Your browser is old and dusty. Try Google Chrome!

Details for sll0248

ORF sll0248
Accession NP_441267.1
Symbol isiB
Category Soluble electron carriers
Definition flavodoxin
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -129 -143 1.47456 0.188
NP_441061.1_2 Forward -213 -199 0.786239 0.199
NP_440795.1_7 Forward -136 -129 14.6904 0.0123
NP_440795.1_7 Reverse -129 -136 14.6904 0.0123
NP_441418.1_6 Forward -137 -118 -19.9617 0.0997
NP_442657.1_5 Forward -180 -166 16.1356 0.269
NP_440815.1_2 Reverse -197 -211 10.2254 0.265
NP_442291.1_5 Reverse -127 -143 10.5799 0.0434
NP_441453.1_4 Reverse -128 -136 16.539 0.00633
NP_441453.1_4 Forward -137 -129 16.539 0.00633
NP_442151.1_6 Forward -137 -123 18.1908 0.00782
NP_441818.1_1 Forward -136 -125 9.79292 0.232
NP_441818.1_1 Reverse -129 -140 8.80962 0.277
NP_441818.1_9 Reverse -110 -129 -9.63698 0.291
NP_441818.1_9 Forward -165 -146 -10.522 0.295
NP_442173.1_1 Forward -136 -128 15.4574 0.00633
NP_442173.1_1 Reverse -129 -137 15.4574 0.00633
NP_442752.1_4 Forward -137 -130 13.8055 0.0199
NP_442752.1_4 Reverse -128 -135 13.8055 0.0199
NP_443027.1_4 Forward -139 -129 13.2547 0.0521
NP_443027.1_4 Reverse -116 -126 8.73149 0.191
NP_441812.1_3 Reverse -127 -141 9.83269 0.228
NP_442975.1_10 Reverse -124 -138 10.5204 0.0541
NP_442975.1_10 Forward -141 -127 3.24392 0.26
NP_440784.1_7 Forward -136 -129 15.9687 0.0123
NP_440784.1_7 Reverse -129 -136 15.9687 0.0123
NP_442909.1_7 Forward -136 -122 13.8636 0.12
NP_442000.2_10 Reverse -97 -115 7.98396 0.286
NP_442000.2_10 Reverse -241 -259 6.01734 0.286
NP_440061.1_9 Reverse -126 -140 13.7653 0.076
NP_440061.1_9 Forward -139 -125 12.782 0.0922
NP_442062.1_8 Forward -137 -127 17.3846 0.00193
NP_442062.1_8 Reverse -128 -138 10.3048 0.0493
NP_441900.1_2 Forward -111 -93 -3.81647 0.288
NP_440304.1_4 Forward -139 -129 10.8948 0.051
NP_440304.1_4 Reverse -197 -207 6.27322 0.167
NP_440304.1_4 Reverse -126 -136 1.84832 0.299
NP_442242.1_4 Forward -136 -129 14.3954 0.0124
NP_442242.1_4 Reverse -129 -136 14.3954 0.0124
NP_440044.1_8 Forward -136 -117 3.34271 0.132
NP_441781.1_7 Forward -367 -348 -0.39387 0.257
NP_439918.1_2 Reverse -73 -92 -4.81876 0.287
NP_441208.1_9 Reverse -125 -139 15.9292 0.0731
NP_440370.1_10 Reverse -119 -138 14.8474 0.094
NP_442110.1_7 Reverse -132 -146 9.63603 0.0715
NP_442110.1_7 Forward -137 -123 0.786239 0.248
NP_441083.1_5 Forward -137 -127 20.3345 0.00053
NP_441083.1_5 Reverse -128 -138 11.2881 0.0159
NP_442827.1_8 Reverse -120 -139 8.65176 0.0792
NP_441738.1_2 Forward -135 -128 15.28 0.0102
NP_441738.1_2 Reverse -130 -137 15.28 0.0102
NP_441558.1_5 Forward -139 -120 14.1591 0.0522
NP_440209.1_1 Reverse -128 -136 18.1123 0.00295
NP_440209.1_1 Forward -137 -129 18.1123 0.00295
NP_442889.1_8 Forward -140 -126 11.4053 0.0733
NP_441713.1_1 Reverse -122 -141 -7.4737 0.13
NP_440178.1_7 Reverse -127 -146 -11.6036 0.0968
NP_440178.1_7 Forward -138 -119 -22.125 0.255
NP_442570.1_3 Reverse -120 -139 -5.21209 0.241
NP_441716.1_1 Forward -137 -123 15.9292 0.0451
NP_442111.1_4 Reverse -127 -141 11.0127 0.0518
NP_442111.1_4 Forward -138 -124 7.07942 0.105
NP_440906.1_5 Forward -136 -129 15.8704 0.0124
NP_440906.1_5 Reverse -129 -136 15.8704 0.0124
NP_440747.1_10 Reverse -125 -137 14.9853 0.00221
NP_440747.1_10 Forward -140 -128 7.4138 0.00422
NP_441847.1_3 Reverse -103 -121 15.7521 0.109
NP_441130.1_10 Reverse -126 -140 7.57108 0.155
NP_441486.1_1 Reverse -125 -139 6.19444 0.0344
NP_441486.1_1 Forward -140 -126 6.09611 0.0344
NP_442634.1_4 Forward -139 -125 -1.96703 0.149
NP_440403.1_4 Reverse -119 -138 1.86774 0.131
NP_440403.1_4 Forward -130 -111 0.196116 0.144
NP_441014.1_10 Reverse -173 -192 -1.67294 0.263
NP_442848.1_1 Reverse -122 -136 8.84938 0.0791
NP_443018.1_3 Forward -136 -129 14.8871 0.0123
NP_443018.1_3 Reverse -129 -136 14.8871 0.0123
NP_443018.1_3 Forward -256 -249 7.6106 0.156
NP_443018.1_3 Forward -126 -119 4.26735 0.267
NP_443018.1_3 Reverse -119 -126 4.07068 0.299
NP_441634.1_8 Forward -139 -125 -3.63866 0.295
NP_441634.1_8 Reverse -126 -140 -3.93365 0.295
NP_441634.1_8 Forward -352 -338 -4.22864 0.295
NP_440376.1_1 Forward -137 -128 19.4693 0.000692
NP_440376.1_1 Reverse -128 -137 19.4693 0.000692
NP_441857.1_5 Reverse -121 -139 11.9172 0.185
NP_441588.1_4 Forward -135 -125 8.92815 0.14
NP_442687.1_7 Forward -138 -128 9.02648 0.0994
NP_442687.1_7 Reverse -127 -137 8.92815 0.0994
NP_442485.1_7 Forward -119 -100 21.2381 0.141
NP_442958.1_3 Forward -148 -129 8.65258 0.142
NP_440642.1_10 Forward -389 -375 3.24392 0.277
NP_441013.1_2 Forward -132 -114 -2.14413 0.282
NP_441013.1_2 Reverse -117 -135 -4.40575 0.298
NP_441422.1_7 Forward -139 -122 -2.81276 0.223
NP_442658.1_1 Forward -139 -129 14.2375 0.0237
NP_442658.1_1 Forward -129 -119 11.9759 0.0662
NP_442658.1_1 Reverse -197 -207 7.25606 0.214
NP_442658.1_1 Reverse -126 -136 6.76441 0.214
NP_442205.1_9 Forward -143 -127 6.45005 0.113
NP_440656.1_8 Forward -148 -129 -6.09707 0.239
NP_442544.1_6 Forward -144 -125 -8.06369 0.298
NP_441414.1_9 Reverse -128 -147 4.42435 0.0543
NP_441414.1_9 Forward -137 -118 -9.93197 0.272
NP_442937.1_5 Reverse -123 -142 6.19431 0.286
NP_441958.1_5 Forward -138 -128 21.2195 0.000805
NP_441958.1_5 Reverse -127 -137 12.2714 0.00183
NP_442836.1_5 Reverse -122 -141 7.17762 0.169
NP_440203.1_5 Forward -134 -124 13.3526 0.116
NP_439905.1_1 Reverse -129 -142 11.819 0.204
NP_440984.1_7 Forward -142 -128 11.996 0.122
NP_439990.1_5 Reverse -123 -136 12.3107 0.114
NP_439990.1_8 Forward -258 -239 1.0811 0.283
NP_442911.1_2 Forward -147 -128 -3.54046 0.114
NP_440153.1_5 Reverse -129 -143 12.1926 0.0658
NP_440153.1_5 Forward -136 -122 3.04785 0.219
NP_441591.1_10 Forward -139 -120 8.65258 0.232
NP_442119.1_6 Reverse -126 -145 11.9958 0.12
NP_443055.1_3 Reverse -119 -138 18.6664 0.0456
NP_443055.1_3 Forward -146 -127 18.0934 0.0489
NP_442236.1_3 Forward -163 -144 11.6025 0.183
NP_440471.1_6 Forward -130 -111 16.7157 0.239
NP_440602.1_2 Reverse -123 -142 5.40766 0.254
NP_440138.1_6 Reverse -129 -148 0.785326 0.292
NP_441099.1_5 Forward -147 -128 -11.0136 0.27
NP_441294.1_7 Reverse -124 -138 13.6661 0.0583
NP_441294.1_7 Forward -141 -127 9.82656 0.223
NP_440411.1_10 Reverse -70 -89 11.9207 0.26
NP_441646.1_1 Reverse -121 -140 2.85105 0.211
NP_442438.1_10 Reverse -123 -137 0.0979218 0.239
NP_442431.1_10 Forward -219 -201 8.37728 0.149
NP_441000.1_6 Reverse -127 -141 -4.13031 0.227
NP_440147.1_4 Reverse -126 -139 18.4072 0.00407
NP_440147.1_4 Forward -139 -126 10.344 0.0355
NP_441550.1_8 Forward -139 -129 15.8108 0.0132
NP_441550.1_8 Reverse -126 -136 14.6309 0.0132
NP_441916.1_7 Reverse -128 -138 18.9579 0.00144
NP_441916.1_7 Forward -137 -127 10.3048 0.0261
NP_441916.1_10 Reverse -197 -216 12.5858 0.122
NP_440206.1_4 Forward -147 -128 -2.26292 0.295
NP_441041.1_4 Forward -137 -118 -0.39387 0.0954
NP_441041.1_4 Reverse -122 -141 -12.2919 0.262
NP_441041.1_7 Forward -140 -128 7.32042 0.169
NP_442396.1_5 Reverse -46 -59 12.3107 0.0913
NP_440569.1_10 Reverse -227 -246 3.38954 0.278
NP_442004.1_6 Forward -238 -224 9.14437 0.14
NP_442004.1_6 Forward -137 -123 8.75105 0.14
NP_441725.1_4 Forward -142 -128 3.73557 0.278
NP_441725.1_5 Forward -136 -126 2.04498 0.115
NP_441725.1_5 Reverse -129 -139 1.94665 0.115
NP_439966.1_7 Forward -139 -129 14.3359 0.0203
NP_439966.1_7 Reverse -126 -136 7.25606 0.15
NP_442941.1_3 Reverse -129 -139 19.2529 0.00262
NP_442941.1_3 Forward -136 -126 11.0914 0.0116
NP_440289.1_2 Forward -140 -127 3.26421 0.0811
NP_440289.1_4 Forward -141 -122 10.4225 0.236
NP_440983.1_9 Forward -146 -127 1.67108 0.292
NP_440260.1_8 Reverse -119 -137 -4.8974 0.273
NP_442281.1_1 Forward -142 -128 7.96378 0.089
NP_441334.1_7 Forward -139 -120 -20.5517 0.277
NP_440177.1_1 Reverse -114 -132 5.23069 0.272
NP_442256.1_2 Reverse -126 -144 -1.06249 0.16
NP_442012.1_1 Forward -143 -124 -0.4922 0.259
NP_441556.1_10 Reverse -123 -137 17.2301 0.0842
NP_440498.1_1 Forward -146 -128 -0.177514 0.218
NP_441644.1_6 Reverse -128 -138 19.0557 0.000803
NP_441644.1_6 Forward -137 -127 17.3841 0.00127
NP_441644.1_6 Forward -257 -247 3.71617 0.267
NP_441644.1_6 Forward -127 -117 3.71617 0.267
NP_442029.1_1 Reverse -116 -135 -12.3902 0.247
NP_440929.1_8 Forward -137 -128 19.2726 0.000701
NP_440929.1_8 Reverse -128 -137 19.2726 0.000701
NP_442933.1_10 Forward -137 -128 17.601 0.00325
NP_442933.1_10 Reverse -128 -137 17.601 0.00325
NP_440891.1_8 Forward -50 -31 15.5145 0.233
NP_441751.2_8 Reverse -129 -143 13.9626 0.0133
NP_442554.1_8 Reverse -129 -139 17.2863 0.00543
NP_442554.1_8 Forward -136 -126 15.3197 0.00882
NP_442554.1_8 Forward -126 -116 4.99491 0.163
NP_442554.1_8 Forward -398 -388 3.81494 0.209
NP_441762.1_7 Forward -138 -126 0.530633 0.0747
NP_441762.1_7 Reverse -127 -139 -6.84419 0.284
NP_442142.1_4 Forward -140 -127 3.7553 0.246
NP_442142.1_4 Reverse -125 -138 3.65697 0.248
NP_442292.1_1 Forward -136 -127 18.486 0.00229
NP_442292.1_1 Reverse -129 -138 17.5026 0.00435
NP_440919.1_7 Reverse -44 -62 5.06531 0.286
NP_442476.1_6 Reverse -129 -143 3.34284 0.158
NP_440421.1_1 Reverse -239 -253 14.3559 0.261
NP_441523.1_6 Forward -141 -122 4.52268 0.251
NP_443009.1_5 Reverse -127 -138 14.5128 0.02
NP_443009.1_5 Forward -138 -127 10.1862 0.0792
NP_441715.1_4 Reverse -129 -139 16.7946 0.0106
NP_441715.1_4 Forward -136 -126 7.94484 0.107
NP_440881.1_7 Reverse -180 -199 12.6841 0.257
NP_440158.1_8 Reverse -70 -89 11.9958 0.23
NP_440464.1_10 Forward -136 -126 13.0082 0.169
NP_441468.1_1 Forward -136 -129 15.8704 0.0124
NP_441468.1_1 Reverse -129 -136 15.8704 0.0124
NP_441468.1_1 Forward -126 -119 4.07068 0.263
NP_441015.1_10 Forward -142 -123 -8.06369 0.272
NP_441673.1_1 Forward -137 -128 20.8459 0.000698
NP_441673.1_1 Reverse -128 -137 20.8459 0.000698
NP_441826.1_2 Reverse -122 -136 3.34284 0.111
NP_441764.1_8 Reverse -292 -302 11.5021 0.284
NP_442868.1_6 Forward -139 -129 10.4031 0.038
NP_442868.1_6 Reverse -126 -136 9.81313 0.038
NP_442719.1_2 Forward -59 -41 -10.1096 0.269
NP_441612.1_2 Forward -137 -127 8.54929 0.21
NP_442808.1_1 Forward -138 -128 8.73102 0.0481
NP_442808.1_1 Reverse -127 -137 8.63269 0.0481
NP_442775.1_6 Forward -213 -194 10.8159 0.277
NP_440145.1_3 Reverse -118 -137 6.58763 0.0509
NP_442542.1_2 Reverse -110 -123 6.1158 0.234
NP_442542.1_9 Reverse -192 -206 13.372 0.108
NP_442050.1_5 Forward -139 -129 15.9091 0.0091
NP_442050.1_5 Reverse -126 -136 7.64939 0.243
NP_440601.1_3 Forward -138 -119 11.9958 0.296
NP_441114.1_3 Forward -255 -246 7.27622 0.247
NP_440558.1_2 Forward -211 -192 -6.88371 0.283
NP_441878.1_6 Forward -138 -128 10.5014 0.0176
NP_441878.1_6 Reverse -127 -137 10.4031 0.0176
NP_441036.1_8 Forward -138 -128 15.713 0.00724
NP_441036.1_8 Reverse -127 -137 8.33817 0.174
NP_442650.1_2 Forward -137 -123 6.19444 0.134
NP_441557.1_5 Forward -137 -128 19.9609 0.000699
NP_441557.1_5 Reverse -128 -137 19.9609 0.000699
NP_441445.1_1 Reverse -119 -138 7.47261 0.134
NP_442066.2_9 Forward -141 -128 12.704 0.154
NP_441308.1_8 Reverse -388 -398 8.33817 0.261
NP_441458.1_8 Reverse -7 -26 6.61707 0.236
NP_442183.1_1 Reverse -128 -142 10.9143 0.078
NP_440086.1_2 Forward -237 -218 7.66846 0.29
NP_442135.1_8 Forward -148 -130 11.3272 0.207
NP_442444.1_6 Reverse -382 -400 12.8239 0.267
NP_442347.1_2 Forward -136 -127 12.4878 0.056
NP_442347.1_2 Reverse -129 -138 3.34298 0.284
NP_442645.1_2 Forward -145 -126 -14.5535 0.175
NP_442645.1_2 Reverse -101 -120 -18.2901 0.27
NP_442645.1_2 Forward -139 -120 -20.2567 0.288
NP_442645.1_2 Reverse -120 -139 -22.3217 0.29
NP_441037.1_4 Reverse -126 -136 7.9999 0.237
NP_441037.1_4 Forward -139 -129 7.22024 0.237
NP_440690.1_1 Reverse -381 -400 5.70265 0.291
NP_441633.1_3 Reverse -126 -139 1.10092 0.109
NP_441633.1_3 Forward -139 -126 -3.71729 0.177
NP_440136.1_2 Forward -136 -129 15.9687 0.0123
NP_440136.1_2 Reverse -129 -136 15.9687 0.0123
NP_442998.1_5 Reverse -259 -269 8.92815 0.26
NP_442998.1_5 Reverse -181 -191 8.1415 0.271
NP_442998.1_10 Forward -135 -128 15.5754 0.0102
NP_442998.1_10 Reverse -130 -137 15.5754 0.0102
NP_440899.1_2 Forward -148 -129 6.48849 0.266
NP_440299.1_1 Reverse -124 -137 19.9798 0.00161
NP_440299.1_1 Reverse -114 -127 6.60689 0.136
NP_440299.1_1 Forward -212 -199 6.0169 0.155
NP_441799.1_1 Forward -141 -127 18.4851 0.0085
NP_441799.1_1 Reverse -124 -138 11.7003 0.054
NP_440977.1_1 Reverse -91 -110 0.196116 0.0844
NP_441007.1_10 Forward -142 -129 10.5407 0.0656
NP_442334.1_2 Reverse -108 -125 -4.77938 0.2
NP_442201.1_10 Forward -148 -129 -14.6519 0.285
NP_442333.2_5 Reverse -188 -207 -9.14533 0.246
NP_440256.1_1 Forward -140 -121 -3.63879 0.137
NP_440087.1_1 Forward -146 -127 3.53937 0.167
NP_441559.1_8 Reverse -123 -137 2.65453 0.143
NP_441559.1_8 Forward -142 -128 1.47456 0.155
NP_441559.1_8 Reverse -133 -147 -6.58858 0.279
NP_440915.1_6 Reverse -124 -138 5.01447 0.0943
NP_442158.1_4 Reverse -172 -182 11.1898 0.28
NP_442855.1_3 Forward -146 -127 18.6823 0.095
NP_442785.1_7 Forward -139 -125 20.4524 0.0439
NP_441866.1_5 Forward -43 -26 18.5392 0.273
NP_441704.1_8 Reverse -117 -136 14.0599 0.108
NP_442069.1_4 Forward -138 -119 5.50599 0.254
NP_441464.1_8 Reverse -205 -219 9.43936 0.192
NP_442993.1_1 Reverse -128 -144 -11.0529 0.233
NP_442993.1_1 Forward -399 -383 -13.5111 0.292
NP_442386.1_9 Reverse -127 -136 13.8639 0.0289
NP_442386.1_9 Forward -138 -129 6.39082 0.219
NP_442386.1_9 Forward -128 -119 5.0142 0.27
NP_441404.1_8 Forward -296 -282 16.4202 0.188
NP_441750.1_1 Reverse -139 -158 -9.63698 0.3
NP_441340.1_5 Forward -136 -129 15.6737 0.0124
NP_441340.1_5 Reverse -129 -136 15.6737 0.0124
NP_441340.1_5 Reverse -119 -126 3.97235 0.274
NP_441947.1_4 Reverse -117 -136 17.8957 0.0763
NP_442791.1_5 Reverse -120 -139 -10.0303 0.279
NP_440168.1_9 Forward -148 -129 -3.14714 0.288
NP_441248.1_10 Forward -246 -236 14.3289 0.289
NP_440194.1_3 Reverse -118 -137 3.14605 0.271
NP_440059.1_3 Forward -224 -205 10.3234 0.17
NP_440586.1_8 Forward -136 -129 13.2151 0.026
NP_440586.1_8 Reverse -129 -136 13.2151 0.026
NP_440586.1_8 Reverse -119 -126 9.57686 0.146
NP_440586.1_8 Forward -130 -123 9.18354 0.171
NP_442251.1_6 Forward -136 -129 15.2804 0.0124
NP_442251.1_6 Reverse -129 -136 15.2804 0.0124
NP_441262.1_3 Reverse -128 -135 14.7888 0.0223
NP_441262.1_3 Forward -137 -130 14.7888 0.0223
NP_440027.1_3 Forward -137 -119 17.6196 0.0812
NP_440027.1_3 Forward -147 -129 5.03327 0.249
NP_440027.1_3 Reverse -118 -136 1.69003 0.299
NP_443051.1_1 Forward -138 -129 19.5676 0.00335
NP_443051.1_1 Reverse -127 -136 10.4228 0.00754
NP_439984.1_3 Forward -144 -130 12.0937 0.281
NP_439937.1_9 Forward -138 -121 -15.9897 0.287
NP_440408.1_3 Forward -130 -111 -2.16383 0.246
NP_440408.1_7 Reverse -198 -217 9.93088 0.253
NP_440439.1_1 Forward -140 -127 13.1956 0.0211
NP_440439.1_1 Reverse -125 -138 2.2809 0.136
NP_440372.1_2 Forward -136 -129 16.3621 0.0124
NP_440372.1_2 Reverse -129 -136 16.3621 0.0124
NP_441138.1_5 Forward -299 -286 9.41998 0.238
NP_442511.1_6 Reverse -73 -92 3.73603 0.229
NP_440316.1_10 Reverse -247 -257 5.78156 0.281
NP_441803.1_2 Forward -142 -123 0.982764 0.242
NP_440210.1_10 Forward -122 -103 6.88182 0.296
NP_441572.1_7 Forward -143 -124 -6.49039 0.293
NP_442384.1_10 Forward -137 -124 18.9972 0.00338
NP_442384.1_10 Reverse -128 -141 18.6038 0.00417
NP_441877.1_5 Forward -364 -345 -1.18052 0.283
NP_441877.1_7 Forward -142 -123 1.57197 0.242
NP_441877.1_7 Reverse -117 -136 1.47364 0.242
NP_441018.1_7 Forward -370 -351 6.98095 0.278
NP_442790.1_4 Reverse -119 -138 -9.14533 0.18
NP_442790.1_4 Forward -146 -127 -14.5535 0.278
NP_442262.1_10 Forward -136 -129 14.1988 0.0123
NP_442262.1_10 Reverse -129 -136 14.1988 0.0123
NP_442262.1_10 Forward -256 -249 8.8889 0.219
NP_441689.1_5 Forward -139 -129 8.3377 0.132
NP_441689.1_5 Reverse -126 -136 5.78111 0.197
NP_440344.1_10 Reverse -121 -138 -9.49926 0.147
NP_440282.1_10 Forward -147 -128 -6.78538 0.25
NP_440531.1_6 Forward -145 -126 13.1758 0.0467
NP_440531.1_6 Reverse -120 -139 3.53937 0.144
NP_442910.1_1 Reverse -121 -140 -5.11376 0.254
NP_441965.1_3 Forward -147 -128 6.19431 0.149
NP_441965.1_10 Forward -140 -124 7.82668 0.14
NP_441965.1_10 Reverse -125 -141 6.84337 0.163
NP_442065.1_7 Reverse -119 -137 0.707465 0.288
NP_440297.1_9 Forward -136 -126 -0.118297 0.282
NP_440297.1_9 Reverse -129 -139 -0.216628 0.282
NP_440999.1_9 Forward -141 -127 6.19444 0.101
NP_440999.1_9 Reverse -124 -138 -0.295402 0.203
NP_440888.1_2 Reverse -128 -142 11.602 0.0635
NP_440888.1_2 Forward -137 -123 11.012 0.0783
NP_442892.1_9 Forward -209 -195 13.8636 0.293
NP_440600.1_4 Reverse -120 -138 8.57394 0.067
NP_440600.1_4 Forward -145 -127 6.41066 0.0974
NP_442033.1_10 Forward -139 -120 3.73603 0.086
NP_442033.1_10 Reverse -116 -135 -12.9802 0.279
NP_441949.1_4 Forward -221 -202 10.8159 0.192
NP_441543.1_2 Forward -136 -127 16.9127 0.00359
NP_441543.1_2 Reverse -129 -138 15.9293 0.00518
NP_442845.1_2 Forward -143 -129 6.6861 0.205
NP_442845.1_2 Reverse -122 -136 4.52282 0.258
NP_441319.1_8 Reverse -122 -140 4.83737 0.285
NP_441469.1_8 Forward -138 -129 6.5879 0.227
NP_441469.1_8 Reverse -127 -136 6.48957 0.227
NP_442315.1_2 Reverse -243 -255 13.9036 0.291
NP_443064.1_6 Forward -137 -127 12.5669 0.0796
NP_443064.1_6 Reverse -128 -138 10.8217 0.13
NP_442337.1_8 Forward -361 -342 -0.4922 0.274
NP_442578.1_7 Forward -136 -129 14.5921 0.026
NP_442578.1_7 Reverse -129 -136 14.5921 0.026
NP_440710.1_1 Forward -145 -127 -1.55415 0.182
NP_440148.1_1 Forward -246 -227 -4.52377 0.219
NP_440148.1_1 Forward -32 -13 -5.99873 0.246
NP_441462.1_2 Reverse -128 -138 20.2362 0.000805
NP_441462.1_2 Forward -137 -127 11.5831 0.00406
NP_441929.1_3 Reverse -39 -58 1.0811 0.298
NP_443062.1_1 Reverse -128 -146 11.4711 0.0984
NP_443062.1_6 Reverse -120 -139 1.86774 0.266
NP_442204.1_1 Forward -141 -130 9.49844 0.0759
NP_442204.1_1 Reverse -124 -135 6.94184 0.144
NP_442204.1_5 Forward -319 -300 1.27776 0.24
NP_441560.1_8 Forward -219 -200 11.8049 0.28
NP_441560.1_10 Reverse -120 -139 5.11266 0.298
NP_442487.1_5 Forward -138 -119 13.5683 0.167
NP_440454.1_2 Reverse -286 -300 15.7678 0.164
NP_440516.1_2 Forward -143 -125 14.6705 0.0514
NP_440516.1_2 Reverse -122 -140 14.1788 0.0538
NP_440516.1_8 Forward -137 -128 16.9127 0.00442
NP_440516.1_8 Reverse -128 -137 16.9127 0.00442
NP_442428.1_5 Forward -136 -129 15.8704 0.0124
NP_442428.1_5 Reverse -129 -136 15.8704 0.0124
NP_442428.1_5 Forward -126 -119 4.46401 0.267
NP_441267.1_2 Forward -154 -135 20.2556 0.0395
NP_441267.1_3 Forward -301 -283 22.0444 0.0269
NP_441267.1_4 Forward -365 -347 18.702 0.0577
NP_441267.1_9 Forward -391 -372 20.8447 0.134
NP_440673.1_2 Reverse -118 -137 17.9986 0.0464
NP_440673.1_2 Forward -218 -199 9.02386 0.259
NP_440673.1_3 Forward -135 -128 12.4288 0.0426
NP_440673.1_3 Reverse -130 -137 12.4288 0.0426
NP_440673.1_3 Forward -324 -317 10.5605 0.123
NP_440673.1_3 Forward -255 -248 8.98723 0.203
NP_440673.1_7 Forward -148 -129 4.62101 0.185
NP_441052.1_2 Forward -137 -127 19.9412 0.00106
NP_441052.1_2 Reverse -128 -138 10.4031 0.0285
NP_442219.1_8 Forward -158 -139 9.13344 0.234
NP_442219.1_8 Reverse -118 -137 6.91087 0.282
NP_442219.1_9 Forward -136 -127 17.7976 0.00718
NP_442219.1_9 Reverse -129 -138 8.25953 0.0681
NP_440436.1_4 Forward -136 -127 17.2072 0.00233
NP_440436.1_4 Reverse -119 -128 10.7174 0.0743
NP_440436.1_4 Reverse -129 -138 9.24241 0.0871
NP_441884.1_9 Forward -140 -121 -21.9284 0.272
NP_440314.1_9 Forward -126 -107 -0.4922 0.11
NP_440314.1_9 Reverse -129 -148 -1.27885 0.127
NP_441719.1_4 Forward -136 -129 16.3621 0.0124
NP_441719.1_4 Reverse -129 -136 16.3621 0.0124
NP_442813.1_4 Forward -210 -191 -0.688862 0.23
NP_442813.1_4 Forward -209 -190 -4.72043 0.299
NP_442366.1_5 Reverse -125 -135 17.2858 0.0141
NP_441115.1_4 Reverse -117 -135 10.5398 0.173
NP_441115.1_4 Forward -138 -120 8.47483 0.247
NP_442206.1_7 Reverse -126 -145 11.6025 0.295
NP_442854.1_6 Reverse -128 -147 5.80098 0.238
NP_440328.1_4 Reverse -122 -141 12.5858 0.0513
NP_441228.1_7 Forward -356 -338 17.3823 0.296
NP_443054.1_2 Forward -139 -125 -0.492064 0.295
NP_441851.1_10 Reverse -127 -137 15.8113 0.00552
NP_441851.1_10 Forward -138 -128 8.53483 0.114
NP_442622.1_8 Reverse -128 -146 0.707465 0.0642
NP_442011.1_1 Reverse -127 -146 4.12936 0.232
NP_442515.1_1 Reverse -127 -141 11.3077 0.0416
NP_442515.1_1 Reverse -204 -218 11.0127 0.0431
NP_442515.1_1 Forward -122 -108 -1.08205 0.245
NP_440593.1_9 Forward -353 -339 8.25939 0.261
NP_441349.1_10 Forward -147 -128 10.5209 0.0232
NP_441349.1_10 Reverse -118 -137 -0.000545616 0.0918
NP_441409.1_6 Reverse -122 -141 -10.4236 0.205
NP_440389.1_5 Reverse -338 -357 18.2961 0.156
NP_440432.1_9 Reverse -129 -144 -3.75668 0.19
NP_442843.1_5 Reverse -22 -41 17.0931 0.194
NP_439960.1_8 Reverse -128 -147 11.3075 0.264
NP_440474.1_8 Reverse -129 -143 5.30886 0.251
NP_440431.1_3 Forward -258 -239 -6.1954 0.188
NP_442450.1_5 Reverse -126 -136 7.55152 0.13
NP_440588.1_2 Forward -146 -127 0.0977854 0.149
NP_440195.1_4 Reverse -193 -212 4.12936 0.297
NP_443047.1_7 Reverse -129 -148 5.11266 0.246
NP_441570.1_1 Forward -137 -119 11.4255 0.00774
NP_441570.1_1 Reverse -128 -146 -5.29072 0.0754
NP_440078.1_10 Forward -137 -118 6.39097 0.224
NP_441078.1_4 Forward -137 -128 19.6659 0.0007
NP_441078.1_4 Reverse -128 -137 19.6659 0.0007
NP_440707.1_6 Forward -145 -126 15.8299 0.172
NP_440526.1_3 Forward -136 -125 0.943182 0.267
NP_441432.1_8 Reverse -127 -136 16.8143 0.00595
NP_441432.1_8 Forward -138 -129 16.8143 0.00595
NP_441432.1_8 Reverse -247 -256 12.2911 0.0444
NP_441432.1_8 Reverse -198 -207 5.3096 0.17
NP_441732.1_2 Forward -141 -125 2.91013 0.0145
NP_441732.1_2 Reverse -124 -140 2.22182 0.0253
NP_442003.1_4 Forward -136 -117 11.2092 0.278
NP_440760.1_1 Reverse -128 -147 -11.2103 0.0851
NP_440760.1_1 Forward -137 -118 -15.6352 0.152
NP_440578.1_10 Forward -364 -345 13.0775 0.246
NP_442353.1_4 Reverse -122 -141 16.0265 0.0643
NP_442751.1_2 Forward -129 -110 10.52 0.196
NP_440713.1_4 Reverse -118 -137 16.1257 0.0724
NP_442489.1_7 Forward -137 -128 20.1576 0.000695
NP_442489.1_7 Reverse -128 -137 20.1576 0.000695
NP_440559.1_1 Forward -136 -127 17.4043 0.00658
NP_440559.1_1 Reverse -129 -138 8.65285 0.0586
NP_441659.2_8 Reverse -128 -138 20.9245 0.000805
NP_441659.2_8 Forward -137 -127 18.1713 0.00133
NP_442913.1_10 Forward -146 -127 -0.787193 0.165
NP_442913.1_10 Reverse -119 -138 -3.54046 0.212
NP_441800.1_10 Reverse -109 -128 2.85105 0.252
NP_442346.1_2 Reverse -117 -136 5.30933 0.281
NP_442346.1_2 Forward -148 -129 4.32602 0.289
NP_442346.1_5 Reverse -127 -137 16.6963 0.00248
NP_442346.1_5 Forward -138 -128 16.303 0.00248
NP_442346.1_10 Forward -124 -105 -2.0655 0.294
NP_440545.1_3 Reverse -124 -141 20.3934 0.00708
NP_440545.1_3 Forward -141 -124 -6.84433 0.289
NP_442311.1_5 Reverse -339 -358 0.982764 0.27
NP_442603.1_7 Forward -137 -123 13.077 0.0925
NP_442603.1_7 Reverse -128 -142 6.19383 0.253
NP_441888.1_7 Forward -142 -128 3.8345 0.225
NP_441948.1_4 Reverse -121 -139 0.904127 0.135
NP_441833.1_4 Forward -136 -129 15.9687 0.0124
NP_441833.1_4 Reverse -129 -136 15.9687 0.0124
NP_441112.1_6 Reverse -189 -208 14.1591 0.0651
NP_442162.1_9 Forward -136 -129 16.2637 0.0124
NP_442162.1_9 Reverse -129 -136 16.2637 0.0124
NP_440671.1_4 Reverse -384 -398 8.94771 0.188
NP_442140.1_3 Forward -136 -126 12.2714 0.0632
NP_442140.1_3 Reverse -119 -129 8.63316 0.119
NP_442140.1_3 Reverse -129 -139 4.69992 0.238
NP_442723.1_1 Forward -268 -249 2.55527 0.286
NP_440875.1_2 Reverse -123 -142 11.6025 0.137
NP_440875.1_9 Reverse -130 -140 13.5309 0.0677
NP_440875.1_9 Reverse -115 -125 7.88535 0.255
NP_440875.1_9 Forward -125 -115 6.91198 0.294
NP_441813.1_5 Forward -139 -129 18.1713 0.00743
NP_441813.1_5 Reverse -126 -136 8.63316 0.0367
NP_441813.1_5 Forward -129 -119 -0.609952 0.261
NP_440594.1_8 Reverse -129 -142 9.95012 0.173
NP_440590.1_4 Forward -136 -123 21.4554 0.00401
NP_440590.1_4 Reverse -129 -142 -3.81562 0.255
NP_440590.1_4 Reverse -119 -132 -4.7006 0.265
NP_440567.1_1 Reverse -129 -143 5.21113 0.105
NP_440567.1_1 Reverse -123 -137 -0.393733 0.281
NP_442497.1_10 Reverse -129 -138 17.601 0.00813
NP_442497.1_10 Forward -136 -127 10.4228 0.0087
NP_440821.1_4 Reverse -126 -136 9.41981 0.0286
NP_440821.1_4 Forward -139 -129 2.24165 0.131
NP_441239.1_9 Forward -139 -127 13.0187 0.0389
NP_441239.1_9 Reverse -116 -128 4.07055 0.264
NP_441239.1_9 Reverse -126 -138 3.38223 0.285
NP_441951.1_3 Forward -158 -139 14.7491 0.286
NP_440542.1_2 Forward -27 -10 14.0018 0.223
NP_441727.1_3 Forward -221 -202 8.84924 0.199
NP_441892.1_1 Reverse -119 -136 14.7885 0.032
NP_441892.1_1 Reverse -190 -207 -1.14113 0.198
NP_441892.1_1 Forward -146 -129 -6.15601 0.298
NP_440604.1_6 Reverse -128 -147 -0.885524 0.191
NP_442044.1_1 Reverse -199 -218 -13.7669 0.279
NP_442270.1_9 Reverse -117 -136 -8.94866 0.226
NP_440354.1_5 Reverse -125 -144 1.67108 0.272
NP_440354.1_7 Reverse -112 -130 6.70565 0.278
NP_441617.1_6 Forward -59 -40 7.96426 0.121
NP_440546.1_4 Reverse -128 -138 13.5365 0.0459
NP_440546.1_4 Forward -137 -127 10.046 0.109
NP_440675.1_1 Forward -217 -198 9.24257 0.195
NP_440462.1_6 Forward -139 -129 18.7612 0.00454
NP_440462.1_6 Reverse -126 -136 1.35667 0.294
NP_442340.1_3 Forward -191 -172 -6.49039 0.223
NP_442592.1_3 Forward -162 -143 19.3707 0.109
NP_440868.1_4 Forward -141 -129 19.6068 0.00963
NP_440868.1_4 Reverse -124 -136 8.6921 0.0582
NP_442499.1_3 Forward -128 -110 4.73903 0.289
NP_441269.1_6 Forward -166 -148 15.1621 0.145
NP_440812.1_4 Reverse -347 -366 15.9978 0.198
NP_441084.1_6 Forward -139 -125 14.3859 0.103
NP_440696.1_3 Reverse -118 -136 6.214 0.189
NP_440696.1_3 Forward -137 -119 3.16574 0.211
NP_440696.1_3 Reverse -128 -146 -0.177514 0.241
NP_442039.1_4 Forward -136 -129 15.1821 0.0124
NP_442039.1_4 Reverse -129 -136 15.1821 0.0124
NP_442039.1_7 Reverse -201 -211 14.0414 0.211
NP_441811.1_8 Reverse -122 -136 13.8643 0.175
NP_441926.1_3 Reverse -128 -144 8.02334 0.17
NP_440825.1_7 Forward -136 -126 12.9096 0.152
NP_442837.1_3 Forward -136 -129 15.7721 0.0124
NP_442837.1_3 Reverse -129 -136 15.7721 0.0124
NP_442053.1_1 Forward -137 -128 18.3876 0.0007
NP_442053.1_1 Reverse -128 -137 18.3876 0.0007
NP_440505.1_3 Forward -139 -129 17.188 0.00332
NP_440505.1_3 Reverse -126 -136 9.22315 0.122
NP_442659.1_10 Reverse -110 -129 21.9867 0.0261
NP_442456.1_5 Reverse -99 -117 8.7706 0.26
NP_440520.1_4 Forward -213 -194 18.7807 0.0282
NP_442532.1_7 Forward -127 -113 10.7177 0.154
NP_442532.1_7 Reverse -199 -213 4.42448 0.171
NP_442532.1_7 Reverse -128 -142 2.94952 0.214
NP_441408.2_7 Forward -139 -120 -1.96717 0.262
NP_440914.1_1 Forward -137 -127 17.5935 0.000537
NP_440914.1_1 Reverse -128 -138 16.3248 0.00196
NP_440914.1_1 Reverse -199 -209 10.6645 0.129
NP_440914.1_1 Forward -127 -117 10.079 0.158
NP_441011.1_8 Reverse -129 -138 16.6177 0.00602
NP_441011.1_8 Forward -136 -127 8.25953 0.144
NP_442533.1_6 Forward -137 -128 17.2076 0.00137
NP_442533.1_6 Reverse -128 -137 17.2076 0.00137
NP_442533.1_6 Reverse -390 -399 1.37636 0.3
NP_441482.1_7 Forward -143 -129 -4.62196 0.153
NP_441482.1_7 Reverse -122 -136 -8.35854 0.193
NP_439944.1_9 Forward -136 -126 10.5014 0.0887
NP_439944.1_9 Reverse -129 -139 9.12481 0.1
NP_441028.1_6 Forward -389 -379 4.7978 0.277
NP_440116.1_5 Reverse -125 -142 4.46374 0.196
NP_441527.1_4 Reverse -278 -297 -2.0535 0.153
NP_440115.1_6 Forward -140 -130 13.0581 0.0818
NP_440115.1_6 Reverse -125 -135 8.33817 0.13
NP_440007.1_9 Reverse -386 -400 1.27789 0.289
NP_442716.1_5 Forward -263 -244 18.9101 0.152
NP_440608.1_6 Forward -136 -117 3.04693 0.292
NP_441972.1_5 Forward -136 -117 -6.09707 0.228
NP_441106.1_1 Forward -138 -129 18.486 0.0028
NP_441106.1_1 Forward -128 -119 10.8161 0.0311
NP_441106.1_1 Reverse -127 -136 9.63616 0.0311
NP_441106.1_1 Reverse -198 -207 2.26134 0.293
NP_439903.1_6 Forward -140 -121 2.55527 0.225
NP_442306.1_10 Forward -142 -123 -19.1751 0.197
NP_441286.1_1 Reverse -127 -139 5.93884 0.0258
NP_441286.1_1 Forward -138 -126 3.48056 0.0467
NP_442674.1_2 Forward -283 -264 8.65258 0.249
NP_440670.1_8 Forward -137 -128 18.3876 0.000699
NP_440670.1_8 Reverse -128 -137 18.3876 0.000699
NP_442908.1_1 Reverse -33 -52 1.37609 0.277
NP_440886.1_7 Forward -138 -128 8.04271 0.0805
NP_440886.1_7 Reverse -127 -137 7.94438 0.0805
NP_442614.1_2 Forward -137 -123 6.29277 0.291
NP_442072.1_9 Reverse -127 -145 -21.5153 0.209
NP_440907.2_8 Reverse -129 -139 9.616 0.103
NP_440907.2_8 Forward -136 -126 7.64939 0.117
NP_442264.1_2 Forward -218 -201 6.13536 0.267
NP_441626.1_2 Forward -136 -129 15.7721 0.0124
NP_441626.1_2 Reverse -129 -136 15.7721 0.0124
NP_442211.1_3 Reverse -187 -206 6.79116 0.299
NP_442365.1_7 Reverse -124 -143 10.8159 0.0723
NP_442794.1_1 Reverse -124 -136 12.4287 0.0721
NP_441962.1_4 Reverse -123 -142 -13.9635 0.28
NP_440387.1_1 Reverse -128 -144 15.9882 0.00482
NP_440387.1_1 Forward -137 -121 4.0901 0.0471
NP_440855.1_1 Forward -133 -114 0.392778 0.24
NP_441431.1_2 Forward -140 -126 15.6336 0.045
NP_441488.1_7 Forward -143 -124 7.47261 0.125
NP_441488.1_8 Reverse -123 -137 11.2087 0.146
NP_441836.1_2 Forward -143 -124 -1.37718 0.217
NP_441193.1_6 Reverse -59 -78 1.17943 0.285
NP_440467.1_10 Reverse -134 -147 18.8988 0.194
NP_440114.1_10 Reverse -128 -142 16.6175 0.0165
NP_440114.1_10 Forward -399 -385 7.47274 0.235
NP_442437.1_3 Reverse -130 -149 11.3067 0.207
NP_441510.2_7 Reverse -199 -213 12.8803 0.28
NP_440287.1_6 Reverse -119 -138 9.24257 0.151
NP_441272.1_7 Forward -201 -191 13.5497 0.257
NP_441237.1_9 Forward -136 -126 14.828 0.0242
NP_442930.1_1 Forward -48 -38 11.4843 0.258
NP_440457.1_1 Forward -141 -129 1.21895 0.244
NP_440457.1_1 Reverse -124 -136 0.137309 0.25
NP_442940.1_2 Forward -137 -118 -1.08219 0.296
NP_440798.1_6 Reverse -249 -262 1.10092 0.234
NP_442297.1_4 Reverse -313 -332 12.0434 0.291
NP_441436.1_8 Reverse -127 -146 12.4875 0.243
NP_440473.1_1 Forward -140 -121 11.9323 0.261
NP_440473.1_9 Forward -148 -129 4.52268 0.0931
NP_442509.1_9 Forward -137 -127 8.14104 0.192
NP_442509.1_9 Reverse -128 -138 8.04271 0.192
NP_441489.1_3 Forward -253 -239 14.9084 0.196
NP_441496.1_1 Reverse -233 -247 16.6272 0.265
NP_442936.1_10 Forward -51 -37 8.21112 0.269
NP_442514.1_10 Forward -143 -124 5.80098 0.273
NP_441159.1_8 Forward -301 -282 0.883656 0.236
NP_440554.1_4 Reverse -129 -139 17.9746 0.0131
NP_440554.1_4 Reverse -119 -129 5.78156 0.132
NP_441845.1_5 Reverse -186 -205 17.6268 0.159
NP_441885.1_5 Forward -137 -127 20.9245 0.000538
NP_441885.1_5 Reverse -128 -138 11.3864 0.00668
NP_440478.1_10 Reverse -126 -140 7.76774 0.257
NP_442341.1_7 Forward -138 -124 9.2427 0.0751
NP_442341.1_9 Forward -139 -125 18.7801 0.015
NP_441173.1_9 Forward -55 -47 10.2454 0.261
NP_440423.1_6 Forward -145 -126 -17.6018 0.232
NP_443000.1_7 Forward -139 -129 20.3345 0.00223
NP_443000.1_7 Reverse -126 -136 10.3048 0.0345
NP_440507.2_3 Forward -163 -144 8.55343 0.252
NP_440275.1_3 Forward -139 -129 16.1063 0.0155
NP_440275.1_3 Reverse -126 -136 8.04317 0.0602
NP_442932.1_9 Reverse -339 -358 17.0107 0.14
NP_440149.1_8 Forward -137 -118 -4.72043 0.213
NP_441105.1_3 Forward -148 -129 0.0977854 0.13
NP_441105.1_3 Reverse -117 -136 -6.58872 0.236
NP_440216.1_1 Reverse -128 -142 8.25939 0.0061
NP_440216.1_1 Forward -137 -123 -9.24352 0.145
NP_440216.1_9 Forward -182 -173 6.39124 0.289
NP_440216.1_9 Forward -324 -315 5.50626 0.292
NP_440172.1_1 Reverse -128 -138 17.5813 0.00421
NP_440172.1_1 Forward -137 -127 15.0247 0.00945
NP_440172.1_1 Reverse -390 -400 1.74999 0.299
NP_442015.1_10 Reverse -124 -137 20.2755 0.00366
NP_442015.1_10 Forward -141 -128 4.05085 0.178
NP_441226.1_7 Forward -136 -129 14.4934 0.0123
NP_441226.1_7 Reverse -129 -136 14.4934 0.0123
NP_441111.1_7 Forward -136 -128 18.7023 0.00294
NP_441111.1_7 Reverse -129 -137 18.7023 0.00294
NP_442379.1_10 Forward -144 -127 -1.63279 0.223
NP_441766.1_2 Forward -137 -128 17.5026 0.00297
NP_441766.1_2 Reverse -128 -137 17.5026 0.00297
NP_440416.1_9 Reverse -121 -140 -15.5368 0.193
NP_440416.1_9 Forward -209 -190 -18.5851 0.26
NP_443052.1_9 Forward -158 -139 -6.68705 0.287
NP_440261.1_2 Forward -150 -131 18.584 0.126
NP_440261.1_5 Reverse -129 -142 5.13249 0.0476
NP_440261.1_5 Forward -136 -123 -4.40561 0.147
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TAGCCATCAGCTTTTCCTCTCTTAAGCAAGCATCGGGGTTTACTTTGCCTAGCTCTGCCAGCCTGAAATTAAGACTCCATTGCTAAGTAACGGTAAACCTCTTTTCTTTTTATTACCTTGCCTAAGTTAATGAATTTTCACTCTCCCATTGCCTAAAAAATTATGGATCATCCTCACACTTGTTTGTGCTGTTGCCATTGTCTTTTGCGGCATTTACACCAAGGAAATTTAGTTTGGTATTGCTGTCAGTGTCGCCAGATGCAGGCGATCGCCAACGATGGCATCAGTCCCCTTTCCTTCAACACTTCGGAACTACTAAACCAAGCCCTACTTAACGGTTAAGGGTTTCCCAAAATTATTTCCACGAAAACAAATTAAGCTTAGTAACTTTCCAGTAATC

CDS

ATGACAAAAATTGGACTTTTTTACGGTACTCAAACCGGCAACACTGAAACCATTGCTGAACTGATTCAAAAAGAAATGGGCGGCGATAGTGTGGTCGATATGATGGATATATCCCAGGCTGATGTTGATGATTTTAGGCAATATAGTTGCCTGATTATCGGTTGTCCCACCTGGAATGTGGGGGAACTCCAGAGTGATTGGGAAGGCTTTTATGACCAATTAGACGAAATTGATTTTAATGGCAAAAAAGTAGCCTATTTTGGTGCTGGCGATCAGGTTGGTTATGCAGATAATTTTCAAGACGCCATGGGCATTTTAGAAGAAAAAATCAGTGGATTAGGCGGTAAAACAGTGGGGTTTTGGCCCACCGCTGGCTATGATTTTGACGAATCAAAAGCGGTGAAAAATGGGAAATTTGTTGGTTTAGCTTTGGACGAAGATAATCAGCCAGAGTTAACAGAATTAAGAGTAAAGACATGGGTAAGTGAAATTAAACCAATTTTGCAATCCTAG

Protein

MTKIGLFYGTQTGNTETIAELIQKEMGGDSVVDMMDISQADVDDFRQYSCLIIGCPTWNVGELQSDWEGFYDQLDEIDFNGKKVAYFGAGDQVGYADNFQDAMGILEEKISGLGGKTVGFWPTAGYDFDESKAVKNGKFVGLALDEDNQPELTELRVKTWVSEIKPILQS