -374 -0.216628 0.282
NP_440297.1_9 Reverse -377 -387 -0.216628 0.282
NP_442187.1_3 Forward -176 -166 16.893 0.0619
NP_441896.1_3 Reverse -367 -386 -1.27885 0.255
NP_441103.1_9 Reverse -152 -162 13.5638 0.243
NP_440999.1_9 Reverse -162 -176 12.9793 0.0339
NP_440999.1_9 Reverse -372 -386 6.29277 0.0991
NP_440999.1_9 Forward -389 -375 0.687908 0.177
NP_440888.1_2 Forward -385 -371 15.2402 0.0118
NP_440888.1_2 Reverse -376 -390 13.2736 0.0307
NP_440600.1_4 Forward -393 -375 -1.25915 0.163
NP_440179.1_6 Forward -384 -365 4.42435 0.246
NP_440491.1_1 Reverse -373 -392 10.8153 0.18
NP_441345.1_8 Forward -224 -205 9.93088 0.286
NP_442033.1_10 Forward -320 -301 -7.17871 0.186
NP_441949.1_2 Reverse -366 -385 6.19431 0.261
NP_441543.1_2 Forward -384 -375 16.9127 0.00359
NP_441543.1_2 Reverse -377 -386 15.9293 0.00518
NP_441543.1_2 Reverse -167 -176 7.17789 0.131
NP_442845.1_2 Reverse -370 -384 6.09611 0.217
NP_442845.1_2 Reverse -67 -81 4.62115 0.256
NP_441304.1_10 Forward -140 -131 14.1594 0.207
NP_441551.1_5 Reverse -372 -388 19.0357 0.0365
NP_441178.1_6 Forward -313 -294 5.60352 0.268
NP_441469.1_8 Forward -386 -377 6.5879 0.227
NP_441469.1_8 Reverse -375 -384 6.48957 0.227
NP_441469.1_8 Reverse -165 -174 5.70292 0.257
NP_441469.1_8 Forward -91 -82 5.01461 0.297
NP_442315.1_5 Forward -168 -158 16.1063 0.3
NP_442637.1_9 Reverse -64 -83 10.0292 0.216
NP_443064.1_6 Forward -385 -375 12.5669 0.0796
NP_443064.1_6 Reverse -376 -386 10.8217 0.13
NP_443064.1_6 Reverse -166 -176 8.39772 0.292
NP_442578.1_5 Reverse -153 -172 0.687771 0.271
NP_442578.1_7 Forward -384 -377 14.5921 0.026
NP_442578.1_7 Reverse -377 -384 14.5921 0.026
NP_442578.1_7 Forward -174 -167 5.93897 0.183
NP_440710.1_1 Forward -393 -375 0.609134 0.161
NP_441462.1_2 Reverse -376 -386 20.2362 0.000805
NP_441462.1_2 Forward -385 -375 11.5831 0.00406
NP_441462.1_2 Forward -175 -165 -0.118297 0.184
NP_441621.1_7 Reverse -374 -388 4.62115 0.0934
NP_441621.1_7 Forward -177 -163 -1.8687 0.188
NP_441621.1_7 Reverse -206 -220 -4.22864 0.214
NP_443062.1_6 Reverse -368 -387 2.26107 0.258
NP_442204.1_1 Forward -389 -378 11.3667 0.0565
NP_442204.1_2 Forward -395 -376 6.19431 0.291
NP_440516.1_8 Forward -175 -166 17.6993 0.00442
NP_440516.1_8 Forward -385 -376 16.9127 0.00442
NP_440516.1_8 Reverse -376 -385 16.9127 0.00442
NP_441033.1_2 Forward -100 -81 -6.88371 0.293
NP_442428.1_5 Forward -384 -377 15.8704 0.0124
NP_442428.1_5 Reverse -377 -384 15.8704 0.0124
NP_442428.1_5 Reverse -167 -174 6.13563 0.209
NP_442428.1_5 Forward -174 -167 6.0373 0.212
NP_441443.1_2 Reverse -155 -174 -1.96717 0.26
NP_440455.1_2 Forward -111 -98 15.6516 0.274
NP_442859.1_2 Reverse -371 -390 2.65439 0.272
NP_441835.1_3 Forward -175 -161 20.3541 0.031
NP_440673.1_3 Forward -383 -376 12.4288 0.0426
NP_440673.1_3 Reverse -378 -385 12.4288 0.0426
NP_440673.1_3 Reverse -168 -175 12.4288 0.0426
NP_440673.1_3 Forward -88 -81 9.67555 0.179
NP_441714.1_2 Forward -338 -320 18.112 0.138
NP_441714.1_2 Forward -74 -56 10.4422 0.277
NP_440865.1_9 Reverse -301 -320 -0.885524 0.167
NP_441052.1_2 Forward -385 -375 19.9412 0.00106
NP_441052.1_2 Reverse -166 -176 10.7964 0.0285
NP_441052.1_2 Reverse -376 -386 10.4031 0.0285
NP_441052.1_2 Forward -82 -72 2.63497 0.197
NP_442219.1_9 Forward -384 -375 17.7976 0.00718
NP_442219.1_9 Reverse -377 -386 8.25953 0.0681
NP_442219.1_9 Reverse -167 -176 8.06287 0.0696
NP_440436.1_4 Forward -384 -375 17.2072 0.00233
NP_440436.1_4 Reverse -167 -176 13.9623 0.0193
NP_440436.1_4 Reverse -377 -386 9.24241 0.0871
NP_440436.1_4 Forward -174 -165 5.80084 0.182
NP_441884.1_8 Forward -176 -157 -12.2919 0.271
NP_441884.1_9 Forward -388 -369 -5.70374 0.0594
NP_441884.1_9 Reverse -373 -392 -21.7317 0.261
NP_442086.1_3 Reverse -377 -396 15.0441 0.0885
NP_441893.1_10 Forward -229 -210 10.0292 0.26
NP_440314.1_9 Forward -89 -70 -9.047 0.258
NP_440648.1_6 Forward -65 -46 7.27514 0.279
NP_441719.1_4 Forward -384 -377 16.3621 0.0124
NP_441719.1_4 Reverse -377 -384 16.3621 0.0124
NP_441719.1_4 Forward -174 -167 6.72562 0.093
NP_441719.1_4 Reverse -167 -174 6.62729 0.151
NP_441004.1_1 Forward -175 -156 -14.9469 0.271
NP_441004.1_1 Reverse -75 -94 -15.8318 0.279
NP_442139.1_7 Forward -180 -161 9.83255 0.24
NP_442873.1_9 Reverse -366 -385 6.1935 0.259
NP_440296.1_10 Reverse -373 -392 -11.7019 0.269
NP_442206.1_4 Reverse -377 -396 6.4893 0.268
NP_442206.1_10 Forward -385 -370 6.07642 0.178
NP_440328.1_4 Forward -391 -372 13.4708 0.0442
NP_440328.1_4 Reverse -370 -389 1.86774 0.213
NP_443054.1_2 Forward -387 -373 0.786239 0.254
NP_442430.1_10 Forward -395 -376 11.7 0.245
NP_441851.1_10 Reverse -375 -385 15.8113 0.00552
NP_441851.1_10 Forward -386 -376 8.53483 0.114
NP_441851.1_10 Forward -319 -309 5.28991 0.218
NP_441157.1_1 Forward -51 -37 5.1122 0.25
NP_441668.1_4 Forward -334 -315 6.98095 0.155
NP_442515.1_1 Forward -386 -372 11.701 0.0388
NP_442515.1_1 Reverse -375 -389 3.04785 0.125
NP_442515.1_1 Reverse -80 -94 -4.91696 0.298
NP_440165.1_5 Forward -259 -240 -7.17871 0.259
NP_442709.1_3 Reverse -369 -388 9.53756 0.121
NP_442689.1_8 Forward -122 -105 -8.12263 0.292
NP_441349.1_10 Forward -395 -376 -9.83364 0.297
NP_441661.1_3 Reverse -302 -319 -5.56602 0.281
NP_441409.1_6 Reverse -160 -179 4.03102 0.0422
NP_441409.1_6 Reverse -370 -389 0.491109 0.0649
NP_440432.1_9 Reverse -377 -392 15.6145 0.0125
NP_440432.1_9 Reverse -167 -182 5.19144 0.0578
NP_440432.1_9 Forward -384 -369 -0.118434 0.164
NP_440432.1_9 Forward -89 -74 -2.8717 0.176
NP_442843.1_1 Forward -339 -320 -11.2103 0.286
NP_442843.1_1 Forward -163 -144 -11.6036 0.291
NP_439960.1_10 Forward -221 -203 10.9339 0.0979
NP_439960.1_10 Forward -392 -374 3.16574 0.165
NP_440474.1_8 Forward -384 -370 5.1122 0.257
NP_440396.1_10 Forward -384 -368 14.4141 0.151
NP_441477.1_10 Reverse -369 -387 4.24738 0.203
NP_442168.1_4 Reverse -77 -91 16.8142 0.277
NP_439950.1_1 Reverse -306 -315 12.5861 0.279
NP_440943.1_4 Reverse -116 -128 15.2803 0.194
NP_442006.1_2 Reverse -211 -228 -17.1691 0.27
NP_443047.1_7 Reverse -377 -396 6.09597 0.228
NP_441570.1_1 Reverse -376 -394 -0.964162 0.0525
NP_441570.1_1 Forward -175 -157 -14.4355 0.226
NP_441570.1_1 Forward -385 -367 -16.7954 0.254
NP_441078.1_4 Forward -385 -376 19.6659 0.0007
NP_441078.1_4 Reverse -376 -385 19.6659 0.0007
NP_441078.1_4 Reverse -166 -175 0.0980582 0.205
NP_441078.1_4 Forward -175 -166 0.0980582 0.205
NP_442729.1_5 Forward -176 -166 8.1415 0.248
NP_442729.1_8 Reverse -372 -385 10.049 0.125
NP_441663.1_8 Forward -391 -372 13.0775 0.0668
NP_442348.1_2 Reverse -219 -228 11.9961 0.225
NP_442443.1_1 Forward -255 -236 -4.32711 0.271
NP_440526.1_3 Forward -384 -373 10.6779 0.0646
NP_441432.1_5 Reverse -202 -216 12.8809 0.271
NP_441432.1_8 Reverse -375 -384 16.8143 0.00595
NP_441432.1_8 Forward -386 -377 16.8143 0.00595
NP_441432.1_8 Forward -176 -167 7.17789 0.102
NP_443024.1_3 Reverse -307 -317 10.3048 0.289
NP_442320.1_8 Reverse -370 -384 -4.13031 0.148
NP_442320.1_8 Forward -181 -167 -6.19526 0.269
NP_441732.1_2 Forward -389 -373 12.7432 0.00384
NP_442343.1_5 Forward -97 -78 6.29183 0.293
NP_440629.1_6 Forward -391 -372 13.091 0.269
NP_440760.1_1 Forward -385 -366 -23.305 0.293
NP_440760.1_1 Forward -90 -71 -23.4033 0.297
NP_442797.1_7 Forward -221 -203 8.18062 0.194
NP_440578.1_10 Forward -207 -188 8.65258 0.286
NP_441057.1_3 Forward -267 -248 -12.7836 0.26
NP_441057.1_4 Forward -176 -158 12.2122 0.14
NP_442353.1_3 Forward -392 -373 8.16011 0.264
NP_440913.1_1 Reverse -374 -392 14.7688 0.116
NP_440913.1_1 Forward -387 -369 4.9357 0.253
NP_442400.1_10 Forward -55 -42 7.22367 0.292
NP_440713.1_4 Reverse -156 -175 2.55606 0.26
NP_442489.1_7 Forward -385 -376 20.1576 0.000695
NP_442489.1_7 Reverse -376 -385 20.1576 0.000695
NP_442489.1_7 Reverse -166 -175 0.786375 0.152
NP_442489.1_7 Forward -175 -166 0.589713 0.17
NP_442079.1_7 Reverse -377 -396 5.60432 0.172
NP_442079.1_7 Forward -174 -155 4.62101 0.189
NP_440559.1_1 Forward -384 -375 17.4043 0.00658
NP_440559.1_1 Reverse -167 -176 14.1594 0.0317
NP_440559.1_1 Reverse -377 -386 8.65285 0.0586
NP_440559.1_1 Forward -89 -80 4.62128 0.24
NP_441659.2_8 Reverse -376 -386 20.9245 0.000805
NP_441659.2_8 Forward -385 -375 18.1713 0.00133
NP_441659.2_8 Reverse -81 -91 2.33998 0.205
NP_440426.1_7 Forward -395 -376 21.2389 0.0264
NP_442913.1_10 Reverse -367 -386 -1.96717 0.18
NP_442849.1_1 Forward -157 -143 11.0127 0.203
NP_442776.1_1 Forward -396 -377 2.94938 0.294
NP_442346.1_5 Reverse -375 -385 16.6963 0.00248
NP_442346.1_5 Forward -386 -376 16.303 0.00248
NP_442346.1_5 Reverse -80 -90 11.4848 0.0663
NP_442346.1_5 Forward -209 -199 7.74818 0.159
NP_442346.1_5 Forward -176 -166 6.8632 0.188
NP_442346.1_5 Reverse -283 -293 5.09324 0.262
NP_440352.1_2 Forward -110 -91 11.1342 0.277
NP_440545.1_3 Forward -389 -372 7.512 0.0496
NP_440545.1_3 Reverse -372 -389 7.02034 0.0522
NP_441856.1_3 Reverse -373 -392 -1.37718 0.237
NP_441629.1_3 Forward -392 -373 0.0970122 0.236
NP_441653.1_2 Forward -396 -377 8.74784 0.174
NP_440010.1_4 Forward -389 -370 5.80018 0.199
NP_440010.1_10 Reverse -69 -88 6.19431 0.226
NP_441943.1_5 Reverse -328 -347 13.882 0.288
NP_442603.1_7 Forward -385 -371 15.9285 0.038
NP_442828.1_7 Forward -167 -148 1.27776 0.276
NP_441948.1_4 Forward -392 -374 4.54237 0.0922
NP_441948.1_4 Forward -182 -164 -4.40575 0.228
NP_441833.1_4 Forward -384 -377 15.9687 0.0124
NP_441833.1_4 Reverse -377 -384 15.9687 0.0124
NP_441833.1_4 Reverse -167 -174 14.1004 0.0258
NP_441833.1_4 Forward -174 -167 6.13563 0.198
NP_441833.1_4 Forward -89 -82 4.66067 0.22
NP_442799.1_2 Forward -84 -65 8.65258 0.159
NP_441329.1_6 Reverse -296 -315 -1.86252 0.293
NP_441112.1_6 Forward -395 -376 -3.63879 0.296
NP_442162.1_9 Forward -384 -377 16.2637 0.0124
NP_442162.1_9 Reverse -377 -384 16.2637 0.0124
NP_442162.1_9 Reverse -167 -174 6.62729 0.142
NP_442162.1_9 Forward -174 -167 6.52896 0.178
NP_440224.1_1 Forward -396 -377 19.6656 0.0127
NP_442073.1_6 Reverse -157 -176 1.27776 0.25
NP_442199.1_5 Forward -393 -374 7.96426 0.0719
NP_442140.1_3 Forward -174 -164 17.7779 0.0159
NP_442140.1_3 Forward -384 -374 13.5497 0.0542
NP_442140.1_3 Reverse -82 -92 6.17489 0.184
NP_442140.1_3 Reverse -377 -387 4.69992 0.238
NP_440875.1_9 Reverse -378 -388 16.5483 0.0145
NP_442547.1_7 Reverse -201 -220 11.4877 0.255
NP_442547.1_7 Forward -251 -232 11.293 0.26
NP_441813.1_3 Forward -157 -138 14.5282 0.243
NP_441813.1_5 Forward -387 -377 18.1713 0.00743
NP_441813.1_5 Reverse -374 -384 8.73149 0.0367
NP_441813.1_5 Forward -177 -167 8.33817 0.047
NP_441813.1_5 Reverse -164 -174 0.471689 0.201
NP_440590.1_4 Forward -384 -371 4.54251 0.0601
NP_440590.1_4 Reverse -167 -180 -0.275709 0.182
NP_440590.1_4 Forward -174 -161 -3.32397 0.255
NP_440590.1_4 Reverse -377 -390 -5.38892 0.277
NP_440567.1_1 Forward -384 -370 15.6342 0.017
NP_440567.1_1 Forward -174 -160 2.65453 0.167
NP_440567.1_1 Reverse -377 -391 0.294584 0.25
NP_442497.1_10 Reverse -377 -386 17.601 0.00813
NP_442497.1_10 Forward -384 -375 10.4228 0.0087
NP_442497.1_10 Reverse -167 -176 0.688044 0.141
NP_442497.1_10 Forward -89 -80 0.688044 0.141
NP_440821.1_4 Reverse -374 -384 17.9746 0.00497
NP_440821.1_4 Reverse -164 -174 6.66654 0.0837
NP_440821.1_4 Forward -387 -377 2.24165 0.131
NP_440821.1_4 Reverse -79 -89 0.176696 0.198
NP_440821.1_4 Forward -177 -167 -0.41329 0.257
NP_441239.1_9 Forward -387 -375 13.0187 0.0389
NP_441239.1_9 Reverse -374 -386 7.11881 0.169
NP_441239.1_9 Reverse -164 -176 6.52882 0.185
NP_441727.1_3 Reverse -369 -388 3.14605 0.292
NP_440665.1_1 Forward -382 -363 -13.5702 0.257
NP_440665.1_2 Forward -221 -202 -6.78538 0.29
NP_442044.1_1 Forward -390 -371 -4.32711 0.177
NP_441017.1_8 Reverse -306 -321 9.22301 0.231
NP_441526.1_8 Reverse -172 -191 -3.14714 0.277
NP_442138.1_10 Reverse -376 -395 11.0125 0.0361
NP_442052.1_8 Reverse -248 -258 13.1564 0.253
NP_440546.1_4 Reverse -376 -386 13.5365 0.0459
NP_440546.1_4 Forward -175 -165 11.0156 0.0991
NP_440546.1_4 Forward -385 -375 10.046 0.109
NP_440546.1_4 Reverse -73 -83 9.46426 0.136
NP_440462.1_6 Forward -387 -377 18.7612 0.00454
NP_440462.1_6 Reverse -374 -384 10.3048 0.0396
NP_440462.1_6 Reverse -164 -174 7.45319 0.0788
NP_440868.1_4 Reverse -372 -384 19.0169 0.0123
NP_440868.1_4 Forward -389 -377 14.7886 0.0169
NP_440868.1_4 Reverse -162 -174 2.0056 0.167
NP_440401.1_5 Reverse -145 -159 16.1259 0.249
NP_442499.1_1 Forward -384 -365 2.3594 0.289
NP_442479.1_9 Forward -113 -94 -12.7836 0.287
NP_441474.1_1 Forward -395 -376 1.37531 0.247
NP_441848.1_4 Reverse -95 -111 11.6568 0.216
NP_441848.1_4 Forward -144 -128 8.02812 0.288
NP_441084.1_6 Forward -387 -373 12.6407 0.158
NP_442923.1_4 Reverse -190 -209 -5.50708 0.279
NP_442039.1_4 Forward -384 -377 15.1821 0.0124
NP_442039.1_4 Reverse -377 -384 15.1821 0.0124
NP_441811.1_8 Reverse -370 -384 7.76774 0.241
NP_442837.1_3 Forward -384 -377 15.7721 0.0124
NP_442837.1_3 Reverse -377 -384 15.7721 0.0124
NP_442837.1_3 Reverse -167 -174 6.13563 0.25
NP_442837.1_3 Forward -174 -167 5.93897 0.265
NP_440160.1_2 Reverse -238 -257 -5.50708 0.274
NP_440160.1_2 Forward -253 -234 -8.65367 0.286
NP_442053.1_1 Forward -385 -376 18.3876 0.0007
NP_442053.1_1 Reverse -376 -385 18.3876 0.0007
NP_442053.1_1 Forward -175 -166 7.76787 0.0895
NP_442053.1_1 Reverse -166 -175 7.17789 0.104
NP_440505.1_3 Forward -387 -377 17.188 0.00332
NP_440505.1_3 Forward -177 -167 17.0896 0.00449
NP_440505.1_3 Reverse -374 -384 16.598 0.00683
NP_441959.1_10 Reverse -238 -256 14.9952 0.178
NP_441102.1_1 Reverse -377 -396 5.211 0.256
NP_441777.1_4 Forward -66 -47 17.3814 0.21
NP_442532.1_7 Forward -385 -371 5.01447 0.171
NP_440914.1_1 Forward -385 -375 17.5935 0.000537
NP_440914.1_1 Reverse -376 -386 16.3248 0.00196
NP_440914.1_1 Reverse -166 -176 13.4947 0.0297
NP_441011.1_8 Reverse -377 -386 16.6177 0.00602
NP_441011.1_8 Forward -384 -375 8.25953 0.144
NP_441011.1_8 Forward -174 -165 5.60459 0.247
NP_442533.1_1 Forward -172 -153 -11.5053 0.236
NP_442533.1_1 Reverse -222 -241 -17.8968 0.297
NP_442533.1_6 Forward -385 -376 17.2076 0.00137
NP_442533.1_6 Reverse -376 -385 17.2076 0.00137
NP_442533.1_6 Forward -82 -73 3.04799 0.228
NP_440263.1_5 Reverse -52 -66 7.47274 0.294
NP_442322.1_4 Forward -90 -73 -2.12512 0.228
NP_443016.1_1 Forward -391 -372 -5.31042 0.245
NP_441482.1_7 Forward -391 -377 -2.85201 0.1
NP_439944.1_9 Forward -384 -374 19.1546 0.00329
NP_439944.1_9 Reverse -377 -387 9.12481 0.1
NP_440816.1_7 Reverse -162 -181 17.6007 0.181
NP_441028.1_6 Reverse -140 -150 5.19112 0.265
NP_440115.1_6 Reverse -373 -383 17.9746 0.0163
NP_440115.1_6 Forward -388 -378 14.0414 0.0615
NP_440115.1_6 Reverse -78 -88 7.35486 0.147
NP_440115.1_6 Forward -178 -168 6.76487 0.167
NP_440007.1_4 Forward -396 -377 13.1758 0.204
NP_440007.1_9 Forward -389 -375 0.786239 0.29
NP_441961.1_2 Reverse -134 -153 20.8456 0.0389
NP_441602.1_3 Reverse -371 -390 -2.65548 0.235
NP_441602.1_3 Forward -323 -304 -4.6221 0.269
NP_441602.1_4 Forward -396 -377 11.7008 0.278
NP_441972.1_5 Reverse -377 -396 -9.53865 0.288
NP_441106.1_1 Forward -386 -377 18.486 0.0028
NP_441106.1_1 Reverse -375 -384 9.63616 0.0311
NP_441106.1_1 Reverse -165 -174 5.70292 0.131
NP_439903.1_6 Forward -388 -369 3.34192 0.21
NP_441286.1_1 Forward -386 -374 12.232 0.00999
NP_441286.1_1 Forward -176 -164 11.2487 0.013
NP_441286.1_1 Reverse -375 -387 5.93884 0.0258
NP_441286.1_1 Forward -91 -79 -5.76255 0.223
NP_440670.1_8 Forward -385 -376 18.3876 0.000699
NP_440670.1_8 Reverse -376 -385 18.3876 0.000699
NP_440670.1_8 Reverse -166 -175 6.8829 0.0907
NP_440670.1_8 Forward -31 -22 4.0313 0.207
NP_440670.1_8 Forward -90 -81 3.83464 0.219
NP_440886.1_7 Reverse -165 -175 8.53436 0.0805
NP_440886.1_7 Forward -386 -376 8.04271 0.0805
NP_440886.1_7 Reverse -375 -385 7.94438 0.0805
NP_440886.1_7 Reverse -156 -166 5.38779 0.185
NP_440083.1_2 Forward -168 -149 -0.39387 0.295
NP_440083.1_3 Forward -333 -314 31.957 0.0000588
NP_440083.1_4 Forward -270 -251 8.94462 0.299
NP_442614.1_2 Forward -385 -371 7.27608 0.275
NP_442072.1_9 Forward -386 -368 -20.237 0.204
NP_442072.1_9 Reverse -375 -393 -20.827 0.204
NP_440907.2_8 Forward -384 -374 10.8943 0.0969
NP_440907.2_8 Reverse -377 -387 9.616 0.103
NP_439999.1_5 Reverse -20 -39 11.1109 0.262
NP_441021.1_1 Forward -384 -365 6.19431 0.0704
NP_440841.1_4 Reverse -164 -183 -6.98204 0.22
NP_441463.1_3 Reverse -366 -385 -0.000545616 0.132
NP_441463.1_6 Forward -387 -373 7.28563 0.262
NP_441626.1_2 Forward -384 -377 15.7721 0.0124
NP_441626.1_2 Reverse -377 -384 15.7721 0.0124
NP_441626.1_2 Forward -174 -167 6.0373 0.212
NP_441626.1_2 Reverse -167 -174 6.0373 0.212
NP_442365.1_7 Forward -389 -370 0.687771 0.177
NP_442365.1_7 Reverse -372 -391 -5.80207 0.279
NP_442794.1_1 Reverse -162 -174 3.18557 0.286
NP_442794.1_1 Forward -185 -173 2.89058 0.286
NP_442615.1_1 Forward -394 -376 6.50899 0.0344
NP_442615.1_1 Forward -184 -166 -5.68405 0.22
NP_441962.1_4 Reverse -76 -95 -9.047 0.211
NP_440387.1_1 Forward -385 -369 21.593 0.00219
NP_440855.1_1 Reverse -208 -227 1.47442 0.225
NP_441431.1_2 Forward -388 -374 12.487 0.116
NP_441431.1_2 Forward -86 -72 6.58715 0.266
NP_441488.1_3 Forward -162 -144 17.1162 0.276
NP_441836.1_2 Reverse -370 -389 -2.36049 0.229
NP_441836.1_2 Forward -214 -195 -3.73712 0.244
NP_441993.1_1 Reverse -220 -239 6.13735 0.186
NP_441993.1_3 Forward -238 -219 19.0748 0.144
NP_440114.1_10 Reverse -376 -390 10.3243 0.148
NP_440114.1_10 Forward -385 -371 6.98109 0.25
NP_441500.1_8 Forward -69 -55 13.8567 0.297
NP_440293.1_3 Reverse -203 -222 -2.26216 0.239
NP_440293.1_3 Reverse -242 -261 -3.83545 0.254
NP_440766.1_5 Reverse -122 -134 9.08817 0.277
NP_439988.1_3 Reverse -69 -83 17.3058 0.145
NP_441237.1_9 Forward -384 -374 14.9263 0.0242
NP_442743.1_1 Reverse -153 -172 11.0117 0.241
NP_442743.1_4 Reverse -377 -396 0.294447 0.174
NP_442942.1_5 Reverse -211 -230 13.2741 0.237
NP_440457.1_1 Forward -389 -377 0.727295 0.25
NP_440457.1_1 Reverse -372 -384 0.137309 0.25
NP_440798.1_6 Reverse -377 -390 10.5407 0.074
NP_442297.1_4 Forward -389 -370 11.8488 0.294
NP_441332.1_6 Forward -83 -73 11.9372 0.239
NP_440473.1_1 Forward -388 -369 11.0646 0.283
NP_442509.1_9 Forward -385 -375 8.14104 0.192
NP_442509.1_9 Reverse -376 -386 8.04271 0.192
NP_440554.1_4 Reverse -377 -387 17.9746 0.0131
NP_440554.1_4 Forward -384 -374 6.37155 0.123
NP_442862.1_3 Forward -341 -324 5.54538 0.271
NP_441885.1_5 Forward -385 -375 20.9245 0.000538
NP_441885.1_5 Reverse -376 -386 11.3864 0.00668
NP_441885.1_5 Reverse -166 -176 1.35667 0.11
NP_440478.1_10 Reverse -164 -178 7.57108 0.261
NP_441428.1_8 Reverse -368 -387 4.71934 0.237
NP_442341.1_7 Forward -386 -372 7.76774 0.0994
NP_442341.1_9 Forward -387 -373 10.1271 0.137
NP_441756.1_5 Reverse -162 -181 -0.39387 0.244
NP_441756.1_5 Reverse -372 -391 -3.44213 0.29
NP_441173.1_9 Forward -130 -122 10.9338 0.242
NP_441173.1_9 Forward -108 -100 10.6388 0.261
NP_443000.1_3 Reverse -73 -92 9.87422 0.297
NP_443000.1_7 Forward -387 -377 20.3345 0.00223
NP_443000.1_7 Reverse -374 -384 10.4031 0.0345
NP_443000.1_7 Forward -177 -167 10.1081 0.0376
NP_441842.1_10 Reverse -369 -383 8.35772 0.225
NP_440275.1_3 Reverse -374 -384 17.6796 0.0102
NP_440275.1_3 Forward -387 -377 16.1063 0.0155
NP_440275.1_3 Reverse -79 -89 8.92815 0.0602
NP_440275.1_3 Reverse -164 -174 6.46988 0.105
NP_440275.1_3 Forward -177 -167 5.48657 0.145
NP_440091.1_1 Reverse -372 -384 8.29878 0.0653
NP_442234.1_1 Forward -162 -143 18.0924 0.117
NP_442495.1_4 Reverse -230 -240 14.828 0.158
NP_442495.1_5 Reverse -200 -219 13.0775 0.23
NP_440149.1_8 Forward -385 -366 -3.44213 0.19
NP_441105.1_3 Forward -270 -251 -9.047 0.283
NP_441105.1_3 Forward -329 -310 -9.44032 0.289
NP_440216.1_1 Reverse -376 -390 24.9757 0.000528
NP_440216.1_1 Forward -385 -371 -9.44018 0.145
NP_440216.1_1 Reverse -166 -180 -12.2918 0.256
NP_440216.1_9 Reverse -333 -342 7.17789 0.286
NP_440216.1_9 Reverse -98 -107 5.3096 0.298
NP_440172.1_1 Reverse -376 -386 17.5813 0.00421
NP_440172.1_1 Forward -385 -375 15.0247 0.00945
NP_442371.1_1 Reverse -100 -110 14.1392 0.191
NP_442371.1_1 Reverse -334 -344 11.8776 0.273
NP_442371.1_2 Reverse -46 -63 18.9249 0.281
NP_440249.1_2 Forward -59 -49 14.8275 0.273
NP_442015.1_10 Forward -389 -376 3.75586 0.178
NP_442015.1_10 Reverse -372 -385 2.77255 0.187
NP_441226.1_7 Forward -384 -377 14.4934 0.0123
NP_441226.1_7 Reverse -377 -384 14.4934 0.0123
NP_441226.1_7 Forward -30 -23 6.82361 0.246
NP_441757.1_3 Reverse -375 -394 12.1925 0.08
NP_441111.1_7 Forward -384 -376 18.7023 0.00294
NP_441111.1_7 Reverse -377 -385 18.7023 0.00294
NP_441111.1_7 Reverse -167 -175 8.96754 0.0463
NP_441111.1_7 Forward -89 -81 -0.472234 0.131
NP_442379.1_10 Reverse -369 -386 13.6085 0.0528
NP_441766.1_2 Forward -385 -376 17.5026 0.00297
NP_441766.1_2 Reverse -376 -385 17.5026 0.00297
NP_441766.1_2 Reverse -166 -175 8.65285 0.0495
NP_441766.1_2 Forward -90 -81 3.34298 0.22
NP_442417.1_5 Reverse -376 -390 4.52282 0.292
NP_440416.1_9 Forward -392 -373 -14.4552 0.176
NP_443052.1_8 Reverse -366 -385 -6.88371 0.149
NP_443052.1_8 Reverse -248 -267 -11.2103 0.224
NP_443052.1_9 Reverse -153 -172 4.12936 0.156
NP_443052.1_9 Reverse -147 -166 -6.68705 0.287
NP_440072.1_5 Reverse -231 -249 -4.01242 0.288
NP_441940.1_4 Forward -387 -368 9.3409 0.266
NP_442154.1_1 Forward -174 -156 -4.50408 0.125
NP_442154.1_1 Reverse -220 -238 -11.8789 0.217
NP_440261.1_5 Forward -384 -371 6.80412 0.0316
NP_440261.1_5 Reverse -377 -390 6.60746 0.0318
NP_440261.1_5 Forward -89 -76 -10.5021 0.201
NP_440988.1_10 Reverse -374 -388 5.67333 0.24
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGAGGATACCCACCAGGCGATCGCCACCATGTTTGAGCTGCAAACTTTGGGTATTCATTTTTCCGTGGATGATTTTGGTACGGGCTATTCCTCCCTGTCCTATCTGAAACGGTTACCCCTGAATGAACTGAAAATTGACCGAGCCTTTGTCCAGGATGCGCCCCAGGACCTCAACAATGCCGCCCTGGTGGAAGCCATCATTAGCGTAGCCCGCACTTTCAATCTGGCGATCGTGGCGGAAGGGGTGGAAACGGAGGAACAGGTGCAATTTTTAGCCCAGTTGGGTTGCAATTTTTACCAGGGTTATTTCTACGGTCGCCCCATGCCCATAGATGAATTTCATCAAAAATTAACCGCCAGTTAAAGTTGGCCGAACGGATTAACCCAGACAAATGGGGGA

CDS

ATGAGGCCAGCATTTTCTCCCCTTCCACTAGAATGGGGGAAATTCTTTTTACGGGGGAACATGGCCAGCAATAACAAAGGTGGCGCTCTGTTGGCAGGCATGGTAATTGGCGGTTTAGTGGGATCGGTGACTGGGTTATTGTTAGCCCCCCGCTCCGGCAAACAAACCAGGCAACTGTTAAAAAAATCTGCCGACGCCCTCCCCGATTTAGCCGAGGATTTGGCCACAACTCTGCAACTCCAGGCAGACTATCTTTCCGAAGCCACCCAACGTAATTGGCAGGGCACCCTGGAACGGCTCAAAGAGGCGATCGCCGCTGGGGTGGAAGCAACCCAAACCACCGTGGTGTCAGAACCGGAACCAAAACCAAGGGACATTACAGCGGAAACTACCCTGGCGGACAGTTAG

Protein

MRPAFSPLPLEWGKFFLRGNMASNNKGGALLAGMVIGGLVGSVTGLLLAPRSGKQTRQLLKKSADALPDLAEDLATTLQLQADYLSEATQRNWQGTLERLKEAIAAGVEATQTTVVSEPEPKPRDITAETTLADS