Your browser is old and dusty. Try Google Chrome!

Details for sll0227

ORF sll0227
Accession NP_440031.1
Symbol ppiB
Category Protein modification and translation factors
Definition peptidyl-prolyl cis-trans isomerase B, periplasmic protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -202 -188 1.96621 0.179
NP_440897.1_6 Forward -394 -375 3.83357 0.142
NP_441623.1_1 Forward -257 -239 -4.40575 0.274
NP_442151.1_6 Forward -30 -16 6.3911 0.236
NP_440348.1_6 Forward -247 -228 3.44104 0.267
NP_440996.1_1 Forward -74 -55 21.8024 0.0234
NP_442173.1_3 Reverse -292 -302 16.303 0.196
NP_442752.1_4 Reverse -296 -303 7.90559 0.144
NP_442000.2_10 Forward -159 -141 10.6389 0.167
NP_440061.1_9 Forward -307 -293 7.66879 0.198
NP_440061.1_9 Forward -396 -382 7.47213 0.205
NP_441859.1_2 Reverse -369 -388 14.0599 0.178
NP_441859.1_3 Forward -350 -331 2.6536 0.258
NP_440304.1_4 Forward -38 -28 6.46988 0.155
NP_440304.1_4 Reverse -25 -35 3.81494 0.292
NP_442268.1_3 Reverse -144 -163 16.0265 0.248
NP_441352.1_2 Forward -264 -245 4.71934 0.209
NP_441208.1_9 Forward -397 -383 4.52282 0.299
NP_441083.1_5 Reverse -385 -395 5.09324 0.125
NP_441083.1_5 Forward -394 -384 -0.0199663 0.251
NP_441434.1_1 Forward -107 -93 14.1444 0.233
NP_441434.1_1 Forward -66 -52 9.56081 0.24
NP_441955.1_10 Reverse -256 -270 17.4042 0.243
NP_440447.1_6 Reverse -341 -359 4.05072 0.181
NP_441713.1_1 Reverse -343 -362 -13.9635 0.257
NP_442570.1_3 Reverse -253 -272 7.27595 0.143
NP_442462.1_2 Forward -160 -141 9.3409 0.172
NP_441792.1_1 Forward -189 -170 8.35759 0.171
NP_441533.1_1 Forward -93 -74 15.5357 0.221
NP_440851.1_6 Reverse -368 -385 8.10198 0.263
NP_440747.1_10 Reverse -382 -394 -2.71429 0.0639
NP_441486.1_1 Forward -206 -192 -4.81863 0.209
NP_441014.1_10 Forward -204 -185 5.99684 0.178
NP_440376.1_1 Forward -358 -349 5.99792 0.111
NP_440376.1_1 Reverse -27 -36 4.0313 0.182
NP_440376.1_1 Reverse -280 -289 1.96635 0.236
NP_442687.1_7 Reverse -348 -358 6.56821 0.159
NP_442485.1_3 Reverse -183 -202 4.52268 0.179
NP_441846.1_10 Reverse -268 -287 -13.9635 0.216
NP_441846.1_10 Forward -263 -244 -23.2067 0.279
NP_440642.1_10 Forward -279 -265 8.75042 0.198
NP_440360.1_5 Reverse -176 -195 -4.91709 0.297
NP_440141.1_8 Reverse -104 -123 7.57094 0.238
NP_440662.1_2 Forward -256 -237 -3.44213 0.276
NP_442782.1_2 Reverse -336 -350 4.42448 0.254
NP_442496.1_5 Reverse -114 -132 6.214 0.284
NP_442205.1_9 Reverse -113 -129 -3.8747 0.297
NP_442937.1_5 Reverse -159 -178 11.8975 0.126
NP_442937.1_5 Reverse -291 -310 6.39097 0.28
NP_441127.1_1 Reverse -113 -127 12.1926 0.215
NP_442836.1_5 Reverse -21 -40 2.94938 0.248
NP_441201.1_2 Reverse -273 -292 17.8957 0.104
NP_442690.1_1 Reverse -350 -369 -10.7186 0.218
NP_442911.1_2 Forward -258 -239 -6.78538 0.192
NP_440993.1_4 Forward -203 -186 4.95539 0.269
NP_442438.1_10 Forward -253 -239 4.22782 0.15
NP_441916.1_10 Reverse -186 -205 -0.000545616 0.294
NP_440174.1_2 Reverse -94 -113 11.6025 0.276
NP_440569.1_7 Forward -173 -154 15.6341 0.177
NP_440569.1_7 Forward -311 -292 9.43923 0.286
NP_439966.1_7 Forward -351 -341 4.99446 0.248
NP_440202.1_8 Reverse -287 -306 11.7516 0.272
NP_440202.1_10 Forward -384 -365 17.3057 0.21
NP_441514.1_6 Reverse -300 -307 12.8221 0.252
NP_442281.1_1 Forward -399 -385 12.5853 0.0358
NP_442500.1_9 Forward -157 -138 14.6508 0.236
NP_440375.1_8 Forward -393 -374 -1.57384 0.288
NP_441644.1_6 Forward -394 -384 5.78111 0.176
NP_442215.1_2 Reverse -12 -28 -4.07137 0.227
NP_442177.1_5 Forward -32 -18 7.57108 0.297
NP_442029.1_6 Reverse -331 -350 3.14605 0.283
NP_442926.1_1 Reverse -284 -303 -4.03212 0.278
NP_442554.1_8 Reverse -386 -396 9.22315 0.0617
NP_442313.1_3 Forward -388 -369 6.58763 0.258
NP_442142.1_4 Forward -302 -289 7.19687 0.144
NP_442292.1_1 Reverse -386 -395 3.7363 0.192
NP_440158.1_8 Reverse -282 -301 9.73422 0.264
NP_440183.1_9 Forward -297 -278 -19.9617 0.282
NP_440183.1_9 Forward -201 -182 -19.9617 0.282
NP_440379.1_5 Forward -398 -379 -5.60541 0.224
NP_441758.1_10 Forward -108 -89 0.883656 0.197
NP_441015.1_8 Forward -167 -148 3.53937 0.272
NP_441393.1_9 Reverse -370 -389 17.9755 0.266
NP_441637.1_9 Forward -129 -111 -1.45582 0.292
NP_442719.1_2 Forward -129 -111 -10.8963 0.284
NP_440031.1_1 Forward -253 -234 29.7937 0.000246
NP_440031.1_2 Forward -307 -288 23.0089 0.00798
NP_440031.1_3 Forward -361 -342 25.1722 0.0148
NP_440031.1_4 Forward -391 -372 29.3012 0.000113
NP_440031.1_5 Forward -232 -213 26.4505 0.00344
NP_440031.1_7 Forward -279 -260 25.2705 0.0146
NP_441114.1_3 Forward -393 -384 12.5861 0.231
NP_440923.1_10 Forward -297 -278 16.5191 0.298
NP_442183.1_1 Forward -311 -297 4.52282 0.26
NP_442397.1_9 Forward -209 -190 1.37609 0.283
NP_442347.1_2 Forward -127 -118 8.35786 0.0927
NP_442347.1_2 Forward -355 -346 3.93297 0.284
NP_442645.1_2 Forward -217 -198 -15.2418 0.194
NP_440547.1_8 Reverse -284 -303 16.5191 0.195
NP_440151.1_2 Reverse -285 -303 16.4396 0.222
NP_442802.1_6 Forward -326 -307 -5.01543 0.279
NP_441559.1_8 Forward -126 -112 -6.98191 0.281
NP_440997.1_6 Forward -364 -345 12.2908 0.228
NP_440717.1_1 Forward -121 -102 9.73422 0.24
NP_440717.1_1 Forward -230 -211 5.11266 0.283
NP_442069.1_6 Forward -304 -285 6.88262 0.224
NP_440748.1_5 Forward -398 -379 4.12936 0.201
NP_440695.1_6 Forward -166 -152 9.34482 0.288
NP_441199.1_6 Forward -362 -343 2.45773 0.198
NP_442993.1_1 Reverse -27 -43 -10.9545 0.231
NP_440677.1_6 Reverse -376 -395 7.96426 0.277
NP_442386.1_9 Reverse -193 -202 8.35743 0.201
NP_442386.1_9 Forward -350 -341 8.06244 0.209
NP_441254.1_1 Reverse -133 -146 11.0318 0.295
NP_442240.1_2 Reverse -337 -356 -19.3717 0.295
NP_442714.1_5 Forward -379 -360 18.4857 0.0292
NP_440684.1_9 Reverse -158 -172 9.43936 0.221
NP_440027.1_3 Forward -299 -281 16.0463 0.0944
NP_439996.1_1 Reverse -268 -287 7.96426 0.263
NP_439937.1_8 Forward -394 -375 -4.32711 0.283
NP_439937.1_9 Forward -123 -106 -12.9415 0.278
NP_439937.1_9 Reverse -142 -159 -16.2847 0.287
NP_440926.1_5 Forward -247 -228 10.7175 0.247
NP_442239.1_8 Reverse -154 -173 5.11266 0.285
NP_441789.1_7 Forward -304 -285 1.08032 0.245
NP_442285.1_3 Forward -270 -251 11.4058 0.254
NP_440316.1_10 Reverse -112 -122 7.25653 0.251
NP_441803.1_2 Forward -388 -369 -1.37718 0.298
NP_441572.1_7 Reverse -274 -293 -5.01543 0.248
NP_442384.1_10 Forward -394 -381 6.60746 0.0987
NP_442790.1_4 Reverse -340 -359 -11.9969 0.239
NP_440350.1_5 Reverse -156 -175 1.17943 0.158
NP_442280.1_10 Reverse -286 -304 7.40243 0.268
NP_442280.1_10 Reverse -281 -299 6.62323 0.27
NP_442280.1_10 Reverse -375 -393 4.67522 0.296
NP_440999.1_9 Reverse -370 -384 2.75286 0.144
NP_440888.1_2 Reverse -286 -300 5.99717 0.254
NP_442892.1_9 Forward -31 -17 12.6836 0.296
NP_439969.1_1 Forward -306 -287 -5.40875 0.288
NP_440982.1_1 Forward -305 -286 3.14526 0.297
NP_442578.1_5 Reverse -370 -389 6.58763 0.227
NP_442578.1_7 Forward -382 -375 6.72562 0.18
NP_441462.1_2 Reverse -27 -37 -0.806614 0.254
NP_441410.1_3 Forward -367 -348 4.71934 0.267
NP_441410.1_4 Forward -212 -193 16.7149 0.153
NP_442204.1_1 Reverse -292 -303 8.02348 0.107
NP_440783.1_5 Reverse -331 -350 -4.52377 0.276
NP_442120.1_10 Reverse -21 -40 -7.86702 0.224
NP_441052.1_2 Forward -356 -346 3.71661 0.175
NP_440436.1_4 Forward -202 -193 9.04574 0.092
NP_440436.1_4 Forward -344 -335 7.07914 0.142
NP_440314.1_9 Forward -357 -338 -9.047 0.258
NP_442813.1_5 Forward -214 -195 6.39097 0.213
NP_442366.1_3 Reverse -36 -54 -1.94747 0.219
NP_442366.1_3 Forward -146 -128 -2.24246 0.224
NP_443054.1_2 Forward -38 -24 0.491246 0.262
NP_442814.1_2 Reverse -250 -269 11.2092 0.181
NP_441555.1_5 Forward -136 -117 16.8132 0.245
NP_442515.1_1 Forward -359 -345 5.89945 0.105
NP_441046.1_2 Forward -385 -366 5.89931 0.221
NP_439960.1_10 Reverse -289 -307 -2.53746 0.255
NP_441596.1_7 Forward -259 -240 8.65258 0.258
NP_442006.1_2 Forward -380 -363 -10.0892 0.197
NP_442006.1_2 Forward -389 -372 -15.6941 0.228
NP_441003.1_3 Forward -93 -74 18.4857 0.192
NP_441570.1_1 Reverse -269 -287 -9.42063 0.137
NP_441078.1_4 Reverse -349 -358 -1.18024 0.237
NP_441078.1_4 Forward -358 -349 -1.96689 0.282
NP_441078.1_4 Forward -394 -385 -2.06522 0.295
NP_441539.1_10 Reverse -104 -123 7.57094 0.0623
NP_442348.1_2 Forward -146 -137 7.37455 0.28
NP_442443.1_1 Forward -388 -369 -3.73712 0.267
NP_441732.1_2 Forward -362 -346 -17.5427 0.27
NP_441030.1_6 Reverse -267 -286 11.8888 0.255
NP_442797.1_6 Reverse -373 -392 12.0064 0.238
NP_442489.1_7 Forward -394 -385 -1.57357 0.213
NP_442489.1_7 Forward -36 -27 -1.57357 0.213
NP_442489.1_7 Reverse -27 -36 -1.6719 0.235
NP_442913.1_10 Reverse -184 -203 -5.60541 0.271
NP_442776.1_1 Forward -394 -375 13.8641 0.122
NP_441185.1_6 Reverse -256 -275 2.0644 0.209
NP_442346.1_10 Forward -205 -186 -3.44213 0.294
NP_440831.1_3 Reverse -222 -241 5.41637 0.28
NP_443026.1_5 Reverse -330 -349 -5.70374 0.293
NP_441973.1_1 Forward -117 -102 -7.49326 0.293
NP_440875.1_9 Forward -297 -287 7.59334 0.255
NP_441239.1_9 Reverse -192 -204 2.98891 0.3
NP_440604.1_6 Reverse -269 -288 -4.13045 0.24
NP_440833.1_6 Reverse -121 -135 6.88214 0.296
NP_440949.1_7 Reverse -186 -205 12.0933 0.214
NP_442141.1_6 Reverse -228 -247 17.155 0.171
NP_440401.1_9 Forward -352 -345 14.5917 0.287
NP_442787.1_5 Forward -380 -361 7.37428 0.27
NP_441269.1_6 Reverse -157 -175 16.9321 0.136
NP_441868.1_4 Forward -296 -282 11.701 0.287
NP_440696.1_3 Reverse -280 -298 9.16393 0.149
NP_441926.1_3 Reverse -27 -43 3.89344 0.206
NP_442786.1_5 Forward -310 -291 6.29264 0.294
NP_440160.1_2 Reverse -238 -257 -2.55715 0.245
NP_440505.1_3 Forward -38 -28 7.35486 0.157
NP_441536.1_1 Forward -379 -360 16.6174 0.148
NP_440914.1_1 Forward -394 -384 12.0308 0.0684
NP_440914.1_1 Reverse -194 -204 8.02955 0.211
NP_441011.1_8 Reverse -350 -359 7.57121 0.17
NP_442533.1_6 Forward -394 -385 4.32629 0.184
NP_442533.1_6 Reverse -286 -295 2.75299 0.241
NP_442322.1_4 Forward -353 -336 -3.40342 0.247
NP_441028.1_6 Forward -127 -117 5.78111 0.243
NP_441028.1_6 Forward -118 -108 5.48612 0.255
NP_442664.1_10 Reverse -262 -281 7.96426 0.269
NP_441527.1_4 Forward -378 -359 -11.5072 0.282
NP_441527.1_4 Forward -49 -30 -12.8441 0.294
NP_440007.1_9 Reverse -292 -306 5.70279 0.249
NP_440007.1_9 Forward -39 -25 1.47456 0.285
NP_441972.1_3 Reverse -219 -238 11.0125 0.286
NP_439903.1_6 Forward -287 -268 2.06362 0.233
NP_442588.1_1 Reverse -278 -297 10.4225 0.199
NP_441930.1_2 Reverse -112 -122 14.1397 0.226
NP_442211.1_3 Reverse -183 -202 6.88843 0.295
NP_441510.2_7 Reverse -21 -35 10.5204 0.28
NP_442940.1_2 Forward -311 -292 -0.295539 0.296
NP_440473.1_1 Forward -302 -283 12.6071 0.219
NP_442514.1_5 Forward -307 -288 -4.42619 0.241
NP_442514.1_5 Forward -278 -259 -4.62285 0.244
NP_442862.1_3 Reverse -147 -164 18.9184 0.0816
NP_441885.1_5 Reverse -385 -395 -0.314959 0.195
NP_440191.1_4 Reverse -367 -377 13.2451 0.282
NP_443000.1_7 Forward -360 -350 2.33998 0.226
NP_440552.1_8 Reverse -45 -62 13.039 0.223
NP_440127.1_5 Reverse -292 -310 13.6872 0.195
NP_442451.1_2 Forward -357 -338 -11.1119 0.287
NP_439962.1_4 Reverse -285 -304 -6.58872 0.283
NP_441105.1_3 Forward -34 -15 -5.40875 0.219
NP_441105.1_3 Forward -400 -381 -5.50708 0.22
NP_440216.1_1 Forward -394 -380 -3.44199 0.082
NP_440172.1_1 Forward -394 -384 7.45319 0.0789
NP_440172.1_1 Reverse -27 -37 1.74999 0.299
NP_440167.1_3 Reverse -286 -305 11.3075 0.231
NP_442788.1_7 Forward -380 -361 11.3075 0.27
NP_442015.1_3 Forward -304 -285 11.405 0.288
NP_441226.1_7 Forward -288 -281 8.29857 0.205
NP_442379.1_10 Forward -320 -303 4.46374 0.148
NP_440416.1_9 Reverse -378 -397 -21.3384 0.294
NP_440261.1_5 Forward -357 -344 -12.2721 0.277
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAAATTGCCGATGTCCAGGCGGTAAAGGCGGAAATTAAAGAAGGCGTTAACCCCAAACGCTCCCTATACCTCAAAGTCAAACAGCGAAGAGATATTCCCCTCACCAGGGCAGGCCAACCCATTTCGCTCTCCCAATTGGAAAACCAGGGGGCTGAGTTAGCCCGCTTTCTAGGAGTACCCCTAGAAGGTTTGTAAATTGCCATTCCCGTGCTGTCAGATTTCACTACCAAGAACACCAAATTCAGGGCAGAAACGGGGGTTTGTTATGTTCAATTGGTCCCCATTTCCCCTAGAAAGTTATCTAAAGTGGACTAAGGTTCCTAACAAGGACTTTAAAGTTGGTTAATTTACATAAACGATGAAAGGCAGTTGCCATTAGCAATTACGGAGATTAGATTTT

CDS

ATGAGGATTTTACCGAATATCAGCCGAGCCACTTGGTTTGTGGGCATCTTTTTTGTCGTCAACATTTTACTGACTGCCTGCAATCAGCCCTCTGCCAATTCTTCAGCCGAGCCTTCCCCCACGGAAACCAACAGCCCAGTGGCCCAGGTAACAACGGATCCATATAAAGACTATAAGCCTCGCTTAAATGGCAAAGCCACTGTGGAAATGATGGTTAATGGCCAACCAATCATCATTGAAGTGGATGGGGAAAATGCGCCGATTACCGCCGGTAACTTTGTTGACTTAGTGGAACAGGGCTTCTACAACGGTTTAACTTTCCACAGGGTGGTAGATGGTTTTGTGGCCCAGGGGGGAGACCCCAAAGGTGACGGTACGGGGGGTTATGTGGATAAAAACACCCAACGTCCCCGCAATATTCCCTTGGAGATTAAGGTGGACCCTGCAGTAGAAAATGCACCAGAAACCCCGGTCTACAGTCGAGCCTTGGGCAATCAAGCTGGATTTCCGGTGATGCTGCCCCACAAAACCGGCGCTGTGGCTATGGCCCGCTCCCAAATGCCAGACTCCGCTTCTTCCCAGTTTTATTTCACCCTGTCCGATGAAACGGGATTTTTAGACGGTGATTATGCTGTGTTTGGTTACGTCACCCAGGGTATGGACGTAGTGCTGAAAATCAAACAGGGGGACAAGATTCAGTCCGCCAAGGTAATTACAGGGCAAAATAACTTAGAAAAATAG

Protein

MRILPNISRATWFVGIFFVVNILLTACNQPSANSSAEPSPTETNSPVAQVTTDPYKDYKPRLNGKATVEMMVNGQPIIIEVDGENAPITAGNFVDLVEQGFYNGLTFHRVVDGFVAQGGDPKGDGTGGYVDKNTQRPRNIPLEIKVDPAVENAPETPVYSRALGNQAGFPVMLPHKTGAVAMARSQMPDSASSQFYFTLSDETGFLDGDYAVFGYVTQGMDVVLKIKQGDKIQSAKVITGQNNLEK