Your browser is old and dusty. Try Google Chrome!

Details for sll0252

ORF sll0252
Accession NP_441258.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -110 -96 -1.08205 0.249
NP_440557.1_1 Forward -110 -91 1.37609 0.256
NP_440795.1_7 Reverse -103 -110 10.8555 0.132
NP_442100.1_1 Forward -171 -152 9.02356 0.24
NP_441418.1_6 Forward -279 -260 -23.895 0.198
NP_441418.1_6 Forward -111 -92 -24.0916 0.199
NP_440897.1_6 Forward -153 -134 -1.18128 0.187
NP_440897.1_6 Reverse -102 -121 -3.14789 0.233
NP_441453.1_4 Reverse -201 -209 12.7041 0.0314
NP_442151.1_6 Reverse -102 -116 9.34103 0.152
NP_442151.1_6 Forward -153 -139 6.58777 0.228
NP_441818.1_1 Reverse -271 -282 8.71129 0.28
NP_442169.1_1 Reverse -308 -327 -3.04881 0.286
NP_441342.1_2 Forward -115 -101 13.3726 0.174
NP_442623.1_1 Reverse -99 -118 -9.24366 0.235
NP_442655.1_1 Reverse -26 -45 -1.67217 0.281
NP_442752.1_4 Forward -279 -272 10.5605 0.1
NP_442752.1_4 Forward -111 -104 10.5605 0.1
NP_442752.1_4 Forward -140 -133 6.52896 0.154
NP_442752.1_4 Reverse -102 -109 5.54565 0.194
NP_443027.1_4 Reverse -100 -110 11.0914 0.107
NP_442975.1_10 Reverse -98 -112 2.06395 0.284
NP_442000.2_10 Forward -94 -76 16.7354 0.167
NP_442000.2_10 Forward -142 -124 5.82068 0.286
NP_440061.1_9 Forward -379 -365 7.47213 0.205
NP_441054.1_2 Forward -41 -22 11.0125 0.277
NP_441054.1_3 Reverse -85 -103 19.3994 0.133
NP_441476.1_5 Reverse -133 -152 2.26107 0.188
NP_441476.1_5 Reverse -97 -116 0.884433 0.19
NP_439979.1_9 Reverse -330 -348 14.2771 0.227
NP_442062.1_8 Reverse -102 -112 4.3066 0.221
NP_442207.1_4 Reverse -323 -342 5.89931 0.285
NP_441594.1_6 Reverse -96 -115 14.0608 0.109
NP_441594.1_6 Reverse -93 -112 2.0644 0.256
NP_442742.1_3 Reverse -216 -235 14.6508 0.2
NP_442742.1_9 Reverse -80 -99 -13.3736 0.274
NP_440132.1_7 Forward -108 -89 19.8623 0.106
NP_441925.1_4 Reverse -23 -42 0.0970122 0.155
NP_441925.1_4 Reverse -263 -282 -15.7342 0.273
NP_440856.1_7 Forward -153 -134 -6.68705 0.246
NP_441083.1_5 Reverse -102 -112 8.23984 0.0429
NP_441083.1_5 Reverse -270 -280 4.40493 0.146
NP_441083.1_5 Forward -363 -353 3.91327 0.162
NP_441083.1_5 Forward -111 -101 -0.511621 0.269
NP_442827.1_3 Reverse -26 -45 16.6174 0.121
NP_442827.1_8 Reverse -94 -113 -2.26292 0.272
NP_441738.1_2 Reverse -379 -386 9.57686 0.166
NP_441558.1_5 Reverse -142 -161 5.99764 0.232
NP_442570.1_3 Reverse -313 -332 -2.16383 0.212
NP_442570.1_3 Forward -155 -136 -4.91709 0.237
NP_442462.1_2 Forward -143 -124 6.98095 0.206
NP_441716.1_1 Forward -330 -316 7.07942 0.181
NP_441716.1_1 Forward -279 -265 6.88276 0.186
NP_440481.1_6 Forward -206 -188 19.7837 0.101
NP_440343.1_9 Reverse -316 -335 7.96426 0.275
NP_440747.1_10 Forward -114 -102 -4.77924 0.117
NP_440747.1_10 Reverse -198 -210 -12.5474 0.297
NP_441837.1_9 Forward -319 -300 10.6192 0.239
NP_441486.1_1 Reverse -99 -113 -5.31028 0.231
NP_442848.1_9 Reverse -22 -41 2.0644 0.255
NP_441012.1_4 Reverse -140 -153 11.7207 0.252
NP_441634.1_8 Forward -113 -99 3.44117 0.152
NP_441634.1_8 Reverse -142 -156 -0.983719 0.274
NP_441634.1_8 Reverse -199 -213 -3.34366 0.295
NP_440376.1_1 Reverse -102 -111 7.17789 0.0829
NP_440376.1_1 Forward -111 -102 -0.000272808 0.285
NP_441588.1_4 Reverse -379 -389 5.19158 0.282
NP_442730.1_8 Reverse -135 -154 9.7334 0.185
NP_442687.1_7 Forward -88 -78 5.09324 0.221
NP_441846.1_10 Forward -42 -23 -15.4385 0.25
NP_441846.1_10 Forward -41 -22 -20.5517 0.256
NP_441846.1_10 Reverse -323 -342 -22.9117 0.271
NP_441950.1_7 Reverse -314 -333 -9.53865 0.297
NP_442296.1_9 Reverse -132 -151 -0.787193 0.197
NP_442782.1_2 Reverse -321 -335 2.45787 0.275
NP_442782.1_2 Forward -40 -26 2.45787 0.275
NP_442205.1_9 Reverse -96 -112 -2.69473 0.272
NP_442205.1_9 Reverse -323 -339 -3.97304 0.3
NP_439990.1_5 Forward -116 -103 8.57408 0.168
NP_442911.1_2 Reverse -92 -111 -6.98204 0.197
NP_440153.1_5 Forward -110 -96 12.9793 0.0638
NP_443055.1_6 Reverse -119 -137 -0.473239 0.261
NP_440827.1_3 Reverse -133 -152 12.4875 0.247
NP_442210.1_7 Forward -256 -237 20.059 0.135
NP_440138.1_6 Forward -368 -349 6.09517 0.227
NP_441099.1_5 Reverse -191 -210 -3.73712 0.138
NP_441646.1_1 Forward -118 -99 -1.67217 0.293
NP_442438.1_10 Reverse -97 -111 8.94771 0.0708
NP_442431.1_10 Reverse -318 -336 4.6407 0.206
NP_441398.1_5 Forward -48 -29 7.7676 0.258
NP_441000.1_6 Reverse -269 -283 1.47456 0.168
NP_440147.1_4 Forward -388 -375 4.8375 0.146
NP_440147.1_4 Forward -358 -345 1.78924 0.22
NP_440147.1_4 Forward -113 -100 0.215946 0.261
NP_441550.1_8 Reverse -268 -278 6.96107 0.183
NP_441550.1_8 Forward -281 -271 4.60114 0.299
NP_440206.1_4 Forward -334 -315 -0.197979 0.29
NP_441041.1_4 Reverse -144 -163 -9.047 0.211
NP_439966.1_7 Reverse -199 -209 4.60114 0.265
NP_440202.1_8 Forward -288 -269 12.3352 0.272
NP_442941.1_3 Reverse -103 -113 6.27322 0.0975
NP_442941.1_3 Forward -209 -199 -0.314959 0.256
NP_440289.1_4 Reverse -373 -392 16.5191 0.126
NP_440983.1_8 Forward -143 -124 18.1907 0.1
NP_442281.1_1 Reverse -139 -153 5.99717 0.139
NP_442281.1_1 Reverse -133 -147 3.34225 0.235
NP_442847.1_2 Forward -39 -20 16.6174 0.278
NP_440437.1_1 Reverse -258 -277 -4.42544 0.258
NP_442500.1_2 Reverse -321 -340 18.4857 0.0559
NP_440723.1_4 Forward -203 -184 -6.1954 0.272
NP_441556.1_10 Forward -117 -103 11.9739 0.205
NP_442982.1_5 Reverse -92 -111 6.78429 0.141
NP_441644.1_6 Reverse -270 -280 7.74772 0.117
NP_441644.1_6 Reverse -102 -112 4.40448 0.239
NP_441644.1_6 Reverse -144 -154 3.51951 0.277
NP_441644.1_6 Reverse -138 -148 3.42118 0.282
NP_442215.1_2 Reverse -252 -268 -2.89139 0.206
NP_442215.1_2 Forward -155 -139 -5.25134 0.248
NP_442215.1_2 Reverse -100 -116 -6.92296 0.281
NP_442029.1_6 Forward -145 -126 7.17762 0.225
NP_440929.1_8 Reverse -201 -210 4.91628 0.162
NP_442933.1_10 Forward -386 -377 4.12963 0.28
NP_442933.1_10 Forward -111 -102 4.12963 0.28
NP_442554.1_8 Forward -209 -199 4.60159 0.18
NP_442554.1_8 Forward -152 -142 4.3066 0.189
NP_441762.1_7 Forward -112 -100 -7.23751 0.286
NP_442292.1_1 Reverse -103 -112 -0.590259 0.258
NP_443009.1_5 Forward -112 -101 13.3328 0.0346
NP_442301.1_2 Forward -339 -320 9.63507 0.2
NP_440357.1_6 Reverse -191 -210 7.96426 0.272
NP_440158.1_8 Reverse -291 -310 14.9458 0.18
NP_440379.1_5 Forward -51 -32 -1.08219 0.184
NP_441020.2_6 Reverse -318 -335 5.54538 0.298
NP_441015.1_10 Reverse -321 -340 -0.197208 0.169
NP_441015.1_10 Forward -152 -133 -9.44032 0.282
NP_441015.1_10 Reverse -327 -346 -11.1119 0.291
NP_441673.1_1 Reverse -102 -111 1.37636 0.114
NP_441673.1_1 Forward -111 -102 1.1797 0.163
NP_441826.1_2 Reverse -96 -110 2.65453 0.123
NP_441826.1_2 Reverse -138 -152 -3.73699 0.286
NP_442868.1_6 Reverse -199 -209 -0.314959 0.284
NP_442719.1_2 Forward -25 -7 -10.4046 0.273
NP_441612.1_2 Reverse -102 -112 13.4867 0.21
NP_441612.1_2 Forward -363 -353 6.51622 0.287
NP_442227.1_2 Reverse -23 -42 -2.95047 0.285
NP_442808.1_1 Reverse -101 -111 6.37109 0.116
NP_442775.1_6 Forward -158 -139 9.63589 0.296
NP_440145.1_4 Reverse -271 -281 16.0075 0.17
NP_442113.1_10 Reverse -182 -201 -7.08038 0.265
NP_442050.1_1 Reverse -313 -332 8.45592 0.25
NP_442342.1_9 Reverse -31 -47 16.6765 0.0737
NP_441114.1_3 Reverse -139 -148 7.66954 0.231
NP_440558.1_2 Reverse -134 -153 -3.04881 0.232
NP_440111.2_2 Forward -107 -88 -4.72043 0.292
NP_440111.2_8 Reverse -128 -144 9.59664 0.28
NP_441036.1_3 Reverse -373 -392 4.12936 0.168
NP_441036.1_8 Reverse -376 -386 8.4365 0.174
NP_441036.1_8 Reverse -101 -111 7.25653 0.203
NP_441036.1_8 Forward -211 -201 5.68323 0.265
NP_441557.1_5 Reverse -102 -111 0.491382 0.144
NP_441557.1_5 Forward -111 -102 0.29472 0.174
NP_441557.1_8 Reverse -28 -38 12.8609 0.235
NP_441445.1_1 Forward -156 -137 4.32602 0.195
NP_441433.1_8 Forward -101 -82 -4.6221 0.294
NP_441224.1_1 Forward -357 -344 18.5055 0.181
NP_440084.1_8 Forward -72 -58 13.5715 0.223
NP_440084.1_8 Forward -74 -60 9.27434 0.29
NP_440084.1_8 Forward -73 -59 9.17885 0.29
NP_442469.1_8 Forward -101 -87 12.291 0.291
NP_442192.1_7 Forward -90 -72 14.0805 0.299
NP_442183.1_8 Forward -113 -96 17.8367 0.205
NP_441819.1_5 Reverse -7 -26 8.35512 0.295
NP_441574.1_1 Forward -245 -226 -4.6221 0.253
NP_441467.1_10 Reverse -71 -85 5.89945 0.281
NP_442347.1_2 Forward -110 -101 16.6177 0.056
NP_442645.1_2 Forward -155 -136 -8.85033 0.133
NP_442594.1_8 Reverse -324 -343 2.26107 0.295
NP_441633.1_3 Forward -113 -100 6.50913 0.0481
NP_440136.1_2 Reverse -103 -110 3.97235 0.288
NP_442590.1_9 Forward -106 -87 4.22769 0.273
NP_440299.1_1 Forward -115 -102 3.26365 0.251
NP_441799.1_1 Forward -360 -346 8.45543 0.114
NP_441799.1_1 Reverse -373 -387 6.39049 0.174
NP_440256.1_1 Forward -150 -131 -10.3253 0.299
NP_440456.1_8 Forward -37 -23 14.1593 0.257
NP_441559.1_8 Reverse -97 -111 -5.31028 0.259
NP_441559.1_8 Forward -116 -102 -5.80194 0.27
NP_441559.1_8 Reverse -76 -90 -6.39192 0.277
NP_440915.1_6 Forward -283 -269 6.29277 0.0828
NP_442158.1_4 Forward -12 -2 12.6647 0.244
NP_440717.1_3 Forward -108 -94 11.4053 0.23
NP_442785.1_7 Reverse -36 -50 13.0776 0.228
NP_442069.1_7 Forward -337 -318 15.8299 0.201
NP_442866.1_1 Forward -53 -34 -8.35868 0.279
NP_441464.1_2 Reverse -29 -39 17.2863 0.221
NP_441939.1_3 Forward -209 -190 4.916 0.298
NP_441199.1_6 Forward -336 -317 5.89931 0.143
NP_441199.1_6 Reverse -98 -117 2.0644 0.201
NP_442993.1_1 Reverse -201 -217 1.82849 0.0502
NP_442386.1_9 Reverse -137 -146 8.06244 0.209
NP_442386.1_9 Reverse -143 -152 7.57079 0.219
NP_442386.1_9 Reverse -101 -110 4.62087 0.294
NP_440570.1_5 Forward -100 -81 -1.96717 0.277
NP_441750.1_1 Reverse -317 -336 -12.6852 0.3
NP_441340.1_5 Forward -209 -202 3.97235 0.274
NP_442484.1_2 Reverse -133 -152 1.76941 0.226
NP_441248.1_9 Forward -78 -59 16.8132 0.294
NP_441134.1_9 Reverse -23 -42 18.1907 0.193
NP_440586.1_1 Reverse -316 -335 2.45773 0.226
NP_442251.1_6 Reverse -378 -385 9.77388 0.162
NP_440192.1_4 Forward -101 -82 9.78569 0.264
NP_440192.1_5 Forward -205 -186 2.94938 0.295
NP_440969.1_3 Forward -323 -305 6.99988 0.294
NP_439937.1_9 Reverse -77 -94 9.47787 0.0543
NP_439937.1_9 Reverse -125 -142 -3.10843 0.157
NP_439937.1_9 Reverse -76 -93 -10.3849 0.227
NP_439937.1_9 Reverse -190 -207 -14.2198 0.287
NP_441595.1_5 Forward -118 -100 3.65739 0.295
NP_440398.1_2 Reverse -90 -109 5.70265 0.231
NP_440408.1_3 Reverse -248 -267 -1.57384 0.238
NP_440439.1_1 Reverse -99 -112 3.16588 0.119
NP_442239.1_8 Forward -40 -21 4.916 0.288
NP_441789.1_7 Reverse -23 -42 -2.55791 0.257
NP_440316.1_10 Forward -280 -270 7.45319 0.251
NP_441803.1_2 Reverse -97 -116 0.884433 0.243
NP_440139.1_1 Forward -153 -134 0.588665 0.287
NP_441572.1_7 Forward -285 -266 -3.14714 0.207
NP_440267.1_2 Forward -335 -321 7.3738 0.198
NP_442384.1_10 Forward -111 -98 8.18076 0.0685
NP_442384.1_10 Reverse -102 -115 5.42749 0.13
NP_442114.1_8 Reverse -49 -63 5.50552 0.243
NP_440364.1_6 Reverse -137 -150 14.2767 0.275
NP_442572.1_10 Forward -378 -359 16.8552 0.248
NP_442262.1_10 Reverse -202 -209 9.47889 0.187
NP_440163.1_10 Forward -150 -140 12.9597 0.14
NP_440344.1_10 Reverse -131 -148 -8.31929 0.125
NP_440344.1_10 Forward -118 -101 -13.7275 0.293
NP_440531.1_6 Reverse -30 -49 -0.688862 0.218
NP_440487.1_1 Reverse -99 -118 -7.67036 0.296
NP_441335.1_4 Reverse -133 -152 11.2092 0.26
NP_442832.1_3 Forward -393 -374 11.7992 0.291
NP_441965.1_10 Reverse -365 -381 3.59845 0.259
NP_440297.1_9 Forward -152 -142 -0.41329 0.283
NP_442280.1_10 Reverse -134 -152 10.227 0.223
NP_440894.1_10 Forward -116 -97 5.60432 0.228
NP_440999.1_9 Reverse -98 -112 4.42448 0.116
NP_440888.1_2 Forward -111 -97 16.6169 0.00609
NP_440491.1_1 Reverse -251 -270 7.4043 0.268
NP_440491.1_1 Reverse -305 -324 6.42973 0.296
NP_441949.1_6 Reverse -24 -43 14.4533 0.107
NP_441543.1_2 Forward -209 -200 5.99792 0.159
NP_441543.1_2 Reverse -103 -112 4.12963 0.279
NP_442845.1_2 Reverse -354 -368 8.06273 0.195
NP_442845.1_2 Forward -153 -139 7.37441 0.195
NP_441304.1_4 Forward -96 -77 14.7491 0.168
NP_441178.1_5 Reverse -242 -261 8.16093 0.3
NP_441178.1_6 Forward -333 -314 1.86696 0.279
NP_441258.1_2 Forward -34 -16 19.7837 0.12
NP_440982.1_1 Reverse -270 -289 14.0599 0.121
NP_442710.1_7 Forward -76 -57 -5.87721 0.294
NP_442315.1_2 Forward -94 -82 12.822 0.291
NP_443064.1_6 Reverse -102 -112 16.2513 0.0796
NP_442337.1_8 Reverse -310 -329 2.94938 0.217
NP_441462.1_4 Reverse -22 -41 -3.14714 0.197
NP_443062.1_1 Reverse -144 -162 6.69328 0.194
NP_442487.1_5 Forward -164 -145 2.06362 0.3
NP_440516.1_8 Forward -279 -270 -0.590259 0.283
NP_440516.1_8 Forward -147 -138 -0.68859 0.297
NP_440128.1_10 Forward -32 -13 17.5024 0.126
NP_442428.1_5 Forward -110 -103 9.57722 0.0852
NP_441052.1_2 Reverse -102 -112 7.45319 0.0712
NP_441052.1_2 Forward -111 -101 6.37155 0.0889
NP_441052.1_2 Forward -330 -320 3.81494 0.173
NP_441052.1_2 Reverse -254 -264 1.74999 0.229
NP_441052.1_2 Reverse -218 -228 1.06167 0.252
NP_442219.1_8 Reverse -98 -117 7.20077 0.275
NP_442219.1_9 Forward -110 -101 2.16301 0.284
NP_440436.1_4 Forward -110 -101 5.40752 0.204
NP_440436.1_4 Reverse -378 -387 3.93256 0.294
NP_441884.1_9 Reverse -351 -370 -22.42 0.278
NP_440648.1_6 Reverse -184 -203 9.93006 0.174
NP_441004.1_1 Reverse -317 -336 -9.53865 0.209
NP_442813.1_4 Forward -106 -87 -0.983855 0.236
NP_442366.1_3 Reverse -346 -364 -1.06249 0.204
NP_442366.1_3 Reverse -101 -119 -5.78238 0.296
NP_442694.1_4 Forward -98 -89 13.9627 0.217
NP_441851.1_10 Reverse -101 -111 5.38824 0.214
NP_441851.1_10 Forward -112 -102 4.60159 0.259
NP_442856.1_7 Forward -272 -253 -3.24547 0.242
NP_442856.1_7 Reverse -93 -112 -5.31042 0.276
NP_441683.1_7 Forward -147 -128 -11.7019 0.284
NP_440593.1_3 Reverse -97 -116 -3.83545 0.242
NP_442843.1_1 Reverse -369 -388 -4.81876 0.239
NP_441124.1_5 Forward -22 -12 13.1036 0.215
NP_441124.1_5 Forward -179 -169 12.7217 0.215
NP_440588.1_2 Forward -120 -101 -6.09707 0.269
NP_442243.1_1 Forward -370 -352 -2.83317 0.297
NP_441078.1_4 Forward -111 -102 7.27622 0.0764
NP_441078.1_4 Reverse -102 -111 0.393051 0.205
NP_441078.1_4 Forward -210 -201 -1.47524 0.266
NP_442729.1_8 Reverse -98 -111 9.75405 0.125
NP_440707.1_9 Reverse -318 -337 8.45592 0.219
NP_440793.1_1 Forward -60 -46 8.94708 0.295
NP_441732.1_2 Forward -115 -99 -15.4778 0.147
NP_441030.1_6 Reverse -136 -155 12.8515 0.23
NP_442157.1_8 Forward -335 -316 15.4366 0.218
NP_440760.1_1 Reverse -102 -121 -15.3402 0.146
NP_440760.1_1 Forward -210 -191 -17.8968 0.205
NP_442797.1_7 Reverse -125 -143 3.3624 0.234
NP_441945.1_10 Forward -210 -191 7.47261 0.284
NP_441945.1_10 Forward -153 -134 6.58763 0.299
NP_442353.1_4 Forward -323 -304 1.37531 0.248
NP_442727.1_1 Forward -99 -85 14.0609 0.237
NP_441072.1_8 Forward -147 -128 3.44104 0.271
NP_442489.1_7 Reverse -102 -111 0.688044 0.152
NP_442489.1_7 Forward -111 -102 0.491382 0.178
NP_440559.1_1 Forward -209 -200 5.01461 0.161
NP_440786.1_5 Reverse -81 -100 17.7974 0.178
NP_441022.1_1 Reverse -58 -67 12.8891 0.222
NP_440363.1_9 Reverse -90 -108 15.5554 0.187
NP_442913.1_7 Forward -120 -104 16.3807 0.279
NP_442913.1_10 Forward -162 -143 -2.16383 0.182
NP_440545.1_3 Forward -115 -98 -6.05768 0.268
NP_440545.1_5 Forward -151 -134 4.56207 0.244
NP_442934.1_1 Forward -242 -223 17.6007 0.224
NP_442900.1_5 Reverse -66 -85 15.2408 0.0772
NP_442603.1_7 Forward -111 -97 9.24208 0.153
NP_442603.1_7 Reverse -354 -368 9.04542 0.158
NP_441948.1_4 Forward -96 -78 -2.43913 0.166
NP_441833.1_4 Reverse -378 -385 11.0522 0.0559
NP_441112.1_6 Reverse -85 -104 -2.85214 0.296
NP_440671.1_4 Forward -153 -139 8.06273 0.204
NP_442140.1_3 Reverse -202 -212 3.71661 0.283
NP_442723.1_1 Reverse -12 -31 1.76863 0.292
NP_440875.1_9 Forward -109 -99 7.39866 0.267
NP_441813.1_5 Reverse -199 -209 5.28991 0.138
NP_440594.1_8 Forward -385 -372 7.39353 0.285
NP_441259.1_4 Reverse -23 -42 20.7473 0.0396
NP_440590.1_4 Forward -209 -196 11.229 0.0216
NP_440590.1_4 Reverse -103 -116 8.57408 0.0435
NP_440590.1_4 Forward -110 -97 2.87088 0.0788
NP_442497.1_1 Reverse -78 -97 9.7334 0.256
NP_440821.1_4 Reverse -100 -110 5.87989 0.104
NP_441239.1_9 Reverse -136 -148 8.39711 0.134
NP_441239.1_9 Forward -155 -143 7.4138 0.161
NP_441239.1_9 Reverse -268 -280 7.31547 0.165
NP_440665.1_2 Forward -97 -78 -4.52377 0.246
NP_442044.1_1 Reverse -97 -116 -13.6686 0.277
NP_442193.1_1 Forward -153 -135 14.9655 0.187
NP_443035.1_10 Reverse -370 -387 19.1151 0.174
NP_440546.1_4 Forward -386 -376 10.3369 0.109
NP_440462.1_6 Reverse -100 -110 6.46988 0.115
NP_441474.1_1 Forward -340 -321 -2.16459 0.272
NP_442402.1_10 Reverse -82 -92 13.5492 0.2
NP_442402.1_10 Reverse -81 -91 13.1559 0.204
NP_441848.1_4 Forward -25 -9 10.4154 0.253
NP_440696.1_3 Forward -108 -90 -2.83245 0.279
NP_441811.1_8 Forward -117 -103 11.5043 0.218
NP_440753.1_5 Reverse -116 -135 8.35759 0.283
NP_442837.1_3 Forward -110 -103 10.1672 0.0935
NP_442053.1_1 Reverse -102 -111 5.40793 0.187
NP_440505.1_3 Reverse -199 -209 7.05986 0.165
NP_441701.1_3 Forward -145 -128 14.1002 0.191
NP_441701.1_3 Forward -156 -139 6.13536 0.294
NP_440914.1_1 Reverse -102 -112 11.5428 0.0887
NP_440914.1_1 Reverse -138 -148 9.98138 0.164
NP_441011.1_8 Forward -110 -101 10.6195 0.101
NP_442533.1_1 Reverse -317 -336 0.491109 0.134
NP_442533.1_1 Reverse -251 -270 -8.06369 0.201
NP_442533.1_1 Forward -45 -26 -10.3253 0.231
NP_442533.1_1 Reverse -305 -324 -14.6519 0.247
NP_442533.1_1 Forward -41 -22 -15.8318 0.257
NP_442533.1_1 Reverse -318 -337 -16.4218 0.268
NP_442533.1_6 Forward -111 -102 6.68623 0.105
NP_442533.1_6 Reverse -144 -153 6.48957 0.109
NP_442533.1_6 Reverse -102 -111 4.91628 0.165
NP_442533.1_6 Reverse -270 -279 2.16301 0.27
NP_442541.1_10 Reverse -27 -41 2.16228 0.265
NP_442322.1_4 Forward -338 -321 -7.92662 0.286
NP_442322.1_4 Reverse -86 -103 -9.99156 0.297
NP_441482.1_7 Reverse -195 -209 -4.32697 0.147
NP_439944.1_9 Forward -385 -375 10.3048 0.0887
NP_441697.1_5 Forward -75 -56 -11.0297 0.29
NP_442351.1_3 Forward -142 -123 5.80098 0.211
NP_440116.1_8 Forward -209 -190 -7.27704 0.225
NP_440007.1_9 Reverse -140 -154 12.1926 0.163
NP_440007.1_9 Forward -283 -269 4.91614 0.267
NP_439965.1_1 Forward -156 -137 -8.752 0.277
NP_441680.1_4 Reverse -88 -107 7.47261 0.167
NP_441602.1_3 Forward -116 -97 1.27776 0.215
NP_441972.1_5 Forward -152 -133 -4.13045 0.206
NP_441106.1_1 Reverse -376 -385 4.52295 0.219
NP_441420.1_1 Forward -112 -93 -5.9004 0.297
NP_440429.1_6 Reverse -110 -129 17.699 0.253
NP_441286.1_1 Forward -112 -100 -4.87757 0.18
NP_440670.1_8 Forward -210 -201 5.01461 0.175
NP_440670.1_8 Reverse -201 -210 4.22796 0.202
NP_440886.1_7 Reverse -101 -111 7.45273 0.093
NP_440886.1_7 Reverse -269 -279 5.87944 0.158
NP_440886.1_7 Reverse -137 -147 4.20782 0.249
NP_440828.1_1 Reverse -128 -147 0.785326 0.259
NP_442614.1_2 Reverse -96 -110 7.86607 0.262
NP_442072.1_9 Forward -112 -94 -14.2388 0.137
NP_440513.1_4 Forward -47 -28 8.06259 0.295
NP_440907.2_8 Forward -110 -100 6.86274 0.144
NP_441205.1_5 Forward -187 -168 16.3215 0.274
NP_440107.1_2 Forward -146 -127 8.84924 0.299
NP_442794.1_1 Forward -115 -103 7.02048 0.152
NP_442794.1_1 Reverse -134 -146 6.33216 0.185
NP_442794.1_1 Reverse -197 -209 5.64384 0.212
NP_440387.1_1 Forward -111 -95 -2.20308 0.147
NP_440387.1_1 Reverse -102 -118 -4.46469 0.187
NP_441488.1_7 Forward -117 -98 4.03102 0.2
NP_441993.1_1 Forward -203 -184 5.65007 0.198
NP_441993.1_1 Forward -40 -21 5.45515 0.201
NP_441993.1_1 Forward -277 -258 3.79838 0.228
NP_441993.1_1 Forward -289 -270 1.75177 0.27
NP_441993.1_1 Reverse -323 -342 1.16703 0.284
NP_442805.1_5 Forward -342 -323 -4.52452 0.269
NP_442743.1_5 Forward -152 -133 15.4374 0.0862
NP_442930.1_1 Forward -18 -8 12.1726 0.239
NP_442930.1_1 Reverse -9 -19 12.1726 0.239
NP_442867.1_8 Forward -103 -84 4.71934 0.277
NP_440457.1_1 Forward -283 -271 8.79043 0.101
NP_442680.1_5 Forward -191 -172 -0.123152 0.277
NP_440801.1_8 Reverse -101 -120 -1.86883 0.283
NP_442297.1_3 Reverse -96 -115 12.6833 0.193
NP_441984.1_3 Reverse -21 -39 6.41066 0.269
NP_441332.1_6 Reverse -269 -279 14.1639 0.158
NP_440473.1_9 Reverse -366 -385 -4.42544 0.18
NP_442509.1_9 Forward -111 -101 15.4175 0.0165
NP_442509.1_9 Forward -88 -78 7.45273 0.219
NP_440554.1_4 Reverse -202 -212 3.22496 0.239
NP_441885.1_5 Forward -210 -200 7.55152 0.0511
NP_441885.1_5 Reverse -102 -112 1.74999 0.0991
NP_441885.1_5 Forward -111 -101 -0.609952 0.215
NP_442341.1_7 Reverse -101 -115 14.9459 0.0256
NP_442341.1_7 Forward -112 -98 3.34284 0.227
NP_442341.1_7 Reverse -200 -214 2.5562 0.252
NP_442341.1_9 Forward -155 -141 5.21053 0.277
NP_442341.1_9 Reverse -93 -107 4.91554 0.287
NP_441173.1_9 Reverse -84 -92 11.3271 0.226
NP_441173.1_9 Reverse -83 -91 11.3271 0.226
NP_441173.1_9 Forward -167 -159 9.85212 0.275
NP_442395.2_4 Reverse -137 -156 1.37531 0.244
NP_440423.1_6 Forward -218 -199 -17.4051 0.232
NP_440076.1_5 Reverse -314 -333 12.88 0.252
NP_441902.1_3 Forward -141 -131 12.6902 0.236
NP_441122.1_1 Forward -151 -136 5.87976 0.28
NP_439962.1_4 Forward -106 -87 -5.50708 0.28
NP_442495.1_4 Forward -43 -33 12.3697 0.229
NP_442495.1_5 Reverse -127 -146 7.7676 0.291
NP_441105.1_3 Reverse -127 -146 -9.93197 0.298
NP_440216.1_1 Forward -111 -97 -11.1118 0.163
NP_440216.1_9 Reverse -370 -379 12.9794 0.213
NP_440216.1_9 Reverse -40 -49 11.3078 0.269
NP_440172.1_1 Reverse -102 -112 2.43831 0.279
NP_442015.1_10 Reverse -98 -111 7.78743 0.0782
NP_442015.1_10 Forward -115 -102 -0.964025 0.289
NP_440416.1_9 Forward -118 -99 -19.1751 0.27
NP_443052.1_9 Reverse -23 -42 -4.91709 0.262
NP_443052.1_9 Forward -333 -314 -6.68705 0.287
NP_440820.2_3 Forward -347 -328 24.483 0.0227
NP_440820.2_4 Forward -368 -349 21.3373 0.0171
NP_440820.2_7 Forward -296 -277 24.0905 0.00733
NP_440591.1_9 Reverse -322 -340 4.05072 0.293
NP_442154.1_1 Forward -41 -23 -17.2871 0.251
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTGGTACGACTTTCAGCGATCTTTTCCATGCCCCGATGCAGATAACCAATCACCGGTTCACAGTCCACCACGTCCTCCCCATCCAGGGTCACAATCAAACGTAACACCCCGTGCATAGACGGGTGATGGGGCCCCATGTTGAGCACCATTGGTTCGGTTCTGGTTTCAATCTTGGTCATACCCGGTTAACTGCTATCGGCAGAGATGTGGTGTGGTTTTAATGAGAAAATCTCTTTAGCAAATCATATGGCATGGCCATTGGGGAGGCAAGGCGGCATTACTGCTCTTTGGTGATCCCCGCCGGCCTTTTGGGGGAAACCGGCCTACAATATTCAAAGTTTTGTTGTTTTGCTTCCAATGGGCTGGAGCGGGGTGTGGTTTGAAAAATTTTTCTGGTGGC

CDS

ATGAAAAAATTAACGTCCTTTCCCTTCCCTTTATTCAAGTTATTCAAATCTCTTAAGTCTTCTAAAAGTTTTTCTTTTCAGGCGATCGCCGGCCGTTGGCCGATGTCCCGTAAATGGGCATTAATGCTAATTCCCCTCGCTTCCATTGGTACTATTCCTCTGTTGTTGGCTTGGAGTGGTTATGGGGAAGACCCCAATGCCATCGCCAATGGCAAAACTAATAGCGGTACCGAAGTAATGGCCGACATGGCCGGGGAAGAATTGATTAAAACCCTGCCGCCCCTGAGCCAAATTCCCTCCCCTCCTGGTTCTCCGGCTTCGGGCTTAAAAAGTCCCCGTCCCATCACTGCCGAAAATTTAGCGAAAAGTGCCCCGGCAACCCCCACTGGGCCAGCGGGTAATATTTCAAATCGTGCTGTTACATTCCCGGCACTTGGGAACAGCGCCCCTGTTCAAAATACCAATACCGCTTCGGTTCCATCTGCCCCGCAATCCCCAGCCTCCGGTAGTCCCCAAACAGCTCCAGCACCGCCCCCCATGGCCAGTCCAGTGGACTACACTCCCCCACCGTTGGAAATTCGGGTCGGCATTCAAAGAGATGTACCCAGTGTGGCGATCGCCGTTTCCAGTCAAGGATATCTCCAGGACCGCCAAGGCCAAGGGCTGATGAGTCTCAATGCTGGCCAAGGAATTAACGTCACTGCCCAAGGTAACAGTCTCCTGATTAACGGTCGTTCTGTTCCCGGCGTAGTCTGGTTTACGGCCGACGCCAATGGTTACCTGGCCGTAGGCGATCGTTGGTACCGGGGACGGGTGTTGTTAGTGCCCAGGGGCGACAAGGTTTTGGCAGTCAACTACGTCAACTTAGAACATTATCTAACCAGTGTAGTCGGTAGCGAAATGCACTCCACCGCCCCCACCGAAGCCCTCAAAGCCCAGGCGATCGCCGCCCGTTCCTATGCCCTGGTCCATATGGTACGCCCCGCCAGCCAGTGGTTTGACCTGGGGGATACCCAAAGATGGCAAGTTTATAAGGGCATCGGCAGTGAGCAGGGCCCTTCCCACAATGCTGTTACTTCCACCCTCGGCCAGGTGTTGAGCCATAACGGTGGTGTGGTGGAATCCCTCTATGCTTCTACGGATGAAATTGTGGCCCGGGTACATAAGGGGAGGGGCATGAGCCAGTATGGAGCCTACGACCTAGCCCGTCAGGGTTATAACTATCAGCAAATTCTCAATCGTTACTATCCTGGGGTGGAAGTGGCTCGGGTAGTGTTAAAAAACTGA

Protein

MKKLTSFPFPLFKLFKSLKSSKSFSFQAIAGRWPMSRKWALMLIPLASIGTIPLLLAWSGYGEDPNAIANGKTNSGTEVMADMAGEELIKTLPPLSQIPSPPGSPASGLKSPRPITAENLAKSAPATPTGPAGNISNRAVTFPALGNSAPVQNTNTASVPSAPQSPASGSPQTAPAPPPMASPVDYTPPPLEIRVGIQRDVPSVAIAVSSQGYLQDRQGQGLMSLNAGQGINVTAQGNSLLINGRSVPGVVWFTADANGYLAVGDRWYRGRVLLVPRGDKVLAVNYVNLEHYLTSVVGSEMHSTAPTEALKAQAIAARSYALVHMVRPASQWFDLGDTQRWQVYKGIGSEQGPSHNAVTSTLGQVLSHNGGVVESLYASTDEIVARVHKGRGMSQYGAYDLARQGYNYQQILNRYYPGVEVARVVLKN