Your browser is old and dusty. Try Google Chrome!

Details for sll0230

ORF sll0230
Accession NP_440026.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -162 -176 2.85119 0.17
NP_441061.1_2 Forward -323 -309 1.17956 0.193
NP_441061.1_2 Reverse -116 -130 -0.197071 0.223
NP_440557.1_1 Reverse -116 -135 13.9625 0.0669
NP_441418.1_6 Forward -93 -74 -30.2865 0.267
NP_440815.1_5 Reverse -268 -287 3.34271 0.286
NP_441623.1_1 Forward -396 -378 -0.964162 0.239
NP_442877.1_3 Reverse -313 -332 14.5516 0.146
NP_441818.1_1 Reverse -325 -336 10.5796 0.232
NP_440226.1_1 Forward -333 -314 3.53937 0.221
NP_440348.1_6 Forward -294 -275 4.916 0.245
NP_443027.1_4 Reverse -318 -328 8.23984 0.215
NP_441812.1_3 Forward -334 -320 13.4709 0.167
NP_440784.1_7 Forward -123 -116 4.16902 0.277
NP_441250.1_3 Forward -389 -370 2.55606 0.272
NP_440061.1_9 Forward -379 -365 5.30886 0.29
NP_440110.1_4 Reverse -163 -182 1.37609 0.288
NP_441054.1_2 Forward -371 -352 9.93088 0.284
NP_442062.1_8 Reverse -320 -330 5.78156 0.152
NP_442062.1_8 Forward -183 -173 3.32329 0.275
NP_440761.1_9 Forward -264 -245 12.5858 0.195
NP_441802.1_1 Forward -122 -103 8.16093 0.224
NP_440044.1_8 Forward -332 -313 -3.63879 0.288
NP_439918.1_2 Reverse -35 -54 1.47442 0.215
NP_439918.1_2 Reverse -41 -60 -0.197208 0.227
NP_441200.1_4 Forward -187 -168 8.16093 0.257
NP_441619.1_8 Forward -277 -263 6.68548 0.295
NP_440518.1_3 Reverse -271 -290 11.7983 0.196
NP_442110.1_7 Reverse -115 -129 12.8809 0.0586
NP_441082.1_10 Forward -282 -269 9.85238 0.237
NP_440300.1_1 Forward -61 -42 11.0117 0.218
NP_440856.1_7 Forward -378 -359 -9.34199 0.287
NP_440655.1_6 Reverse -133 -152 8.94757 0.262
NP_440447.1_1 Forward -129 -111 5.62401 0.194
NP_441770.1_4 Reverse -292 -311 -6.1954 0.22
NP_440178.1_7 Forward -295 -276 -15.8318 0.163
NP_442570.1_3 Forward -280 -261 -3.44213 0.219
NP_442848.1_5 Reverse -261 -279 5.32902 0.265
NP_442848.1_5 Forward -131 -113 -0.472507 0.276
NP_442848.1_9 Reverse -66 -85 11.9958 0.144
NP_443018.1_3 Forward -188 -181 10.2655 0.107
NP_443065.1_5 Reverse -296 -315 20.1573 0.0428
NP_442687.1_7 Forward -75 -65 4.89658 0.23
NP_441797.1_8 Forward -351 -332 20.7473 0.0688
NP_441422.1_3 Reverse -79 -98 17.4179 0.14
NP_441855.2_7 Reverse -17 -36 14.8474 0.282
NP_441414.1_6 Forward -94 -75 5.40766 0.13
NP_440800.1_7 Reverse -273 -287 11.111 0.28
NP_440203.1_5 Forward -375 -365 8.63269 0.29
NP_441338.2_5 Reverse -369 -388 13.3725 0.192
NP_441338.2_5 Forward -372 -353 10.6192 0.247
NP_442690.1_1 Forward -250 -231 -8.35868 0.187
NP_442911.1_1 Forward -251 -238 15.627 0.271
NP_440153.1_8 Reverse -65 -78 2.37923 0.215
NP_442064.1_4 Reverse -111 -130 10.9134 0.192
NP_442536.1_8 Reverse -288 -307 11.3075 0.272
NP_443055.1_6 Reverse -380 -398 -0.178247 0.254
NP_440993.1_4 Reverse -285 -302 9.57695 0.216
NP_440993.1_4 Reverse -179 -196 2.89044 0.298
NP_440138.1_1 Forward -50 -32 7.19654 0.227
NP_440615.1_7 Reverse -174 -193 18.9882 0.113
NP_441348.1_3 Reverse -294 -313 16.2241 0.135
NP_442431.1_10 Forward -276 -258 0.412472 0.275
NP_441292.1_2 Forward -85 -66 -10.3253 0.292
NP_441175.1_7 Reverse -231 -250 7.17762 0.239
NP_441916.1_7 Forward -329 -319 1.74999 0.275
NP_441916.1_10 Forward -132 -113 0.982764 0.27
NP_440345.1_5 Reverse -236 -250 14.525 0.276
NP_441041.1_4 Reverse -309 -328 3.44104 0.065
NP_440569.1_6 Reverse -282 -301 1.47442 0.288
NP_442004.1_6 Forward -329 -315 3.14618 0.248
NP_440703.1_9 Reverse -66 -79 10.7368 0.192
NP_441725.1_5 Reverse -116 -126 -1.19994 0.294
NP_439966.1_7 Forward -172 -162 8.63269 0.132
NP_439966.1_7 Forward -126 -116 4.99446 0.248
NP_440736.1_3 Reverse -289 -308 -1.08219 0.282
NP_441678.1_9 Reverse -141 -160 2.85105 0.221
NP_442281.1_1 Forward -134 -120 3.34225 0.235
NP_442012.1_1 Forward -189 -170 -1.08219 0.274
NP_443030.1_4 Forward -67 -48 -6.58872 0.288
NP_442029.1_1 Forward -86 -67 -12.0953 0.242
NP_440929.1_8 Reverse -115 -124 4.42462 0.187
NP_442554.1_8 Forward -396 -386 4.0116 0.2
NP_442554.1_8 Reverse -66 -76 2.33998 0.274
NP_442142.1_4 Forward -336 -323 3.95196 0.239
NP_442381.1_8 Reverse -321 -340 -13.3736 0.271
NP_440730.1_4 Forward -323 -304 -2.0655 0.28
NP_441448.1_2 Reverse -349 -368 -1.18128 0.271
NP_440464.1_10 Reverse -347 -357 11.8623 0.275
NP_441015.1_10 Forward -188 -169 -6.39206 0.248
NP_441339.1_4 Reverse -114 -133 -5.70374 0.28
NP_441956.1_9 Reverse -272 -291 6.39097 0.274
NP_442808.1_1 Reverse -267 -277 1.94622 0.281
NP_441849.1_3 Forward -58 -39 15.6332 0.177
NP_441114.1_3 Reverse -67 -76 7.66954 0.231
NP_441114.1_3 Forward -48 -39 7.37455 0.239
NP_440558.1_2 Reverse -62 -81 0.0977854 0.194
NP_440558.1_2 Forward -192 -173 -1.67217 0.217
NP_440558.1_2 Forward -133 -114 -2.0655 0.222
NP_440558.1_2 Forward -327 -308 -2.65548 0.229
NP_441878.1_6 Reverse -64 -74 0.766681 0.134
NP_441878.1_6 Forward -75 -65 0.57002 0.14
NP_441878.1_6 Reverse -387 -397 -7.78811 0.266
NP_441878.1_6 Reverse -386 -396 -7.78811 0.266
NP_441036.1_8 Reverse -389 -399 5.5849 0.271
NP_442650.1_2 Reverse -309 -323 4.52282 0.169
NP_441445.1_1 Forward -83 -64 8.06259 0.122
NP_441590.1_4 Reverse -61 -80 4.91521 0.279
NP_442183.1_1 Reverse -161 -175 6.48943 0.171
NP_440547.1_1 Reverse -358 -377 7.07848 0.294
NP_442590.1_10 Forward -81 -62 6.29264 0.246
NP_442998.1_5 Reverse -312 -322 9.41981 0.241
NP_440299.1_1 Reverse -61 -74 2.37867 0.291
NP_442333.2_5 Reverse -263 -282 -15.6352 0.299
NP_440709.1_1 Reverse -232 -251 13.2733 0.045
NP_441559.1_8 Reverse -116 -130 -6.68692 0.279
NP_441559.1_8 Reverse -338 -352 -7.17857 0.287
NP_440997.1_6 Reverse -315 -334 16.2241 0.108
NP_440026.1_2 Forward -285 -266 20.4523 0.133
NP_440026.1_4 Forward -77 -58 18.584 0.203
NP_440026.1_6 Forward -333 -314 23.4997 0.0367
NP_440026.1_7 Forward -194 -179 15.1229 0.239
NP_441750.1_1 Forward -22 -3 -9.44032 0.3
NP_441947.1_10 Reverse -113 -131 2.37909 0.276
NP_440327.1_6 Reverse -29 -48 5.99764 0.249
NP_442240.1_2 Forward -332 -313 -18.5851 0.293
NP_440586.1_8 Forward -188 -181 9.08521 0.178
NP_440586.1_8 Forward -73 -66 5.8403 0.283
NP_442251.1_6 Reverse -325 -332 10.4622 0.12
NP_440027.1_3 Reverse -65 -83 15.2596 0.101
NP_440027.1_3 Forward -130 -112 6.90155 0.22
NP_440027.1_4 Reverse -94 -113 30.2505 0.000191
NP_439937.1_9 Reverse -64 -81 -7.72996 0.165
NP_441138.1_5 Reverse -26 -39 3.97694 0.297
NP_442511.1_6 Reverse -41 -60 3.83436 0.229
NP_441803.1_2 Forward -188 -169 2.55606 0.209
NP_441803.1_2 Reverse -315 -334 -0.197208 0.269
NP_442384.1_10 Reverse -65 -78 4.05085 0.17
NP_441018.1_7 Forward -281 -262 14.4541 0.119
NP_441018.1_7 Reverse -111 -130 10.8159 0.194
NP_442262.1_10 Forward -188 -181 9.18389 0.211
NP_442262.1_10 Forward -182 -175 7.6106 0.274
NP_440531.1_6 Forward -285 -266 -4.32711 0.279
NP_441640.1_8 Forward -188 -169 0.58944 0.187
NP_440297.1_9 Forward -73 -63 0.668351 0.282
NP_440297.1_9 Reverse -181 -191 0.0783647 0.282
NP_440297.1_9 Reverse -66 -76 -0.118297 0.282
NP_442280.1_1 Reverse -298 -317 5.80098 0.204
NP_442280.1_10 Reverse -117 -135 5.06482 0.291
NP_441592.1_4 Reverse -262 -281 -3.83545 0.29
NP_440894.1_10 Forward -86 -67 2.45773 0.29
NP_439969.1_1 Forward -90 -71 -5.40875 0.288
NP_439969.1_3 Reverse -175 -194 -1.7705 0.283
NP_441543.1_3 Reverse -266 -280 13.4703 0.163
NP_442845.1_2 Reverse -314 -328 4.52282 0.258
NP_443064.1_6 Reverse -343 -353 10.2399 0.166
NP_442337.1_8 Forward -283 -264 2.0644 0.221
NP_442337.1_8 Reverse -110 -129 -0.39387 0.273
NP_442337.1_8 Forward -284 -265 -1.57384 0.286
NP_440710.1_1 Forward -159 -141 -6.66736 0.226
NP_443062.1_1 Forward -329 -311 4.45062 0.26
NP_441423.1_5 Forward -246 -233 18.9965 0.18
NP_442780.1_3 Forward -251 -232 12.8432 0.185
NP_442120.1_10 Reverse -168 -187 -11.8986 0.265
NP_440865.1_9 Reverse -378 -397 -2.0655 0.182
NP_442219.1_9 Reverse -54 -63 3.04799 0.206
NP_440436.1_4 Forward -165 -156 6.39082 0.162
NP_441321.1_5 Reverse -377 -396 4.81767 0.265
NP_442366.1_3 Reverse -323 -341 -2.53746 0.229
NP_442366.1_3 Reverse -160 -178 -3.32411 0.246
NP_443054.1_2 Forward -172 -158 6.6861 0.185
NP_440508.1_2 Forward -248 -229 13.2896 0.281
NP_442001.1_4 Forward -58 -39 10.3234 0.264
NP_441668.1_4 Reverse -378 -397 9.43923 0.121
NP_440593.1_3 Reverse -169 -188 -5.40875 0.259
NP_440432.1_9 Forward -396 -381 3.22482 0.0967
NP_442843.1_1 Reverse -292 -311 -8.85033 0.264
NP_441124.1_5 Reverse -237 -247 13.9631 0.215
NP_440943.1_5 Forward -332 -318 18.6825 0.163
NP_442006.1_2 Reverse -285 -302 -16.8741 0.265
NP_442006.1_2 Reverse -75 -92 -18.939 0.296
NP_441003.1_9 Forward -303 -284 5.211 0.266
NP_442729.1_5 Forward -75 -65 8.4365 0.248
NP_442729.1_5 Forward -190 -180 7.74818 0.271
NP_441539.1_1 Forward -251 -237 12.782 0.284
NP_441663.1_6 Forward -285 -266 15.4374 0.213
NP_441663.1_6 Forward -92 -73 14.9458 0.234
NP_441663.1_8 Forward -316 -297 -3.14714 0.276
NP_442443.1_1 Forward -269 -250 -5.60541 0.282
NP_441432.1_8 Reverse -368 -377 11.9961 0.0519
NP_441732.1_2 Forward -187 -171 -16.9527 0.223
NP_440629.1_4 Reverse -73 -92 10.6192 0.238
NP_442815.1_2 Reverse -310 -328 4.14905 0.244
NP_442797.1_6 Forward -328 -309 9.29156 0.246
NP_441805.1_5 Reverse -197 -216 14.1583 0.0883
NP_440281.1_7 Forward -86 -69 15.8701 0.261
NP_439956.1_7 Reverse -110 -129 3.34271 0.257
NP_440708.1_6 Forward -281 -262 -6.39206 0.234
NP_442346.1_5 Forward -75 -65 14.1397 0.0164
NP_440025.1_1 Forward -337 -318 5.89931 0.279
NP_440459.1_2 Forward -83 -66 8.59364 0.254
NP_440671.1_4 Forward -189 -175 13.4709 0.0806
NP_441239.1_9 Forward -399 -387 6.43049 0.189
NP_441239.1_9 Reverse -63 -75 4.5622 0.251
NP_441892.1_1 Forward -83 -66 -4.09106 0.255
NP_442643.1_7 Reverse -109 -128 3.6377 0.287
NP_440354.1_5 Forward -303 -284 3.14605 0.239
NP_442138.1_9 Reverse -262 -281 11.995 0.202
NP_440546.1_4 Forward -74 -64 10.2399 0.109
NP_443033.1_3 Forward -396 -377 9.83255 0.268
NP_440675.1_1 Forward -274 -255 3.24438 0.252
NP_440675.1_10 Forward -83 -64 17.109 0.191
NP_440675.1_10 Forward -165 -146 11.7992 0.256
NP_440462.1_6 Reverse -318 -328 1.35667 0.294
NP_440080.2_2 Forward -298 -284 20.2201 0.0512
NP_440868.1_4 Reverse -320 -332 0.0389777 0.234
NP_442479.1_9 Forward -249 -230 -4.81876 0.265
NP_440653.1_10 Reverse -309 -328 5.89931 0.22
NP_440696.1_3 Reverse -111 -129 2.67408 0.215
NP_440696.1_3 Forward -333 -315 2.28076 0.216
NP_440696.1_3 Reverse -18 -36 -1.75081 0.265
NP_442039.1_4 Reverse -116 -123 12.2322 0.049
NP_441811.1_8 Forward -335 -321 12.291 0.209
NP_441926.1_3 Reverse -121 -137 3.79511 0.208
NP_440825.1_6 Reverse -18 -37 12.0942 0.252
NP_442696.1_6 Reverse -264 -283 -12.1936 0.251
NP_441760.1_4 Forward -283 -265 6.70565 0.291
NP_440160.1_2 Reverse -141 -160 -7.67036 0.286
NP_442053.1_1 Reverse -388 -397 5.01461 0.213
NP_441203.1_1 Forward -73 -54 -17.7001 0.297
NP_440914.1_1 Reverse -269 -279 7.73678 0.224
NP_441011.1_8 Forward -332 -323 5.80125 0.227
NP_442533.1_6 Forward -74 -65 4.62128 0.179
NP_442533.1_6 Forward -170 -161 3.24465 0.219
NP_442541.1_10 Forward -130 -116 5.01387 0.248
NP_441219.1_6 Reverse -284 -302 17.2271 0.0986
NP_441482.1_7 Forward -130 -116 -11.3085 0.254
NP_440007.1_4 Reverse -321 -340 10.5209 0.251
NP_439965.1_1 Reverse -334 -353 -5.70374 0.211
NP_441544.1_1 Reverse -118 -130 17.9352 0.196
NP_441602.1_3 Forward -222 -203 3.53937 0.174
NP_441930.1_3 Reverse -241 -260 12.3837 0.198
NP_441463.1_3 Reverse -284 -303 -2.55715 0.156
NP_441463.1_3 Forward -343 -324 -3.04881 0.167
NP_442209.1_4 Forward -297 -278 7.47261 0.299
NP_441962.1_4 Reverse -310 -329 -8.85033 0.208
NP_441993.1_1 Forward -294 -275 4.28566 0.222
NP_440814.1_8 Reverse -309 -328 14.3558 0.137
NP_442324.1_7 Reverse -95 -114 6.72632 0.268
NP_440293.1_9 Reverse -162 -176 10.7645 0.261
NP_440766.1_5 Forward -121 -109 6.70087 0.294
NP_442942.1_7 Forward -83 -64 5.211 0.275
NP_440801.1_8 Reverse -78 -97 -0.688862 0.273
NP_441984.1_3 Forward -140 -122 12.1139 0.172
NP_441436.1_6 Forward -333 -314 8.94757 0.26
NP_442737.1_5 Reverse -329 -348 17.242 0.11
NP_442341.1_5 Reverse -67 -86 10.7175 0.297
NP_442341.1_7 Reverse -173 -187 4.62115 0.185
NP_441561.1_8 Forward -185 -166 17.2269 0.282
NP_440091.1_1 Reverse -320 -332 7.51213 0.081
NP_443010.1_10 Forward -173 -156 2.38426 0.277
NP_442451.1_2 Forward -316 -297 -7.17871 0.232
NP_442451.1_2 Forward -178 -159 -7.57203 0.237
NP_442638.1_3 Forward -120 -101 17.4269 0.209
NP_442918.1_6 Reverse -135 -154 18.7269 0.163
NP_440175.1_7 Reverse -111 -129 11.5101 0.23
NP_440175.1_7 Forward -282 -264 8.48479 0.297
NP_441105.1_3 Forward -299 -280 -7.96535 0.263
NP_441105.1_3 Forward -194 -175 -8.26035 0.269
NP_441105.1_3 Forward -135 -116 -8.752 0.278
NP_440216.1_9 Forward -128 -119 13.1761 0.205
NP_440216.1_9 Reverse -182 -191 5.89959 0.289
NP_440047.1_7 Forward -93 -74 5.01433 0.292
NP_442371.1_1 Reverse -375 -385 11.8776 0.273
NP_440167.1_3 Reverse -305 -324 9.73422 0.247
NP_442015.1_10 Reverse -117 -130 1.9859 0.204
NP_443052.1_8 Reverse -314 -333 0.294447 0.0669
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TACCGCCCTCGGCCCATTTTTCCGTGAATGCCTCCGTGGTAATTTGGGGCGGAACCACGTGCAAAATCGTGATCGATGCCTTTTGCACCGCCGGAAAGTCCATCATGGCCTTGAGCATTTCTTGGGTTTGGCTGGTGCCAGAATCTGCGTATAAAATTTTGCTAAGCATGATAATTGAGTTCCTTGAATCGGTTCAGGGAGAGTCTCACCGTGCCATGGAGATTGATAACGGCAAGCCCTCCTCGGTTAAGCCTTATCCCTTCAGAATAAGGCCAATGCAAGCGCAGAAATTTAACGACTTGTTGCGGACTTTCTCAGCCTTGGTGGGCCATGGTTCTAGGGAACTCCTAACCCAATACCCATATCAACAGCTAACCTGCCCCTCCAATTGACGGCAGGA

CDS

GTGTGTCAAAATCTAGGGAAATTTGAGATTGTCGTCAGCCATTACCGACGAGTAAAAGCTATGAACGTGATTGTGGATTTATGTGTTGTGCCCCTGGGTGTGGGGGTTTCCGTGGGTCAGTATGTGGCCGCTTGCCAGAAAGTACTGGCCGAAGCGGGGCTGAAACATACCATGCATGCCTACGGCACCAACATTGAAGGGGATTGGGACGAAGTTTTTGCCGCAGTTAAGGCTTGCCATGAAGCTGTCCATGCCCTGGGAGCCCCCCGCATCACTTCCAGCATGCGTTTTGGTACCCGCACTGATCGCCCCCAAACCATGGATGAAAAGGTGAAAAGTGTGGAAACATGGCTGGAAAATTCTTAG

Protein

MCQNLGKFEIVVSHYRRVKAMNVIVDLCVVPLGVGVSVGQYVAACQKVLAEAGLKHTMHAYGTNIEGDWDEVFAAVKACHEAVHALGAPRITSSMRFGTRTDRPQTMDEKVKSVETWLENS